F457717

General Info

Members Datasets Scaffolds Average Seq Length
514 318 492 320

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10249368|Ga0105237_102493682
Length 354
Sequence LLRPSIIGILQPEPGGLGTVRRWQGRTLSMRFRLIGVIVIAWLAILAAPDAAQAQENFPSRPIRIVIPYSPGSVADVFARIVGQNMQEQWKGSIVVESKSGANGSIAAEEVARAAPDGYTWLLVTTFFVASPALTASLRWDPIRDFVPVGQVCRAPNFFIVPTTLPVKNVAEYVALAKAKPGTLNYSHPGKGSTGHLGFELFKRLAGIDVTGIGYRGYPQMVPDIASGLINSTFLSANQALAQVQTGSIRIIGAISDGRSKYFPDVPTMAEQGFAEAQVTPWFGVVVPQGTPQPIVERISKALETALATPDVQRKLDVAGCEAKSAPLQIFADIIKSDVALWAKVVKEAGITAD

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
3 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
4 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
5 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
6 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
7 2855730933 Achromobacter sp. HZ28 Isolate Nodule
8 2855767633 Achromobacter sp. HZ34 Isolate Nodule
9 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
10 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
11 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
12 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
13 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
14 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
15 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
16 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
17 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
18 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
19 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
185 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
188 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
189 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
213 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
214 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
232 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
238 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
241 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
250 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
261 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
262 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
297 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
298 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
299 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
300 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
303 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
304 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
305 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
306 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
307 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
308 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
309 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
310 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
311 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
312 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
313 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
314 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
315 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
316 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
317 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
318 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.53
Metatranscriptomes 0.19
Isolates 4.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.81
Nodule 2.53
Rhizoplane 4.47
Rhizosphere 82.49
Stem 0
Stem Tuber 0
Unclassified 3.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10002303 3300003187 Bacteria 11661
2 JGI25406J46586_10000176 3300003203 Bacteria 28549
3 JGI25406J46586_10002931 3300003203 Bacteria 8050
4 JGI25406J46586_10004657 3300003203 Bacteria 6386
5 Ga0065715_10009494 3300005293 Bacteria 2762
6 Ga0065715_10163289 3300005293 Bacteria 1609
7 Ga0070658_10157316 3300005327 Unclassified 1905
8 Ga0070676_10006711 3300005328 Bacteria 6166
9 Ga0070676_10203244 3300005328 Bacteria 1300
10 Ga0070683_100090513 3300005329 Bacteria 2873
11 Ga0070670_100010326 3300005331 Bacteria 7969
12 Ga0070670_100031548 3300005331 Bacteria 4564
13 Ga0070670_100234534 3300005331 Bacteria 1597
14 Ga0068869_100041159 3300005334 Bacteria 3307
15 Ga0070666_10055178 3300005335 Bacteria 2681
16 Ga0070682_100037985 3300005337 Bacteria 2951
17 Ga0068868_100060481 3300005338 Bacteria 2999
18 Ga0070660_100430632 3300005339 Bacteria 1093
19 Ga0070689_100047319 3300005340 Bacteria 3317
20 Ga0070689_100139390 3300005340 Bacteria 1950
21 Ga0070691_10020432 3300005341 Bacteria 3060
22 Ga0070661_100083789 3300005344 Bacteria 2356
23 Ga0070668_100074908 3300005347 Bacteria 2641
24 Ga0070669_100082803 3300005353 Bacteria 2392
25 Ga0070669_100173708 3300005353 Bacteria 1681
26 Ga0070675_100087234 3300005354 Bacteria 2609
27 Ga0070671_100069164 3300005355 Bacteria 2944
28 Ga0070671_100074978 3300005355 Bacteria 2826
29 Ga0070671_100173532 3300005355 Bacteria 1824
30 Ga0070674_100005894 3300005356 Bacteria 7123
31 Ga0070674_100381550 3300005356 Bacteria 1147
32 Ga0070673_100131078 3300005364 Bacteria 2103
33 Ga0070673_100274964 3300005364 Bacteria 1475
34 Ga0070688_100083719 3300005365 Bacteria 2070
35 Ga0070688_100190445 3300005365 Bacteria 1428
36 Ga0070659_100134884 3300005366 Bacteria 2007
37 Ga0070659_100157079 3300005366 Bacteria 1858
38 Ga0070667_100113682 3300005367 Bacteria 2350
39 Ga0070667_100123857 3300005367 Bacteria 2251
40 Ga0070713_100012869 3300005436 Bacteria 6154
41 Ga0070713_100086219 3300005436 Bacteria 2692
42 Ga0070710_10001820 3300005437 Bacteria 10067
43 Ga0070710_10095055 3300005437 Bacteria 1764
44 Ga0070701_10161139 3300005438 Bacteria 1299
45 Ga0070701_10197455 3300005438 Bacteria 1187
46 Ga0070711_100002350 3300005439 Bacteria 10755
47 Ga0070705_100009020 3300005440 Bacteria 4950
48 Ga0070705_100030689 3300005440 Bacteria 2969
49 Ga0070694_100094021 3300005444 Bacteria 2108
50 Ga0070678_100002615 3300005456 Bacteria 9903
51 Ga0070678_100060688 3300005456 Bacteria 2784
52 Ga0070662_100105736 3300005457 Bacteria 2137
53 Ga0070681_10017680 3300005458 Bacteria 7126
54 Ga0070685_10148907 3300005466 Bacteria 1481
55 Ga0070706_100269081 3300005467 Bacteria 1590
56 Ga0070699_100033765 3300005518 Bacteria 4421
57 Ga0070684_100017844 3300005535 Bacteria 5833
58 Ga0070684_100036518 3300005535 Bacteria 4211
59 Ga0070697_100033182 3300005536 Bacteria 4158
60 Ga0070697_100042882 3300005536 Bacteria 3662
61 Ga0070697_100157558 3300005536 Bacteria 1917
62 Ga0068853_100142264 3300005539 Bacteria 2154
63 Ga0070686_100087168 3300005544 Bacteria 2080
64 Ga0070686_100304486 3300005544 Bacteria 1183
65 Ga0070695_100003903 3300005545 Bacteria 8706
66 Ga0070695_100076688 3300005545 Bacteria 2202
67 Ga0070695_100122898 3300005545 Bacteria 1778
68 Ga0070696_100004498 3300005546 Bacteria 9308
69 Ga0070696_100032944 3300005546 Bacteria 3557
70 Ga0070696_100040313 3300005546 Bacteria 3225
71 Ga0070693_100073402 3300005547 Bacteria 2021
72 Ga0070665_100008665 3300005548 Bacteria 10293
73 Ga0070665_100044294 3300005548 Bacteria 4469
74 Ga0070665_100095491 3300005548 Bacteria 2978
75 Ga0070665_100096673 3300005548 Bacteria 2958
76 Ga0068855_100032479 3300005563 Bacteria 6232
77 Ga0068855_100058610 3300005563 Bacteria 4509
78 Ga0070664_100177969 3300005564 Bacteria 1889
79 Ga0068857_100243207 3300005577 Bacteria 1648
80 Ga0068854_100195760 3300005578 Bacteria 1586
81 Ga0070702_100115205 3300005615 Bacteria 1674
82 Ga0068852_100130356 3300005616 Bacteria 2315
83 Ga0068859_100184583 3300005617 Bacteria 2169
84 Ga0068859_100394360 3300005617 Bacteria 1480
85 Ga0068864_100018636 3300005618 Bacteria 5800
86 Ga0068864_100037368 3300005618 Bacteria 4144
87 Ga0068864_100273226 3300005618 Bacteria 1575
88 Ga0068861_100087663 3300005719 Bacteria 2449
89 Ga0068851_10014696 3300005834 Bacteria 3720
90 Ga0068870_10042059 3300005840 Bacteria 2377
91 Ga0068863_100194658 3300005841 Bacteria 1949
92 Ga0068863_100301430 3300005841 Bacteria 1555
93 Ga0068858_100074954 3300005842 Bacteria 3142
94 Ga0068860_100283052 3300005843 Bacteria 1621
95 Ga0068862_100192384 3300005844 Bacteria 1836
96 Ga0068862_100220965 3300005844 Bacteria 1715
97 Ga0081455_10014642 3300005937 Bacteria 7670
98 Ga0081540_1002588 3300005983 Bacteria 14693
99 Ga0081540_1023745 3300005983 Bacteria 3576
100 Ga0081540_1032500 3300005983 Bacteria 2849
101 Ga0081540_1042645 3300005983 Bacteria 2338
102 Ga0081539_10000478 3300005985 Bacteria 84639
103 Ga0081539_10000563 3300005985 Bacteria 76531
104 Ga0081539_10000572 3300005985 Bacteria 76133
105 Ga0081539_10012172 3300005985 Bacteria 6676
106 Ga0070717_10012420 3300006028 Bacteria 6494
107 Ga0070717_10081260 3300006028 Bacteria 2721
108 Ga0075365_10021229 3300006038 Bacteria 4047
109 Ga0075363_100026963 3300006048 Bacteria 2943
110 Ga0075363_100142369 3300006048 Bacteria 1351
111 Ga0075364_10096153 3300006051 Bacteria 1969
112 Ga0070716_100052869 3300006173 Bacteria 2314
113 Ga0070712_100035227 3300006175 Bacteria 3397
114 Ga0075367_10034693 3300006178 Bacteria 2916
115 Ga0075366_10005051 3300006195 Bacteria 7132
116 Ga0097621_100003275 3300006237 Bacteria 11136
117 Ga0097621_100053721 3300006237 Bacteria 3284
118 Ga0097621_100271380 3300006237 Bacteria 1491
119 Ga0075370_10018204 3300006353 Bacteria 3808
120 Ga0075370_10163232 3300006353 Bacteria 1308
121 Ga0068871_100022393 3300006358 Bacteria 4870
122 Ga0068871_100235355 3300006358 Bacteria 1591
123 Ga0075428_100001924 3300006844 Bacteria 22276
124 Ga0075428_100317846 3300006844 Bacteria 1673
125 Ga0075430_100034059 3300006846 Bacteria 4322
126 Ga0075430_100078159 3300006846 Bacteria 2774
127 Ga0075429_100000731 3300006880 Bacteria 25770
128 Ga0075436_100004664 3300006914 Bacteria 9392
129 Ga0075436_100015616 3300006914 Bacteria 5199
130 Ga0075436_100056989 3300006914 Bacteria 2699
131 Ga0075436_100060981 3300006914 Bacteria 2606
132 Ga0075436_100070220 3300006914 Bacteria 2421
133 Ga0075436_100147286 3300006914 Bacteria 1656
134 Ga0097620_100184566 3300006931 Bacteria 2169
135 Ga0097620_100394368 3300006931 Bacteria 1480
136 Ga0099794_10006763 3300007265 Bacteria 4664
137 Ga0099795_10001606 3300007788 Bacteria 4990
138 Ga0105240_10004735 3300009093 Bacteria 20540
139 Ga0105240_10027925 3300009093 Bacteria 7381
140 Ga0105240_10050277 3300009093 Bacteria 5257
141 Ga0111539_10122652 3300009094 Bacteria 3046
142 Ga0111539_10159096 3300009094 Bacteria 2642
143 Ga0111539_10191553 3300009094 Bacteria 2386
144 Ga0111539_10285891 3300009094 Bacteria 1919
145 Ga0105245_10028830 3300009098 Bacteria 4899
146 Ga0105245_10447122 3300009098 Bacteria 1300
147 Ga0105247_10015911 3300009101 Bacteria 4504
148 Ga0105247_10040828 3300009101 Bacteria 2838
149 Ga0105247_10114399 3300009101 Bacteria 1740
150 Ga0105247_10157267 3300009101 Bacteria 1502
151 Ga0114129_10004193 3300009147 Bacteria 20367
152 Ga0114129_10440880 3300009147 Bacteria 1710
153 Ga0105243_10062838 3300009148 Bacteria 2974
154 Ga0105248_10038641 3300009177 Bacteria 5343
155 Ga0105237_10008183 3300009545 Bacteria 11357
156 Ga0105237_10073014 3300009545 Bacteria 3424
157 Ga0105237_10249368 3300009545 Bacteria 1777
158 Ga0105237_10410746 3300009545 Bacteria 1359
159 Ga0105238_10008143 3300009551 Bacteria 10484
160 Ga0105238_10044172 3300009551 Bacteria 4506
161 Ga0105249_10440100 3300009553 Bacteria 1341
162 Ga0105239_10024271 3300010375 Bacteria 6678
163 Ga0105239_10064973 3300010375 Bacteria 4006
164 Ga0105239_10066968 3300010375 Bacteria 3945
165 Ga0105246_10017489 3300011119 Bacteria 4557
166 Ga0105246_10240837 3300011119 Bacteria 1430
167 Ga0157370_10017812 3300013104 Bacteria 7158
168 Ga0157370_10054733 3300013104 Bacteria 3803
169 Ga0157369_10007198 3300013105 Bacteria 12825
170 Ga0157374_10090626 3300013296 Bacteria 2915
171 Ga0157374_10100227 3300013296 Bacteria 2776
172 Ga0157378_10005363 3300013297 Bacteria 11249
173 Ga0157378_10263238 3300013297 Bacteria 1655
174 Ga0157378_10569448 3300013297 Bacteria 1140
175 Ga0163162_10161770 3300013306 Bacteria 2360
176 Ga0157375_10137314 3300013308 Bacteria 2570
177 Ga0157375_10357761 3300013308 Bacteria 1626
178 Ga0163163_10025386 3300014325 Bacteria 5649
179 Ga0157380_10175187 3300014326 Bacteria 1878
180 Ga0157380_10349933 3300014326 Bacteria 1382
181 Ga0157377_10035025 3300014745 Bacteria 2751
182 Ga0157377_10113305 3300014745 Bacteria 1633
183 Ga0157379_10026309 3300014968 Bacteria 5179
184 Ga0157379_10305551 3300014968 Bacteria 1450
185 Ga0157376_10042314 3300014969 Bacteria 3734
186 Ga0209025_1000049 3300025294 Bacteria 333459
187 Ga0209758_1016130 3300025297 Bacteria 3812
188 Ga0209758_1020899 3300025297 Bacteria 3074
189 Ga0207697_10007349 3300025315 Bacteria 4922
190 Ga0207697_10026295 3300025315 Bacteria 2380
191 Ga0207682_10001086 3300025893 Bacteria 12557
192 Ga0207682_10006592 3300025893 Bacteria 4672
193 Ga0207692_10003796 3300025898 Bacteria 5937
194 Ga0207710_10022918 3300025900 Bacteria 2680
195 Ga0207699_10025931 3300025906 Bacteria 3225
196 Ga0207699_10028299 3300025906 Bacteria 3113
197 Ga0207645_10013503 3300025907 Bacteria 5501
198 Ga0207645_10020198 3300025907 Bacteria 4362
199 Ga0207643_10022040 3300025908 Bacteria 3505
200 Ga0207684_10221269 3300025910 Bacteria 1634
201 Ga0207707_10001083 3300025912 Bacteria 26026
202 Ga0207707_10001628 3300025912 Bacteria 20704
203 Ga0207707_10014916 3300025912 Bacteria 6767
204 Ga0207707_10120631 3300025912 Bacteria 2292
205 Ga0207695_10014198 3300025913 Bacteria 9450
206 Ga0207671_10109000 3300025914 Bacteria 2105
207 Ga0207693_10004729 3300025915 Bacteria 11452
208 Ga0207693_10053764 3300025915 Bacteria 3159
209 Ga0207663_10001198 3300025916 Bacteria 11978
210 Ga0207660_10003821 3300025917 Bacteria 9815
211 Ga0207660_10023139 3300025917 Bacteria 4193
212 Ga0207660_10073605 3300025917 Bacteria 2491
213 Ga0207657_10003922 3300025919 Bacteria 15790
214 Ga0207657_10034027 3300025919 Bacteria 4588
215 Ga0207649_10017748 3300025920 Bacteria 4035
216 Ga0207649_10156996 3300025920 Bacteria 1573
217 Ga0207681_10142754 3300025923 Bacteria 1785
218 Ga0207694_10069799 3300025924 Bacteria 2745
219 Ga0207694_10087445 3300025924 Bacteria 2455
220 Ga0207650_10005539 3300025925 Bacteria 8616
221 Ga0207650_10043753 3300025925 Bacteria 3288
222 Ga0207650_10044899 3300025925 Bacteria 3249
223 Ga0207687_10016510 3300025927 Bacteria 4849
224 Ga0207700_10001731 3300025928 Bacteria 12395
225 Ga0207700_10005989 3300025928 Bacteria 7317
226 Ga0207700_10040991 3300025928 Bacteria 3384
227 Ga0207664_10010509 3300025929 Bacteria 6536
228 Ga0207664_10073802 3300025929 Bacteria 2754
229 Ga0207644_10045147 3300025931 Bacteria 3134
230 Ga0207644_10161886 3300025931 Bacteria 1740
231 Ga0207690_10092720 3300025932 Bacteria 2138
232 Ga0207706_10012435 3300025933 Bacteria 7756
233 Ga0207706_10136396 3300025933 Bacteria 2159
234 Ga0207686_10295404 3300025934 Bacteria 1201
235 Ga0207709_10031030 3300025935 Bacteria 3116
236 Ga0207704_10201000 3300025938 Bacteria 1458
237 Ga0207665_10002908 3300025939 Bacteria 11484
238 Ga0207665_10107693 3300025939 Bacteria 1955
239 Ga0207691_10003161 3300025940 Bacteria 16108
240 Ga0207711_10036184 3300025941 Bacteria 4188
241 Ga0207711_10509957 3300025941 Bacteria 1121
242 Ga0207689_10006304 3300025942 Bacteria 10506
243 Ga0207689_10012200 3300025942 Bacteria 7352
244 Ga0207679_10006216 3300025945 Bacteria 7540
245 Ga0207667_10029619 3300025949 Bacteria 5935
246 Ga0207667_10134944 3300025949 Bacteria 2541
247 Ga0207712_10196859 3300025961 Bacteria 1595
248 Ga0207712_10272412 3300025961 Bacteria 1378
249 Ga0207712_10348706 3300025961 Bacteria 1230
250 Ga0207668_10166657 3300025972 Bacteria 1723
251 Ga0207668_10437961 3300025972 Bacteria 1113
252 Ga0207658_10097353 3300025986 Bacteria 2297
253 Ga0207708_10008455 3300026075 Bacteria 7620
254 Ga0207641_10083585 3300026088 Bacteria 2777
255 Ga0207648_10056359 3300026089 Bacteria 3430
256 Ga0207676_10068564 3300026095 Bacteria 2837
257 Ga0207674_10048558 3300026116 Bacteria 4344
258 Ga0207674_10064569 3300026116 Bacteria 3692
259 Ga0207675_100019128 3300026118 Bacteria 6394
260 Ga0207683_10005256 3300026121 Bacteria 11111
261 Ga0207683_10007025 3300026121 Bacteria 9656
262 Ga0207683_10107188 3300026121 Bacteria 2499
263 Ga0207698_10055262 3300026142 Bacteria 3059
264 Ga0207698_10123289 3300026142 Bacteria 2198
265 Ga0209179_1010313 3300027512 Bacteria 1626
266 Ga0209588_1000354 3300027671 Bacteria 11922
267 Ga0207428_10002206 3300027907 Bacteria 19579
268 Ga0268266_10000988 3300028379 Bacteria 35821
269 Ga0268266_10002854 3300028379 Bacteria 18005
270 Ga0268266_10069800 3300028379 Bacteria 3045
271 Ga0268266_10162827 3300028379 Bacteria 2019
272 Ga0268265_10042329 3300028380 Bacteria 3379
273 Ga0268265_10156915 3300028380 Bacteria 1927
274 Ga0268265_10156961 3300028380 Bacteria 1927
275 Ga0265332_10029911 3300031238 Bacteria 2379
276 Ga0265325_10044886 3300031241 Bacteria 2299
277 Ga0307408_100207130 3300031548 Bacteria 1591
278 Ga0265314_10095880 3300031711 Bacteria 1920
279 Ga0265342_10017730 3300031712 Bacteria 4624
280 Ga0307406_10311338 3300031901 Bacteria 1214
281 Ga0307416_100014809 3300032002 Bacteria 5361
282 Ga0307415_100109282 3300032126 Bacteria 2048
283 Ga0307510_10021753 3300033180 Bacteria 7467
284 Ga0315911_1000009 3300033442 Bacteria 379354
285 Ga0316215_1004066 3300033544 Bacteria 1400
286 Ga0373926_0009865 3300035083 Bacteria 3193
287 Ga0373934_0001668 3300035086 Bacteria 8155
288 Ga0373951_0027143 3300035091 Bacteria 1336
289 Ga0373936_0028901 3300035113 Bacteria 2181
290 Ga0373936_0039824 3300035113 Bacteria 1881
291 Ga0373945_0093465 3300035116 Bacteria 1167
292 Ga0373953_0000108 3300035117 Bacteria 20124
293 Ga0373953_0001849 3300035117 Bacteria 6262
294 Ga0373954_0000085 3300035118 Bacteria 31872
295 Ga0373954_0039655 3300035118 Bacteria 2193
296 Ga0373956_0000272 3300035119 Bacteria 20783
297 Ga0373956_0015106 3300035119 Bacteria 3229
298 Ga0373957_0000129 3300035120 Bacteria 18551
299 Ga0373957_0034807 3300035120 Bacteria 1868
300 Ga0373943_0030837 3300035170 Bacteria 2541
301 Ga0373946_0029262 3300035171 Bacteria 2191
302 Ga0373955_0000288 3300035172 Bacteria 20919
303 Ga0373955_0007868 3300035172 Bacteria 4917
304 Ga0373961_0013839 3300035241 Bacteria 2040
305 Ga0373924_0004383 3300035410 Bacteria 4925
306 Ga0373924_0052370 3300035410 Bacteria 1694
307 Ga0373935_0061629 3300035692 Bacteria 2401
308 Ga0373935_0122182 3300035692 Bacteria 1741
309 Ga0373927_0008450 3300035695 Bacteria 6925
310 Ga0373927_0016271 3300035695 Bacteria 4908
311 Ga0373927_0080511 3300035695 Bacteria 2110
312 Ga0373927_0118924 3300035695 Bacteria 1724
313 Ga0373933_0000059 3300035724 Bacteria 65716
314 Ga0373933_0000913 3300035724 Bacteria 18054
315 Ga0373947_0186018 3300035725 Bacteria 1354
316 Ga0373937_0005718 3300036401 Bacteria 10679
317 Ga0373937_0055333 3300036401 Bacteria 3642
318 Ga0373937_0118598 3300036401 Bacteria 2465
319 Ga0373937_0203872 3300036401 Bacteria 1860
320 Ga0373937_0255615 3300036401 Bacteria 1651
321 Ga0373937_0585347 3300036401 Bacteria 1059
322 Ga0372808_001187 3300036459 Bacteria 2596
323 Ga0373925_0018489 3300037068 Bacteria 5066
324 Ga0373925_0043524 3300037068 Bacteria 3333
325 Ga0373925_0117684 3300037068 Bacteria 2059
326 Ga0395899_0097575 3300037312 Bacteria 2124
327 Ga0395900_0158604 3300037418 Bacteria 2309
328 Ga0395898_0547072 3300037466 Bacteria 1100
329 Ga0395901_0116169 3300038443 Bacteria 2811
330 Ga0436365_0965344 3300039437 Bacteria 2893
331 Ga0439453_0001575 3300041408 Bacteria 2966
332 Ga0439443_005217 3300042003 Bacteria 1727
333 Ga0439440_0013396 3300042993 Bacteria 1758
334 Ga0451576_0433871 3300045051 Bacteria 1379
335 Ga0495592_0000795 3300046454 Bacteria 21828
336 Ga0495592_0008545 3300046454 Bacteria 7687
337 Ga0495603_0062661 3300046455 Bacteria 2195
338 Ga0495603_0067705 3300046455 Bacteria 2101
339 Ga0495629_0000582 3300046459 Bacteria 29684
340 Ga0495629_0041233 3300046459 Bacteria 3249
341 Ga0495629_0068768 3300046459 Bacteria 2471
342 Ga0495651_0002961 3300046462 Bacteria 13121
343 Ga0495651_0040411 3300046462 Bacteria 3627
344 Ga0495653_0002685 3300046463 Bacteria 14171
345 Ga0495653_0033437 3300046463 Bacteria 4074
346 Ga0495580_0191331 3300046472 Bacteria 1411
347 Ga0495582_0212914 3300046473 Bacteria 1105
348 Ga0495639_0041471 3300046475 Bacteria 2073
349 Ga0495639_0106941 3300046475 Bacteria 1325
350 Ga0495662_0046614 3300046476 Bacteria 2093
351 Ga0495594_0099678 3300046499 Bacteria 1634
352 Ga0495606_0004206 3300046507 Bacteria 14566
353 Ga0495608_0000569 3300046511 Bacteria 25372
354 Ga0495608_0214413 3300046511 Bacteria 1209
355 Ga0495618_0015858 3300046514 Bacteria 4599
356 Ga0495618_0110598 3300046514 Bacteria 1759
357 Ga0495628_0010360 3300046516 Bacteria 7926
358 Ga0495628_0064601 3300046516 Bacteria 2865
359 Ga0495630_0055082 3300046517 Bacteria 2980
360 Ga0495631_0102707 3300046518 Bacteria 1230
361 Ga0495643_0071107 3300046522 Bacteria 1827
362 Ga0495652_0168347 3300046529 Bacteria 1693
363 Ga0495665_0022675 3300046531 Bacteria 3374
364 Ga0495640_0019903 3300046533 Bacteria 4950
365 Ga0495640_0031138 3300046533 Bacteria 3810
366 Ga0495640_0044604 3300046533 Bacteria 3082
367 Ga0495587_0007583 3300046536 Bacteria 7020
368 Ga0495587_0108406 3300046536 Bacteria 1596
369 Ga0495587_0117493 3300046536 Bacteria 1525
370 Ga0495598_0025778 3300046537 Bacteria 1606
371 Ga0495621_0013721 3300046539 Bacteria 2551
372 Ga0495645_0247448 3300046543 Bacteria 1186
373 Ga0495667_0000128 3300046559 Bacteria 54804
374 Ga0495667_0051416 3300046559 Bacteria 2718
375 Ga0495668_0113248 3300046616 Bacteria 1484
376 Ga0495634_0029815 3300046642 Bacteria 3774
377 Ga0495634_0032598 3300046642 Bacteria 3583
378 Ga0495625_0072268 3300046660 Bacteria 2420
379 Ga0495635_0006917 3300046663 Bacteria 7923
380 Ga0495635_0027935 3300046663 Bacteria 3923
381 Ga0495659_0100728 3300046664 Bacteria 1119
382 Ga0495657_0003126 3300046675 Bacteria 13671
383 Ga0495599_0002733 3300046678 Bacteria 10293
384 Ga0495599_0023684 3300046678 Bacteria 3838
385 Ga0495623_0006786 3300046679 Bacteria 7448
386 Ga0495623_0021930 3300046679 Bacteria 4125
387 Ga0495646_0000412 3300046680 Bacteria 22576
388 Ga0495647_0032736 3300046681 Bacteria 1939
389 Ga0495613_0050085 3300046689 Bacteria 3081
390 Ga0495613_0092184 3300046689 Bacteria 2194
391 Ga0495613_0145850 3300046689 Bacteria 1689
392 Ga0495600_0005826 3300046809 Bacteria 7449
393 Ga0495600_0022948 3300046809 Bacteria 4012
394 Ga0495600_0045403 3300046809 Bacteria 2866
395 Ga0495600_0159801 3300046809 Bacteria 1457
396 Ga0495604_0007172 3300047317 Bacteria 8829
397 Ga0495636_0080644 3300047318 Bacteria 1401
398 Ga0495674_0112245 3300047319 Bacteria 2309
399 Ga0495672_0002625 3300047320 Bacteria 16239
400 Ga0495676_0064726 3300047321 Bacteria 2841
401 Ga0495680_0001973 3300047322 Bacteria 21554
402 Ga0495680_0030826 3300047322 Bacteria 4372
403 Ga0495680_0269369 3300047322 Bacteria 1203
404 Ga0495675_0000345 3300047444 Bacteria 32608
405 Ga0495675_0116651 3300047444 Bacteria 1664
406 Ga0495681_0115136 3300047470 Bacteria 1160
407 Ga0495684_0000650 3300047471 Bacteria 27935
408 Ga0495684_0253826 3300047471 Bacteria 1278
409 Ga0495593_0010605 3300047673 Bacteria 5315
410 Ga0495602_0005890 3300048088 Bacteria 12875
411 Ga0495602_0136638 3300048088 Bacteria 1946
412 Ga0495614_0064844 3300048089 Bacteria 1571
413 Ga0496100_0003436 3300048903 Bacteria 8258
414 Ga0496100_0383985 3300048903 Bacteria 1067
415 Ga0496101_0002458 3300048904 Bacteria 11379
416 Ga0496102_0007852 3300048905 Bacteria 9117
417 Ga0496102_0269587 3300048905 Bacteria 1605
418 Ga0496103_0026546 3300048906 Bacteria 3505
419 Ga0496104_0376988 3300048907 Bacteria 1331
420 Ga0496105_0106760 3300048908 Bacteria 2311
421 Ga0496107_0005677 3300048910 Bacteria 8538
422 Ga0496107_0038685 3300048910 Bacteria 3421
423 Ga0496107_0289117 3300048910 Bacteria 1220
424 Ga0496108_0066237 3300048911 Bacteria 3045
425 Ga0496108_0112453 3300048911 Bacteria 2330
426 Ga0496110_0084535 3300048913 Bacteria 2832
427 Ga0496111_0017403 3300048914 Bacteria 4970
428 Ga0496112_0000004 3300048915 Bacteria 553294
429 Ga0496113_0396435 3300048916 Bacteria 1108
430 Ga0496114_0037134 3300048917 Bacteria 4029
431 Ga0496114_0112571 3300048917 Bacteria 2333
432 Ga0496114_0117658 3300048917 Bacteria 2283
433 Ga0496114_0454663 3300048917 Bacteria 1134
434 Ga0496115_0007883 3300048918 Bacteria 7857
435 Ga0496115_0228656 3300048918 Bacteria 1534
436 Ga0496121_0100781 3300048924 Bacteria 2229
437 Ga0496121_0104243 3300048924 Bacteria 2180
438 Ga0496121_0179792 3300048924 Bacteria 1528
439 Ga0496126_0018962 3300048929 Bacteria 6795
440 Ga0496126_0106054 3300048929 Bacteria 2453
441 Ga0496126_0117965 3300048929 Bacteria 2304
442 Ga0496126_0119268 3300048929 Bacteria 2289
443 Ga0496126_0410077 3300048929 Bacteria 1097
444 Ga0501032_0048780 3300049569 Bacteria 2859
445 Ga0501034_0168835 3300049571 Bacteria 2156
446 Ga0501047_0138456 3300049581 Bacteria 2313
447 Ga0501047_0200457 3300049581 Bacteria 1857
448 Ga0501067_0058932 3300049583 Bacteria 2126
449 Ga0501070_0080339 3300049586 Bacteria 2698
450 Ga0501044_0188213 3300049823 Bacteria 2028
451 nmdc:mga03683_121994_c1 3300050489 Bacteria 1159
452 nmdc:mga00v17_263987_c1 3300050491 Bacteria 1117
453 nmdc:mga00v17_48594_c1 3300050491 Bacteria 2173
454 nmdc:mga0k408_16740_c1 3300050493 Bacteria 4075
455 nmdc:mga06z11_25270_c1 3300050494 Bacteria 2813
456 nmdc:mga06z11_76521_c1 3300050494 Bacteria 1785
457 nmdc:mga05p37_1414_c1 3300050507 Bacteria 27904
458 nmdc:mga05p37_187813_c1 3300050507 Bacteria 2511
459 nmdc:mga09592_1633_c1 3300050508 Bacteria 18055
460 nmdc:mga0qj67_7392_c1 3300050509 Bacteria 8120
461 nmdc:mga0qj67_84257_c1 3300050509 Bacteria 2549
462 nmdc:mga06r32_377231_c1 3300050510 Bacteria 1401
463 nmdc:mga08y16_17999_c1 3300050511 Bacteria 7442
464 nmdc:mga08y16_304525_c1 3300050511 Bacteria 1642
465 nmdc:mga08y16_317718_c1 3300050511 Bacteria 1603
466 nmdc:mga0rr50_46035_c1 3300050513 Bacteria 3210
467 nmdc:mga08x19_11990_c1 3300050514 Bacteria 5217
468 nmdc:mga08x19_25561_c1 3300050514 Bacteria 3679
469 nmdc:mga08x19_57375_c1 3300050514 Bacteria 2516
470 Ga0495612_0016270 3300053078 Bacteria 2980
471 Ga0500635_0035006 3300053080 Bacteria 1648
472 Ga0495595_0000309 3300053084 Bacteria 19034
473 Ga0495595_0052343 3300053084 Bacteria 1894
474 Ga0495619_0004295 3300053085 Bacteria 9087
475 Ga0495619_0091658 3300053085 Bacteria 2057
476 Ga0495619_0258032 3300053085 Bacteria 1208
477 Ga0500566_0000100 3300053094 Bacteria 43788
478 Ga0500640_005859 3300053095 Bacteria 4634
479 Ga0500572_000176 3300053111 Bacteria 22627
480 Ga0500595_047302 3300053119 Bacteria 1348
481 Ga0500608_028998 3300053122 Bacteria 2615
482 Ga0500614_000141 3300053123 Bacteria 17860
483 Ga0500559_0003396 3300053136 Bacteria 7846
484 Ga0500603_000017 3300053150 Bacteria 56324
485 Ga0500603_000889 3300053150 Bacteria 7110
486 Ga0500616_0124425 3300053153 Bacteria 1227
487 Ga0500634_0071057 3300053161 Bacteria 1821
488 Ga0500638_011827 3300053162 Bacteria 3890
489 Ga0500639_000525 3300053163 Bacteria 19105
490 Ga0500637_0004916 3300053178 Bacteria 6417
491 Ga0500637_0009251 3300053178 Bacteria 5007
492 Ga0500601_006898 3300053737 Bacteria 1256

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_317718_c1 nmdc:mga08y16_317718_c1_143_928 257
2 3300005458 Ga0070681_10017680 Ga0070681_100176803 279
3 3300025912 Ga0207707_10001628 Ga0207707_1000162813 279
4 3300005544 Ga0070686_100304486 Ga0070686_1003044861 281
5 3300025917 Ga0207660_10073605 Ga0207660_100736051 281
6 3300035695 Ga0373927_0008450 Ga0373927_0008450_4890_5765 284
7 3300046455 Ga0495603_0067705 Ga0495603_0067705_919_1794 284
8 3300046472 Ga0495580_0191331 Ga0495580_0191331_493_1368 284
9 3300046499 Ga0495594_0099678 Ga0495594_0099678_355_1230 284
10 3300014968 Ga0157379_10026309 Ga0157379_100263092 285
11 3300009177 Ga0105248_10038641 Ga0105248_100386415 286
12 3300025941 Ga0207711_10036184 Ga0207711_100361842 286
13 3300003203 JGI25406J46586_10004657 JGI25406J46586_100046576 290
14 3300005985 Ga0081539_10000572 Ga0081539_1000057224 290
15 3300050493 nmdc:mga0k408_16740_c1 nmdc:mga0k408_16740_c1_3039_3914 291
16 3300045051 Ga0451576_0433871 Ga0451576_0433871_32_946 292
17 3300009147 Ga0114129_10440880 Ga0114129_104408803 293
18 3300050507 nmdc:mga05p37_187813_c1 nmdc:mga05p37_187813_c1_17_976 293
19 3300006914 Ga0075436_100060981 Ga0075436_1000609813 294
20 3300050511 nmdc:mga08y16_304525_c1 nmdc:mga08y16_304525_c1_307_1281 294
21 3300050513 nmdc:mga0rr50_46035_c1 nmdc:mga0rr50_46035_c1_326_1288 294
22 3300005440 Ga0070705_100030689 Ga0070705_1000306892 296
23 3300005536 Ga0070697_100157558 Ga0070697_1001575582 296
24 3300005545 Ga0070695_100122898 Ga0070695_1001228981 296
25 3300006914 Ga0075436_100056989 Ga0075436_1000569891 296
26 3300003203 JGI25406J46586_10000176 JGI25406J46586_100001767 297
27 3300005985 Ga0081539_10000563 Ga0081539_1000056310 297
28 3300009093 Ga0105240_10004735 Ga0105240_1000473511 301
29 3300025913 Ga0207695_10014198 Ga0207695_100141986 301
30 3300005328 Ga0070676_10006711 Ga0070676_100067114 302
31 3300005335 Ga0070666_10055178 Ga0070666_100551782 302
32 3300005353 Ga0070669_100173708 Ga0070669_1001737081 302
33 3300005354 Ga0070675_100087234 Ga0070675_1000872343 302
34 3300005355 Ga0070671_100069164 Ga0070671_1000691642 302
35 3300005356 Ga0070674_100005894 Ga0070674_1000058944 302
36 3300005365 Ga0070688_100190445 Ga0070688_1001904452 302
37 3300005367 Ga0070667_100113682 Ga0070667_1001136821 302
38 3300005438 Ga0070701_10161139 Ga0070701_101611391 302
39 3300005457 Ga0070662_100105736 Ga0070662_1001057362 302
40 3300011119 Ga0105246_10240837 Ga0105246_102408372 302
41 3300013308 Ga0157375_10357761 Ga0157375_103577612 302
42 3300025893 Ga0207682_10006592 Ga0207682_100065922 302
43 3300025907 Ga0207645_10013503 Ga0207645_100135034 302
44 3300025923 Ga0207681_10142754 Ga0207681_101427542 302
45 3300025925 Ga0207650_10044899 Ga0207650_100448992 302
46 3300025933 Ga0207706_10136396 Ga0207706_101363962 302
47 3300025940 Ga0207691_10003161 Ga0207691_1000316116 302
48 3300026089 Ga0207648_10056359 Ga0207648_100563592 302
49 3300026121 Ga0207683_10007025 Ga0207683_100070253 302
50 3300048910 Ga0496107_0038685 Ga0496107_0038685_30_950 303
51 3300009094 Ga0111539_10122652 Ga0111539_101226523 306
52 3300031548 Ga0307408_100207130 Ga0307408_1002071301 307
53 3300031901 Ga0307406_10311338 Ga0307406_103113381 307
54 3300032002 Ga0307416_100014809 Ga0307416_1000148093 307
55 3300035725 Ga0373947_0186018 Ga0373947_0186018_188_1156 308
56 3300037068 Ga0373925_0018489 Ga0373925_0018489_319_1287 308
57 3300037312 Ga0395899_0097575 Ga0395899_0097575_929_1867 308
58 3300037418 Ga0395900_0158604 Ga0395900_0158604_422_1360 308
59 3300046455 Ga0495603_0062661 Ga0495603_0062661_35_970 308
60 3300046522 Ga0495643_0071107 Ga0495643_0071107_183_1118 308
61 3300046533 Ga0495640_0044604 Ga0495640_0044604_248_1216 308
62 3300047319 Ga0495674_0112245 Ga0495674_0112245_1080_2048 308
63 3300048911 Ga0496108_0112453 Ga0496108_0112453_16_951 308
64 3300048917 Ga0496114_0454663 Ga0496114_0454663_176_1111 308
65 3300036401 Ga0373937_0055333 Ga0373937_0055333_1806_2759 309
66 3300036401 Ga0373937_0585347 Ga0373937_0585347_63_1016 309
67 3300035113 Ga0373936_0028901 Ga0373936_0028901_332_1276 310
68 3300035116 Ga0373945_0093465 Ga0373945_0093465_43_987 310
69 3300035170 Ga0373943_0030837 Ga0373943_0030837_99_1043 310
70 3300035171 Ga0373946_0029262 Ga0373946_0029262_1212_2156 310
71 3300035410 Ga0373924_0004383 Ga0373924_0004383_1583_2527 310
72 3300035692 Ga0373935_0061629 Ga0373935_0061629_983_1927 310
73 3300035695 Ga0373927_0080511 Ga0373927_0080511_997_1941 310
74 3300037068 Ga0373925_0117684 Ga0373925_0117684_118_1062 310
75 3300046459 Ga0495629_0041233 Ga0495629_0041233_112_1056 310
76 3300046475 Ga0495639_0041471 Ga0495639_0041471_582_1526 310
77 3300046476 Ga0495662_0046614 Ga0495662_0046614_924_1868 310
78 3300046514 Ga0495618_0110598 Ga0495618_0110598_345_1289 310
79 3300046516 Ga0495628_0064601 Ga0495628_0064601_780_1724 310
80 3300046531 Ga0495665_0022675 Ga0495665_0022675_1534_2478 310
81 3300046536 Ga0495587_0117493 Ga0495587_0117493_504_1448 310
82 3300046543 Ga0495645_0247448 Ga0495645_0247448_20_964 310
83 3300046681 Ga0495647_0032736 Ga0495647_0032736_118_1062 310
84 3300046689 Ga0495613_0092184 Ga0495613_0092184_995_1939 310
85 3300047321 Ga0495676_0064726 Ga0495676_0064726_1597_2541 310
86 3300047322 Ga0495680_0269369 Ga0495680_0269369_75_1019 310
87 3300048089 Ga0495614_0064844 Ga0495614_0064844_449_1393 310
88 3300049581 Ga0501047_0138456 Ga0501047_0138456_1352_2302 310
89 iso_pu_bacteria 2855730933 2855732273 310
90 iso_pu_bacteria 2855767633 2855768981 310
91 3300006844 Ga0075428_100317846 Ga0075428_1003178461 311
92 3300031711 Ga0265314_10095880 Ga0265314_100958802 311
93 3300048924 Ga0496121_0104243 Ga0496121_0104243_408_1355 311
94 3300048929 Ga0496126_0117965 Ga0496126_0117965_413_1360 311
95 3300049569 Ga0501032_0048780 Ga0501032_0048780_518_1483 312
96 3300049571 Ga0501034_0168835 Ga0501034_0168835_62_1024 312
97 3300049581 Ga0501047_0200457 Ga0501047_0200457_766_1728 312
98 3300049586 Ga0501070_0080339 Ga0501070_0080339_595_1557 312
99 3300049823 Ga0501044_0188213 Ga0501044_0188213_881_1846 312
100 3300005437 Ga0070710_10001820 Ga0070710_100018209 313
101 3300006844 Ga0075428_100001924 Ga0075428_10000192416 313
102 3300006880 Ga0075429_100000731 Ga0075429_1000007316 313
103 3300006914 Ga0075436_100070220 Ga0075436_1000702202 313
104 3300013297 Ga0157378_10005363 Ga0157378_1000536315 313
105 3300025898 Ga0207692_10003796 Ga0207692_100037964 313
106 3300025906 Ga0207699_10025931 Ga0207699_100259312 313
107 3300025916 Ga0207663_10001198 Ga0207663_1000119813 313
108 3300025928 Ga0207700_10040991 Ga0207700_100409912 313
109 3300025929 Ga0207664_10010509 Ga0207664_100105094 313
110 3300025939 Ga0207665_10002908 Ga0207665_100029088 313
111 3300027907 Ga0207428_10002206 Ga0207428_1000220616 313
112 3300031241 Ga0265325_10044886 Ga0265325_100448861 313
113 3300035086 Ga0373934_0001668 Ga0373934_0001668_4035_4985 313
114 3300035117 Ga0373953_0000108 Ga0373953_0000108_5747_6697 313
115 3300035118 Ga0373954_0000085 Ga0373954_0000085_11277_12227 313
116 3300035119 Ga0373956_0000272 Ga0373956_0000272_11534_12484 313
117 3300035120 Ga0373957_0000129 Ga0373957_0000129_5266_6216 313
118 3300035172 Ga0373955_0000288 Ga0373955_0000288_17502_18452 313
119 3300035724 Ga0373933_0000913 Ga0373933_0000913_5332_6282 313
120 3300036401 Ga0373937_0005718 Ga0373937_0005718_3308_4258 313
121 3300046454 Ga0495592_0000795 Ga0495592_0000795_14307_15257 313
122 3300046459 Ga0495629_0000582 Ga0495629_0000582_17787_18737 313
123 3300046462 Ga0495651_0002961 Ga0495651_0002961_11222_12172 313
124 3300046463 Ga0495653_0002685 Ga0495653_0002685_8769_9719 313
125 3300046511 Ga0495608_0000569 Ga0495608_0000569_950_1900 313
126 3300046514 Ga0495618_0015858 Ga0495618_0015858_3618_4568 313
127 3300046529 Ga0495652_0168347 Ga0495652_0168347_178_1128 313
128 3300046533 Ga0495640_0019903 Ga0495640_0019903_3968_4918 313
129 3300046536 Ga0495587_0007583 Ga0495587_0007583_1884_2834 313
130 3300046559 Ga0495667_0000128 Ga0495667_0000128_41846_42796 313
131 3300046642 Ga0495634_0029815 Ga0495634_0029815_1217_2167 313
132 3300046663 Ga0495635_0006917 Ga0495635_0006917_6024_6974 313
133 3300046675 Ga0495657_0003126 Ga0495657_0003126_11900_12850 313
134 3300046678 Ga0495599_0002733 Ga0495599_0002733_5909_6859 313
135 3300046679 Ga0495623_0006786 Ga0495623_0006786_5801_6751 313
136 3300046680 Ga0495646_0000412 Ga0495646_0000412_15602_16552 313
137 3300046689 Ga0495613_0050085 Ga0495613_0050085_2077_3027 313
138 3300046809 Ga0495600_0005826 Ga0495600_0005826_950_1900 313
139 3300047317 Ga0495604_0007172 Ga0495604_0007172_7032_7982 313
140 3300047322 Ga0495680_0001973 Ga0495680_0001973_3308_4258 313
141 3300047444 Ga0495675_0000345 Ga0495675_0000345_20619_21569 313
142 3300047471 Ga0495684_0000650 Ga0495684_0000650_15967_16917 313
143 3300047673 Ga0495593_0010605 Ga0495593_0010605_3335_4285 313
144 3300048088 Ga0495602_0005890 Ga0495602_0005890_6904_7854 313
145 3300050508 nmdc:mga09592_1633_c1 nmdc:mga09592_1633_c1_4277_5218 313
146 3300050511 nmdc:mga08y16_17999_c1 nmdc:mga08y16_17999_c1_3957_4898 313
147 3300050514 nmdc:mga08x19_25561_c1 nmdc:mga08x19_25561_c1_1051_2013 313
148 3300053084 Ga0495595_0000309 Ga0495595_0000309_6353_7303 313
149 3300053085 Ga0495619_0004295 Ga0495619_0004295_3645_4595 313
150 3300005293 Ga0065715_10163289 Ga0065715_101632892 314
151 3300005328 Ga0070676_10203244 Ga0070676_102032441 314
152 3300005438 Ga0070701_10197455 Ga0070701_101974552 314
153 3300005546 Ga0070696_100040313 Ga0070696_1000403132 314
154 3300005844 Ga0068862_100192384 Ga0068862_1001923842 314
155 3300009094 Ga0111539_10191553 Ga0111539_101915532 314
156 3300009147 Ga0114129_10004193 Ga0114129_100041935 314
157 3300026142 Ga0207698_10123289 Ga0207698_101232892 314
158 3300028380 Ga0268265_10042329 Ga0268265_100423293 314
159 3300041408 Ga0439453_0001575 Ga0439453_0001575_1940_2908 314
160 3300042003 Ga0439443_005217 Ga0439443_005217_553_1521 314
161 3300042993 Ga0439440_0013396 Ga0439440_0013396_645_1613 314
162 3300050507 nmdc:mga05p37_1414_c1 nmdc:mga05p37_1414_c1_10622_11566 314
163 iso_pu_bacteria 2513237096 2513661084 314
164 iso_pu_bacteria 2513237137 2513857452 314
165 iso_pu_bacteria 2513237145 2513922769 314
166 iso_pu_bacteria 2517572143 2517893409 314
167 iso_pu_bacteria 2524023228 2524537915 314
168 iso_pu_bacteria 2883577096 2883580465 314
169 iso_pu_bacteria 2894772417 2894777330 314
170 iso_pu_bacteria 2906635258 2906640626 314
171 iso_pu_bacteria 2906660503 2906665846 314
172 iso_pu_bacteria 2929199973 2929204970 314
173 iso_pu_bacteria 2935630451 2935634383 314
174 iso_pu_bacteria 2941507105 2941511273 314
175 iso_pu_bacteria 2941515067 2941518657 314
176 iso_pu_bacteria 2941523033 2941530393 314
177 iso_pu_bacteria 8006933436 8006942134 314
178 iso_pu_bacteria 8006973647 8006981870 314
179 iso_pu_bacteria 8055909800 8055913101 314
180 3300005293 Ga0065715_10009494 Ga0065715_100094943 315
181 3300005327 Ga0070658_10157316 Ga0070658_101573162 315
182 3300005331 Ga0070670_100010326 Ga0070670_1000103264 315
183 3300005334 Ga0068869_100041159 Ga0068869_1000411592 315
184 3300005340 Ga0070689_100139390 Ga0070689_1001393902 315
185 3300005341 Ga0070691_10020432 Ga0070691_100204322 315
186 3300005364 Ga0070673_100131078 Ga0070673_1001310782 315
187 3300005366 Ga0070659_100134884 Ga0070659_1001348842 315
188 3300005437 Ga0070710_10095055 Ga0070710_100950551 315
189 3300005439 Ga0070711_100002350 Ga0070711_1000023501 315
190 3300005444 Ga0070694_100094021 Ga0070694_1000940212 315
191 3300005564 Ga0070664_100177969 Ga0070664_1001779692 315
192 3300005618 Ga0068864_100018636 Ga0068864_1000186365 315
193 3300005618 Ga0068864_100037368 Ga0068864_1000373686 315
194 3300005841 Ga0068863_100194658 Ga0068863_1001946582 315
195 3300005843 Ga0068860_100283052 Ga0068860_1002830522 315
196 3300006914 Ga0075436_100015616 Ga0075436_1000156162 315
197 3300009101 Ga0105247_10015911 Ga0105247_100159113 315
198 3300013104 Ga0157370_10017812 Ga0157370_100178124 315
199 3300013306 Ga0163162_10161770 Ga0163162_101617702 315
200 3300025900 Ga0207710_10022918 Ga0207710_100229182 315
201 3300025919 Ga0207657_10034027 Ga0207657_100340273 315
202 3300025925 Ga0207650_10043753 Ga0207650_100437534 315
203 3300025932 Ga0207690_10092720 Ga0207690_100927202 315
204 3300025942 Ga0207689_10012200 Ga0207689_100122007 315
205 3300025945 Ga0207679_10006216 Ga0207679_100062163 315
206 3300026116 Ga0207674_10048558 Ga0207674_100485582 315
207 3300028380 Ga0268265_10156961 Ga0268265_101569612 315
208 3300047318 Ga0495636_0080644 Ga0495636_0080644_232_1203 315
209 3300050514 nmdc:mga08x19_11990_c1 nmdc:mga08x19_11990_c1_558_1520 315
210 3300053119 Ga0500595_047302 Ga0500595_047302_224_1249 315
211 3300005331 Ga0070670_100031548 Ga0070670_1000315483 316
212 3300005337 Ga0070682_100037985 Ga0070682_1000379852 316
213 3300005340 Ga0070689_100047319 Ga0070689_1000473193 316
214 3300005353 Ga0070669_100082803 Ga0070669_1000828032 316
215 3300005364 Ga0070673_100274964 Ga0070673_1002749642 316
216 3300005365 Ga0070688_100083719 Ga0070688_1000837192 316
217 3300005440 Ga0070705_100009020 Ga0070705_1000090203 316
218 3300005466 Ga0070685_10148907 Ga0070685_101489072 316
219 3300005467 Ga0070706_100269081 Ga0070706_1002690811 316
220 3300005518 Ga0070699_100033765 Ga0070699_1000337654 316
221 3300005536 Ga0070697_100042882 Ga0070697_1000428823 316
222 3300005539 Ga0068853_100142264 Ga0068853_1001422642 316
223 3300005545 Ga0070695_100003903 Ga0070695_1000039035 316
224 3300005546 Ga0070696_100004498 Ga0070696_1000044981 316
225 3300005546 Ga0070696_100032944 Ga0070696_1000329443 316
226 3300005563 Ga0068855_100058610 Ga0068855_1000586103 316
227 3300005577 Ga0068857_100243207 Ga0068857_1002432072 316
228 3300005615 Ga0070702_100115205 Ga0070702_1001152052 316
229 3300005617 Ga0068859_100184583 Ga0068859_1001845832 316
230 3300005617 Ga0068859_100394360 Ga0068859_1003943602 316
231 3300005840 Ga0068870_10042059 Ga0068870_100420592 316
232 3300005841 Ga0068863_100301430 Ga0068863_1003014302 316
233 3300005844 Ga0068862_100220965 Ga0068862_1002209652 316
234 3300005937 Ga0081455_10014642 Ga0081455_100146423 316
235 3300005983 Ga0081540_1023745 Ga0081540_10237452 316
236 3300005983 Ga0081540_1032500 Ga0081540_10325002 316
237 3300006028 Ga0070717_10012420 Ga0070717_100124202 316
238 3300006173 Ga0070716_100052869 Ga0070716_1000528692 316
239 3300006237 Ga0097621_100271380 Ga0097621_1002713801 316
240 3300006846 Ga0075430_100034059 Ga0075430_1000340592 316
241 3300006846 Ga0075430_100078159 Ga0075430_1000781592 316
242 3300006914 Ga0075436_100004664 Ga0075436_1000046646 316
243 3300006914 Ga0075436_100147286 Ga0075436_1001472862 316
244 3300006931 Ga0097620_100184566 Ga0097620_1001845662 316
245 3300006931 Ga0097620_100394368 Ga0097620_1003943682 316
246 3300009093 Ga0105240_10027925 Ga0105240_100279255 316
247 3300009094 Ga0111539_10159096 Ga0111539_101590961 316
248 3300009094 Ga0111539_10285891 Ga0111539_102858912 316
249 3300009098 Ga0105245_10447122 Ga0105245_104471222 316
250 3300009148 Ga0105243_10062838 Ga0105243_100628383 316
251 3300009545 Ga0105237_10073014 Ga0105237_100730141 316
252 3300013297 Ga0157378_10263238 Ga0157378_102632382 316
253 3300013297 Ga0157378_10569448 Ga0157378_105694481 316
254 3300014745 Ga0157377_10035025 Ga0157377_100350252 316
255 3300025315 Ga0207697_10007349 Ga0207697_100073493 316
256 3300025893 Ga0207682_10001086 Ga0207682_1000108610 316
257 3300025907 Ga0207645_10020198 Ga0207645_100201983 316
258 3300025908 Ga0207643_10022040 Ga0207643_100220403 316
259 3300025910 Ga0207684_10221269 Ga0207684_102212692 316
260 3300025912 Ga0207707_10014916 Ga0207707_100149164 316
261 3300025917 Ga0207660_10023139 Ga0207660_100231392 316
262 3300025924 Ga0207694_10087445 Ga0207694_100874452 316
263 3300025928 Ga0207700_10001731 Ga0207700_100017318 316
264 3300025933 Ga0207706_10012435 Ga0207706_100124353 316
265 3300025935 Ga0207709_10031030 Ga0207709_100310303 316
266 3300025938 Ga0207704_10201000 Ga0207704_102010001 316
267 3300025939 Ga0207665_10107693 Ga0207665_101076931 316
268 3300025941 Ga0207711_10509957 Ga0207711_105099571 316
269 3300025942 Ga0207689_10006304 Ga0207689_100063049 316
270 3300025949 Ga0207667_10134944 Ga0207667_101349442 316
271 3300025961 Ga0207712_10196859 Ga0207712_101968592 316
272 3300025972 Ga0207668_10437961 Ga0207668_104379611 316
273 3300026075 Ga0207708_10008455 Ga0207708_100084554 316
274 3300026088 Ga0207641_10083585 Ga0207641_100835852 316
275 3300026095 Ga0207676_10068564 Ga0207676_100685642 316
276 3300026116 Ga0207674_10064569 Ga0207674_100645692 316
277 3300026118 Ga0207675_100019128 Ga0207675_1000191286 316
278 3300028380 Ga0268265_10156915 Ga0268265_101569152 316
279 3300035083 Ga0373926_0009865 Ga0373926_0009865_493_1488 316
280 3300035113 Ga0373936_0039824 Ga0373936_0039824_132_1100 316
281 3300035695 Ga0373927_0016271 Ga0373927_0016271_2880_3851 316
282 3300037068 Ga0373925_0043524 Ga0373925_0043524_1882_2853 316
283 3300046475 Ga0495639_0106941 Ga0495639_0106941_66_1037 316
284 3300046537 Ga0495598_0025778 Ga0495598_0025778_471_1445 316
285 3300047470 Ga0495681_0115136 Ga0495681_0115136_27_1001 316
286 3300048924 Ga0496121_0100781 Ga0496121_0100781_251_1225 316
287 3300050509 nmdc:mga0qj67_84257_c1 nmdc:mga0qj67_84257_c1_1577_2527 316
288 3300050510 nmdc:mga06r32_377231_c1 nmdc:mga06r32_377231_c1_11_961 316
289 3300050514 nmdc:mga08x19_57375_c1 nmdc:mga08x19_57375_c1_1042_1995 316
290 3300053094 Ga0500566_0000100 Ga0500566_0000100_33286_34254 316
291 3300053095 Ga0500640_005859 Ga0500640_005859_3558_4526 316
292 3300053111 Ga0500572_000176 Ga0500572_000176_9337_10305 316
293 3300053122 Ga0500608_028998 Ga0500608_028998_1262_2230 316
294 3300053123 Ga0500614_000141 Ga0500614_000141_4886_5854 316
295 3300053136 Ga0500559_0003396 Ga0500559_0003396_297_1265 316
296 3300053150 Ga0500603_000017 Ga0500603_000017_35969_36937 316
297 3300053162 Ga0500638_011827 Ga0500638_011827_1129_2097 316
298 3300053163 Ga0500639_000525 Ga0500639_000525_6609_7577 316
299 3300053178 Ga0500637_0009251 Ga0500637_0009251_1100_2068 316
300 3300053737 Ga0500601_006898 Ga0500601_006898_180_1148 316
301 iso_pu_bacteria 2842775625 2842780468 316
302 3300003203 JGI25406J46586_10002931 JGI25406J46586_100029315 317
303 3300005331 Ga0070670_100234534 Ga0070670_1002345342 317
304 3300005339 Ga0070660_100430632 Ga0070660_1004306321 317
305 3300005355 Ga0070671_100173532 Ga0070671_1001735322 317
306 3300005356 Ga0070674_100381550 Ga0070674_1003815501 317
307 3300005456 Ga0070678_100060688 Ga0070678_1000606882 317
308 3300005985 Ga0081539_10000478 Ga0081539_1000047868 317
309 3300005985 Ga0081539_10012172 Ga0081539_100121725 317
310 3300006358 Ga0068871_100235355 Ga0068871_1002353552 317
311 3300014326 Ga0157380_10175187 Ga0157380_101751872 317
312 3300025297 Ga0209758_1016130 Ga0209758_10161304 317
313 3300025912 Ga0207707_10120631 Ga0207707_101206312 317
314 3300025920 Ga0207649_10156996 Ga0207649_101569961 317
315 3300025931 Ga0207644_10045147 Ga0207644_100451472 317
316 3300025961 Ga0207712_10272412 Ga0207712_102724122 317
317 3300026121 Ga0207683_10107188 Ga0207683_101071883 317
318 3300033442 Ga0315911_1000009 Ga0315911_100000922 317
319 3300035695 Ga0373927_0118924 Ga0373927_0118924_525_1499 317
320 3300036401 Ga0373937_0203872 Ga0373937_0203872_18_992 317
321 3300037466 Ga0395898_0547072 Ga0395898_0547072_64_1041 317
322 3300038443 Ga0395901_0116169 Ga0395901_0116169_65_1042 317
323 3300046473 Ga0495582_0212914 Ga0495582_0212914_89_1063 317
324 3300046507 Ga0495606_0004206 Ga0495606_0004206_3025_4089 317
325 3300046660 Ga0495625_0072268 Ga0495625_0072268_513_1484 317
326 3300047320 Ga0495672_0002625 Ga0495672_0002625_11902_12963 317
327 3300048905 Ga0496102_0269587 Ga0496102_0269587_440_1414 317
328 3300048910 Ga0496107_0289117 Ga0496107_0289117_46_1020 317
329 3300048915 Ga0496112_0000004 Ga0496112_0000004_206701_207765 317
330 3300048916 Ga0496113_0396435 Ga0496113_0396435_54_1034 317
331 3300048917 Ga0496114_0112571 Ga0496114_0112571_1198_2172 317
332 3300048917 Ga0496114_0117658 Ga0496114_0117658_937_1911 317
333 3300049583 Ga0501067_0058932 Ga0501067_0058932_907_1881 317
334 3300053153 Ga0500616_0124425 Ga0500616_0124425_249_1202 317
335 3300005329 Ga0070683_100090513 Ga0070683_1000905133 318
336 3300005338 Ga0068868_100060481 Ga0068868_1000604812 318
337 3300005344 Ga0070661_100083789 Ga0070661_1000837892 318
338 3300005347 Ga0070668_100074908 Ga0070668_1000749083 318
339 3300005355 Ga0070671_100074978 Ga0070671_1000749783 318
340 3300005366 Ga0070659_100157079 Ga0070659_1001570791 318
341 3300005436 Ga0070713_100012869 Ga0070713_1000128694 318
342 3300005456 Ga0070678_100002615 Ga0070678_1000026154 318
343 3300005535 Ga0070684_100017844 Ga0070684_1000178442 318
344 3300005535 Ga0070684_100036518 Ga0070684_1000365185 318
345 3300005536 Ga0070697_100033182 Ga0070697_1000331822 318
346 3300005544 Ga0070686_100087168 Ga0070686_1000871681 318
347 3300005545 Ga0070695_100076688 Ga0070695_1000766883 318
348 3300005547 Ga0070693_100073402 Ga0070693_1000734022 318
349 3300005548 Ga0070665_100008665 Ga0070665_1000086653 318
350 3300005548 Ga0070665_100044294 Ga0070665_1000442942 318
351 3300005548 Ga0070665_100095491 Ga0070665_1000954913 318
352 3300005548 Ga0070665_100096673 Ga0070665_1000966733 318
353 3300005563 Ga0068855_100032479 Ga0068855_1000324792 318
354 3300005578 Ga0068854_100195760 Ga0068854_1001957602 318
355 3300005616 Ga0068852_100130356 Ga0068852_1001303563 318
356 3300005618 Ga0068864_100273226 Ga0068864_1002732262 318
357 3300005719 Ga0068861_100087663 Ga0068861_1000876632 318
358 3300005834 Ga0068851_10014696 Ga0068851_100146961 318
359 3300005842 Ga0068858_100074954 Ga0068858_1000749543 318
360 3300005983 Ga0081540_1002588 Ga0081540_100258817 318
361 3300005983 Ga0081540_1042645 Ga0081540_10426452 318
362 3300006028 Ga0070717_10081260 Ga0070717_100812602 318
363 3300006038 Ga0075365_10021229 Ga0075365_100212294 318
364 3300006048 Ga0075363_100026963 Ga0075363_1000269633 318
365 3300006048 Ga0075363_100142369 Ga0075363_1001423692 318
366 3300006051 Ga0075364_10096153 Ga0075364_100961532 318
367 3300006178 Ga0075367_10034693 Ga0075367_100346932 318
368 3300006237 Ga0097621_100003275 Ga0097621_1000032758 318
369 3300006237 Ga0097621_100053721 Ga0097621_1000537213 318
370 3300006353 Ga0075370_10018204 Ga0075370_100182042 318
371 3300006353 Ga0075370_10163232 Ga0075370_101632321 318
372 3300006358 Ga0068871_100022393 Ga0068871_1000223938 318
373 3300007265 Ga0099794_10006763 Ga0099794_100067633 318
374 3300007788 Ga0099795_10001606 Ga0099795_100016062 318
375 3300009093 Ga0105240_10050277 Ga0105240_100502772 318
376 3300009098 Ga0105245_10028830 Ga0105245_100288302 318
377 3300009101 Ga0105247_10040828 Ga0105247_100408282 318
378 3300009101 Ga0105247_10114399 Ga0105247_101143992 318
379 3300009101 Ga0105247_10157267 Ga0105247_101572672 318
380 3300009545 Ga0105237_10008183 Ga0105237_100081832 318
381 3300009545 Ga0105237_10249368 Ga0105237_102493682 318
382 3300009545 Ga0105237_10410746 Ga0105237_104107462 318
383 3300009551 Ga0105238_10008143 Ga0105238_100081434 318
384 3300009551 Ga0105238_10044172 Ga0105238_100441723 318
385 3300009553 Ga0105249_10440100 Ga0105249_104401001 318
386 3300010375 Ga0105239_10024271 Ga0105239_100242712 318
387 3300010375 Ga0105239_10064973 Ga0105239_100649734 318
388 3300010375 Ga0105239_10066968 Ga0105239_100669682 318
389 3300011119 Ga0105246_10017489 Ga0105246_100174893 318
390 3300013104 Ga0157370_10054733 Ga0157370_100547332 318
391 3300013105 Ga0157369_10007198 Ga0157369_100071983 318
392 3300013296 Ga0157374_10090626 Ga0157374_100906263 318
393 3300013296 Ga0157374_10100227 Ga0157374_101002272 318
394 3300014325 Ga0163163_10025386 Ga0163163_100253864 318
395 3300014326 Ga0157380_10349933 Ga0157380_103499332 318
396 3300014745 Ga0157377_10113305 Ga0157377_101133052 318
397 3300014968 Ga0157379_10305551 Ga0157379_103055511 318
398 3300014969 Ga0157376_10042314 Ga0157376_100423142 318
399 3300025315 Ga0207697_10026295 Ga0207697_100262952 318
400 3300025912 Ga0207707_10001083 Ga0207707_1000108315 318
401 3300025914 Ga0207671_10109000 Ga0207671_101090002 318
402 3300025915 Ga0207693_10053764 Ga0207693_100537643 318
403 3300025917 Ga0207660_10003821 Ga0207660_100038216 318
404 3300025919 Ga0207657_10003922 Ga0207657_1000392218 318
405 3300025920 Ga0207649_10017748 Ga0207649_100177482 318
406 3300025924 Ga0207694_10069799 Ga0207694_100697992 318
407 3300025927 Ga0207687_10016510 Ga0207687_100165102 318
408 3300025928 Ga0207700_10005989 Ga0207700_100059892 318
409 3300025929 Ga0207664_10073802 Ga0207664_100738023 318
410 3300025931 Ga0207644_10161886 Ga0207644_101618862 318
411 3300025934 Ga0207686_10295404 Ga0207686_102954041 318
412 3300025949 Ga0207667_10029619 Ga0207667_100296193 318
413 3300025961 Ga0207712_10348706 Ga0207712_103487062 318
414 3300025972 Ga0207668_10166657 Ga0207668_101666572 318
415 3300026121 Ga0207683_10005256 Ga0207683_1000525611 318
416 3300026142 Ga0207698_10055262 Ga0207698_100552622 318
417 3300027512 Ga0209179_1010313 Ga0209179_10103131 318
418 3300027671 Ga0209588_1000354 Ga0209588_10003544 318
419 3300028379 Ga0268266_10000988 Ga0268266_100009888 318
420 3300028379 Ga0268266_10002854 Ga0268266_1000285411 318
421 3300028379 Ga0268266_10069800 Ga0268266_100698003 318
422 3300028379 Ga0268266_10162827 Ga0268266_101628272 318
423 3300031238 Ga0265332_10029911 Ga0265332_100299113 318
424 3300031712 Ga0265342_10017730 Ga0265342_100177303 318
425 3300032126 Ga0307415_100109282 Ga0307415_1001092822 318
426 3300033180 Ga0307510_10021753 Ga0307510_100217533 318
427 3300033544 Ga0316215_1004066 Ga0316215_10040661 318
428 3300035091 Ga0373951_0027143 Ga0373951_0027143_221_1198 318
429 3300035117 Ga0373953_0001849 Ga0373953_0001849_2091_3068 318
430 3300035118 Ga0373954_0039655 Ga0373954_0039655_1043_2020 318
431 3300035119 Ga0373956_0015106 Ga0373956_0015106_1810_2787 318
432 3300035120 Ga0373957_0034807 Ga0373957_0034807_138_1115 318
433 3300035172 Ga0373955_0007868 Ga0373955_0007868_173_1150 318
434 3300035241 Ga0373961_0013839 Ga0373961_0013839_875_1840 318
435 3300035410 Ga0373924_0052370 Ga0373924_0052370_659_1636 318
436 3300035692 Ga0373935_0122182 Ga0373935_0122182_470_1447 318
437 3300035724 Ga0373933_0000059 Ga0373933_0000059_20986_21966 318
438 3300036401 Ga0373937_0118598 Ga0373937_0118598_1383_2357 318
439 3300036401 Ga0373937_0255615 Ga0373937_0255615_139_1116 318
440 3300036459 Ga0372808_001187 Ga0372808_001187_1387_2364 318
441 3300039437 Ga0436365_0965344 Ga0436365_0965344_197_1177 318
442 3300046454 Ga0495592_0008545 Ga0495592_0008545_6500_7477 318
443 3300046459 Ga0495629_0068768 Ga0495629_0068768_1075_2052 318
444 3300046462 Ga0495651_0040411 Ga0495651_0040411_2294_3271 318
445 3300046463 Ga0495653_0033437 Ga0495653_0033437_2761_3738 318
446 3300046511 Ga0495608_0214413 Ga0495608_0214413_22_999 318
447 3300046516 Ga0495628_0010360 Ga0495628_0010360_3383_4360 318
448 3300046517 Ga0495630_0055082 Ga0495630_0055082_1921_2898 318
449 3300046518 Ga0495631_0102707 Ga0495631_0102707_10_987 318
450 3300046533 Ga0495640_0031138 Ga0495640_0031138_1568_2545 318
451 3300046536 Ga0495587_0108406 Ga0495587_0108406_320_1297 318
452 3300046539 Ga0495621_0013721 Ga0495621_0013721_1101_2087 318
453 3300046559 Ga0495667_0051416 Ga0495667_0051416_542_1519 318
454 3300046616 Ga0495668_0113248 Ga0495668_0113248_295_1272 318
455 3300046642 Ga0495634_0032598 Ga0495634_0032598_304_1281 318
456 3300046663 Ga0495635_0027935 Ga0495635_0027935_764_1741 318
457 3300046678 Ga0495599_0023684 Ga0495599_0023684_337_1314 318
458 3300046679 Ga0495623_0021930 Ga0495623_0021930_1407_2384 318
459 3300046689 Ga0495613_0145850 Ga0495613_0145850_364_1341 318
460 3300046809 Ga0495600_0045403 Ga0495600_0045403_1741_2718 318
461 3300046809 Ga0495600_0159801 Ga0495600_0159801_159_1136 318
462 3300047322 Ga0495680_0030826 Ga0495680_0030826_3179_4156 318
463 3300047444 Ga0495675_0116651 Ga0495675_0116651_259_1236 318
464 3300047471 Ga0495684_0253826 Ga0495684_0253826_103_1080 318
465 3300048088 Ga0495602_0136638 Ga0495602_0136638_542_1519 318
466 3300048903 Ga0496100_0003436 Ga0496100_0003436_7267_8244 318
467 3300048903 Ga0496100_0383985 Ga0496100_0383985_44_1021 318
468 3300048904 Ga0496101_0002458 Ga0496101_0002458_875_1852 318
469 3300048905 Ga0496102_0007852 Ga0496102_0007852_7667_8644 318
470 3300048906 Ga0496103_0026546 Ga0496103_0026546_603_1580 318
471 3300048907 Ga0496104_0376988 Ga0496104_0376988_58_1035 318
472 3300048908 Ga0496105_0106760 Ga0496105_0106760_343_1320 318
473 3300048910 Ga0496107_0005677 Ga0496107_0005677_1335_2312 318
474 3300048911 Ga0496108_0066237 Ga0496108_0066237_1500_2477 318
475 3300048913 Ga0496110_0084535 Ga0496110_0084535_196_1173 318
476 3300048914 Ga0496111_0017403 Ga0496111_0017403_93_1070 318
477 3300048917 Ga0496114_0037134 Ga0496114_0037134_1419_2396 318
478 3300048918 Ga0496115_0007883 Ga0496115_0007883_3253_4230 318
479 3300048918 Ga0496115_0228656 Ga0496115_0228656_529_1509 318
480 3300048924 Ga0496121_0179792 Ga0496121_0179792_285_1262 318
481 3300048929 Ga0496126_0018962 Ga0496126_0018962_2512_3492 318
482 3300048929 Ga0496126_0106054 Ga0496126_0106054_565_1545 318
483 3300048929 Ga0496126_0119268 Ga0496126_0119268_1286_2260 318
484 3300050489 nmdc:mga03683_121994_c1 nmdc:mga03683_121994_c1_72_1049 318
485 3300050491 nmdc:mga00v17_263987_c1 nmdc:mga00v17_263987_c1_93_1070 318
486 3300050494 nmdc:mga06z11_25270_c1 nmdc:mga06z11_25270_c1_1261_2238 318
487 3300053078 Ga0495612_0016270 Ga0495612_0016270_306_1283 318
488 3300053080 Ga0500635_0035006 Ga0500635_0035006_183_1160 318
489 3300053085 Ga0495619_0091658 Ga0495619_0091658_179_1156 318
490 3300053085 Ga0495619_0258032 Ga0495619_0258032_157_1134 318
491 3300053150 Ga0500603_000889 Ga0500603_000889_2239_3216 318
492 3300053178 Ga0500637_0004916 Ga0500637_0004916_1253_2230 318
493 3300005436 Ga0070713_100086219 Ga0070713_1000862192 319
494 3300006175 Ga0070712_100035227 Ga0070712_1000352272 319
495 3300025906 Ga0207699_10028299 Ga0207699_100282993 319
496 3300025915 Ga0207693_10004729 Ga0207693_100047295 319
497 3300025925 Ga0207650_10005539 Ga0207650_100055398 319
498 3300046664 Ga0495659_0100728 Ga0495659_0100728_95_1057 319
499 3300046809 Ga0495600_0022948 Ga0495600_0022948_2600_3658 319
500 3300048929 Ga0496126_0410077 Ga0496126_0410077_33_1013 319
501 3300050509 nmdc:mga0qj67_7392_c1 nmdc:mga0qj67_7392_c1_2279_3268 319
502 3300053161 Ga0500634_0071057 Ga0500634_0071057_403_1377 319
503 3300006195 Ga0075366_10005051 Ga0075366_100050514 320
504 3300025297 Ga0209758_1020899 Ga0209758_10208992 320
505 3300050491 nmdc:mga00v17_48594_c1 nmdc:mga00v17_48594_c1_261_1232 320
506 3300050494 nmdc:mga06z11_76521_c1 nmdc:mga06z11_76521_c1_234_1205 320
507 3300053084 Ga0495595_0052343 Ga0495595_0052343_573_1568 320
508 3300005367 Ga0070667_100123857 Ga0070667_1001238572 321
509 3300013308 Ga0157375_10137314 Ga0157375_101373142 321
510 3300025986 Ga0207658_10097353 Ga0207658_100973532 321
511 iso_pu_bacteria 2904541872 2904542200 321
512 iso_pu_bacteria 2929160207 2929167485 321
513 3300003187 JGI25151J46595_10002303 JGI25151J46595_100023032 325
514 3300025294 Ga0209025_1000049 Ga0209025_100004994 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

78

351

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9382 31 322
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9382 27 325
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9366 28 325
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9352 27 325
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9336 28 325
ID Description Score Start End Superfamily
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9431 127 249 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9332 128 249 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9288 127 249 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9247 127 249 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9235 127 242 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A536SFT4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9597 55 325
AF-A0A556ACX6-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9552 35 323
AF-A0A6L5FCX9-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9546 18 325
AF-A0A5N7XAH9-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9512 52 325
AF-A0A439F197-F1-model_v4 deleted 0.9503 81 325

Feature Viewer

pLDDT pTM Quality
90.35 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map