F457632

General Info

Members Datasets Scaffolds Average Seq Length
513 276 1026 306

Family's Representative Sequence

Representative Sequence 3300048923|Ga0496120_0049899|Ga0496120_0049899_14_1123
Length 369
Sequence MFLTRSTATSDRTVDWQGSTYPLIVVDVTSDSHPFWTGSSRRIDTAGQVEKFHRRYGARPAPWGGGMRLKPGRPDLGDYARFFDLPAAGSAPLTVTWAGVTTLLVDDGTSAVMTDGFFSRPALLRVGLARIAPSAPRIDGCLARLGVRSLDAVLPVHTHFDHAMDSAVVAERTGAALVGGDSVAHLGHGLAPEKIVLATPGVPLRLGAFDITLIVGEHCPPDRFPGPITAPVRPPVRAAAYRCGEAWSTVVHHRPSDRRLLIVGSAGFVPGALAGHRAEVVYLGIGQLGLQPEHYLLDYWTETVRTVGARRVVLIHWDDFFRPLDEPLRALPYAADDLDVSMRVLARLAEQDGVTLHLPTLWQPTDPWI

Samples

Sample ID Description Type Environment
1 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
88 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
133 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
145 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
149 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
155 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
156 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
157 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
158 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
180 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
243 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
244 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
245 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
246 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
247 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
248 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
249 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
250 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
251 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 2643221561 Nocardioides sp. Root151 Isolate Unclassified
254 2643221576 Nocardioides sp. Root614 Isolate Unclassified
255 2643221590 Nocardioides sp. Root682 Isolate Unclassified
256 2643221604 Nocardioides sp. Root190 Isolate Unclassified
257 2643221615 Nocardioides sp. Root224 Isolate Unclassified
258 2643221617 Nocardioides sp. Root79 Isolate Unclassified
259 2643221620 Nocardioides sp. Root240 Isolate Unclassified
260 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
261 2643221696 Nocardioides sp. Root140 Isolate Unclassified
262 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
263 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
264 2738541305 Nocardioides sp. CF167 Isolate Unclassified
265 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
266 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
267 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
268 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
269 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
270 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
271 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
272 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
273 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
274 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
275 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
276 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.32
Metatranscriptomes 0
Isolates 4.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.28
Nodule 0.19
Rhizoplane 11.31
Rhizosphere 67.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496120_0049899 3300048923 Bacteria 2399
2 JGI24742J22300_10001568 3300002244 Bacteria 3632
3 Ga0055540_1000332 3300003792 Bacteria 41197
4 Ga0070683_100220139 3300005329 Bacteria 1804
5 Ga0070690_100007705 3300005330 Bacteria 6174
6 Ga0070670_100146735 3300005331 Bacteria 2041
7 Ga0068869_100024891 3300005334 Bacteria 4150
8 Ga0070666_10010462 3300005335 Bacteria 5806
9 Ga0070682_100013235 3300005337 Bacteria 4743
10 Ga0070682_100054375 3300005337 Bacteria 2511
11 Ga0068868_100007488 3300005338 Bacteria 7777
12 Ga0070687_100226527 3300005343 Bacteria 1148
13 Ga0070668_100001930 3300005347 Bacteria 15141
14 Ga0070668_100019451 3300005347 Bacteria 5110
15 Ga0070669_100000974 3300005353 Bacteria 20904
16 Ga0070671_100007204 3300005355 Bacteria 8894
17 Ga0070671_100032131 3300005355 Bacteria 4341
18 Ga0070674_100001949 3300005356 Bacteria 11261
19 Ga0070688_100009863 3300005365 Bacteria 5248
20 Ga0070659_100138130 3300005366 Bacteria 1983
21 Ga0070667_100000220 3300005367 Bacteria 65980
22 Ga0070667_100048632 3300005367 Bacteria 3570
23 Ga0070667_100062646 3300005367 Bacteria 3151
24 Ga0070667_100372393 3300005367 Bacteria 1296
25 Ga0070714_100025705 3300005435 Bacteria 4861
26 Ga0070701_10004346 3300005438 Bacteria 5725
27 Ga0070701_10192028 3300005438 Bacteria 1202
28 Ga0070711_100011015 3300005439 Bacteria 5608
29 Ga0070711_100389350 3300005439 Bacteria 1129
30 Ga0070705_100003339 3300005440 Bacteria 7878
31 Ga0070700_100002414 3300005441 Bacteria 9525
32 Ga0070663_100104605 3300005455 Bacteria 2118
33 Ga0070663_100192895 3300005455 Bacteria 1586
34 Ga0070678_100001019 3300005456 Bacteria 14599
35 Ga0070662_100003538 3300005457 Bacteria 9742
36 Ga0070662_100025892 3300005457 Bacteria 4055
37 Ga0068853_100004268 3300005539 Bacteria 11039
38 Ga0068853_100029723 3300005539 Bacteria 4609
39 Ga0070696_100001399 3300005546 Bacteria 15773
40 Ga0070693_100015319 3300005547 Bacteria 3945
41 Ga0070665_100003829 3300005548 Bacteria 15926
42 Ga0070665_100011466 3300005548 Bacteria 8962
43 Ga0070665_100503536 3300005548 Bacteria 1222
44 Ga0070665_100545148 3300005548 Bacteria 1172
45 Ga0070704_100017773 3300005549 Bacteria 4532
46 Ga0070704_100068990 3300005549 Bacteria 2559
47 Ga0068855_100427949 3300005563 Bacteria 1447
48 Ga0068855_100581087 3300005563 Bacteria 1210
49 Ga0068854_100001142 3300005578 Bacteria 15957
50 Ga0068854_100238225 3300005578 Bacteria 1448
51 Ga0070702_100006934 3300005615 Bacteria 5396
52 Ga0068852_100080567 3300005616 Bacteria 2887
53 Ga0068852_100087243 3300005616 Bacteria 2783
54 Ga0068852_100181801 3300005616 Bacteria 1978
55 Ga0068859_100005670 3300005617 Bacteria 12710
56 Ga0068859_100067695 3300005617 Bacteria 3606
57 Ga0068859_100071300 3300005617 Bacteria 3510
58 Ga0068864_100085013 3300005618 Bacteria 2781
59 Ga0068864_100365075 3300005618 Bacteria 1365
60 Ga0068866_10001263 3300005718 Bacteria 10965
61 Ga0068861_100014924 3300005719 Bacteria 5461
62 Ga0068861_100188750 3300005719 Bacteria 1721
63 Ga0068863_100015889 3300005841 Bacteria 7220
64 Ga0068863_100016513 3300005841 Bacteria 7082
65 Ga0068863_100081526 3300005841 Bacteria 3065
66 Ga0068858_100208307 3300005842 Bacteria 1850
67 Ga0068860_100000150 3300005843 Bacteria 113021
68 Ga0068860_100003008 3300005843 Bacteria 17415
69 Ga0068862_100000078 3300005844 Bacteria 114008
70 Ga0068862_100000569 3300005844 Bacteria 38520
71 Ga0068862_100056700 3300005844 Bacteria 3357
72 Ga0068862_100065364 3300005844 Bacteria 3133
73 Ga0081455_10003328 3300005937 Bacteria 18542
74 Ga0081455_10052964 3300005937 Bacteria 3470
75 Ga0075365_10000492 3300006038 Bacteria 15048
76 Ga0075365_10001223 3300006038 Bacteria 11354
77 Ga0075365_10004243 3300006038 Bacteria 7557
78 Ga0075365_10019760 3300006038 Bacteria 4165
79 Ga0075365_10129928 3300006038 Bacteria 1743
80 Ga0075368_10004216 3300006042 Bacteria 4850
81 Ga0075368_10067808 3300006042 Bacteria 1437
82 Ga0075363_100001386 3300006048 Bacteria 9139
83 Ga0075363_100002067 3300006048 Bacteria 8030
84 Ga0075363_100006316 3300006048 Bacteria 5370
85 Ga0075363_100187314 3300006048 Bacteria 1179
86 Ga0075364_10001434 3300006051 Bacteria 12924
87 Ga0075364_10006670 3300006051 Bacteria 6805
88 Ga0075364_10110068 3300006051 Bacteria 1837
89 Ga0070715_10017646 3300006163 Bacteria 2705
90 Ga0070716_100001464 3300006173 Bacteria 10525
91 Ga0070716_100009984 3300006173 Bacteria 4748
92 Ga0070712_100003275 3300006175 Bacteria 9962
93 Ga0075362_10014629 3300006177 Bacteria 3171
94 Ga0075362_10087702 3300006177 Bacteria 1441
95 Ga0075367_10021307 3300006178 Bacteria 3620
96 Ga0075367_10035759 3300006178 Bacteria 2877
97 Ga0075367_10068847 3300006178 Bacteria 2124
98 Ga0075369_10000676 3300006186 Bacteria 10874
99 Ga0075369_10015622 3300006186 Bacteria 3051
100 Ga0075369_10047890 3300006186 Bacteria 1844
101 Ga0075369_10050988 3300006186 Bacteria 1791
102 Ga0075369_10055119 3300006186 Bacteria 1727
103 Ga0075370_10005265 3300006353 Bacteria 6405
104 Ga0075370_10117000 3300006353 Bacteria 1550
105 Ga0068871_100107615 3300006358 Bacteria 2342
106 Ga0075428_100023235 3300006844 Bacteria 6858
107 Ga0075431_100116819 3300006847 Bacteria 2753
108 Ga0075429_100179436 3300006880 Bacteria 1856
109 Ga0068865_100003418 3300006881 Bacteria 9498
110 Ga0097620_100005671 3300006931 Bacteria 12710
111 Ga0097620_100067695 3300006931 Bacteria 3606
112 Ga0097620_100071300 3300006931 Bacteria 3510
113 Ga0105250_10131334 3300009092 Bacteria 1034
114 Ga0105245_10020687 3300009098 Bacteria 5769
115 Ga0105245_10030182 3300009098 Bacteria 4793
116 Ga0105245_10058118 3300009098 Bacteria 3481
117 Ga0105247_10000074 3300009101 Bacteria 113207
118 Ga0114129_10016083 3300009147 Bacteria 10643
119 Ga0105243_10006541 3300009148 Bacteria 9000
120 Ga0105242_10001099 3300009176 Bacteria 21294
121 Ga0105248_10000077 3300009177 Bacteria 113148
122 Ga0105248_10008850 3300009177 Bacteria 11060
123 Ga0105237_10004195 3300009545 Bacteria 16784
124 Ga0105237_10098304 3300009545 Bacteria 2918
125 Ga0105237_10339794 3300009545 Bacteria 1506
126 Ga0105238_10272119 3300009551 Bacteria 1674
127 Ga0105249_10000111 3300009553 Bacteria 109164
128 Ga0105249_10003780 3300009553 Bacteria 13074
129 Ga0105249_10037912 3300009553 Bacteria 4374
130 Ga0099796_10010705 3300010159 Bacteria 2531
131 Ga0105239_10081261 3300010375 Bacteria 3567
132 Ga0105246_10032968 3300011119 Bacteria 3438
133 Ga0157371_10128090 3300013102 Bacteria 1805
134 Ga0157374_10117122 3300013296 Bacteria 2567
135 Ga0157378_10005481 3300013297 Bacteria 11121
136 Ga0163162_10003427 3300013306 Bacteria 15141
137 Ga0163162_10020836 3300013306 Bacteria 6445
138 Ga0157372_10002067 3300013307 Bacteria 21787
139 Ga0157372_10394290 3300013307 Bacteria 1613
140 Ga0157375_10005799 3300013308 Bacteria 10745
141 Ga0157375_10082362 3300013308 Bacteria 3259
142 Ga0163163_10004383 3300014325 Bacteria 12027
143 Ga0163163_10005638 3300014325 Bacteria 10847
144 Ga0163163_10164151 3300014325 Bacteria 2267
145 Ga0157380_10000655 3300014326 Bacteria 21452
146 Ga0157377_10187405 3300014745 Bacteria 1305
147 Ga0157379_10000746 3300014968 Bacteria 26283
148 Ga0157379_10024361 3300014968 Bacteria 5373
149 Ga0157379_10073686 3300014968 Bacteria 3056
150 Ga0157376_10014063 3300014969 Bacteria 5992
151 Ga0163161_10003326 3300017792 Bacteria 11268
152 Ga0163161_10024384 3300017792 Bacteria 4273
153 Ga0213875_10014567 3300021388 Bacteria 3836
154 Ga0213875_10051526 3300021388 Bacteria 1928
155 Ga0209051_1000557 3300025303 Bacteria 45433
156 Ga0209051_1000728 3300025303 Bacteria 35703
157 Ga0207692_10019301 3300025898 Bacteria 3079
158 Ga0207692_10036593 3300025898 Bacteria 2395
159 Ga0207692_10169699 3300025898 Bacteria 1264
160 Ga0207642_10005334 3300025899 Bacteria 4188
161 Ga0207642_10017551 3300025899 Bacteria 2725
162 Ga0207710_10000086 3300025900 Bacteria 129918
163 Ga0207688_10002788 3300025901 Bacteria 9479
164 Ga0207680_10008079 3300025903 Bacteria 5156
165 Ga0207647_10031852 3300025904 Bacteria 3391
166 Ga0207685_10004626 3300025905 Bacteria 3529
167 Ga0207685_10093199 3300025905 Bacteria 1273
168 Ga0207671_10005856 3300025914 Bacteria 11170
169 Ga0207693_10000380 3300025915 Bacteria 40807
170 Ga0207693_10004573 3300025915 Bacteria 11677
171 Ga0207663_10001584 3300025916 Bacteria 10685
172 Ga0207657_10050116 3300025919 Bacteria 3635
173 Ga0207681_10000755 3300025923 Bacteria 21272
174 Ga0207687_10000607 3300025927 Bacteria 24149
175 Ga0207687_10054211 3300025927 Bacteria 2804
176 Ga0207664_10049750 3300025929 Bacteria 3301
177 Ga0207644_10017560 3300025931 Bacteria 4835
178 Ga0207644_10022808 3300025931 Bacteria 4280
179 Ga0207706_10004704 3300025933 Bacteria 12786
180 Ga0207706_10053537 3300025933 Bacteria 3562
181 Ga0207686_10156688 3300025934 Bacteria 1592
182 Ga0207686_10296569 3300025934 Bacteria 1199
183 Ga0207709_10007651 3300025935 Bacteria 5995
184 Ga0207669_10044398 3300025937 Bacteria 2610
185 Ga0207704_10177048 3300025938 Bacteria 1537
186 Ga0207665_10004691 3300025939 Bacteria 9079
187 Ga0207665_10008231 3300025939 Bacteria 6885
188 Ga0207711_10000577 3300025941 Bacteria 37314
189 Ga0207711_10307298 3300025941 Bacteria 1463
190 Ga0207689_10015295 3300025942 Bacteria 6496
191 Ga0207689_10063375 3300025942 Bacteria 3041
192 Ga0207712_10000162 3300025961 Bacteria 69049
193 Ga0207712_10026821 3300025961 Bacteria 3843
194 Ga0207712_10031636 3300025961 Bacteria 3566
195 Ga0207668_10009864 3300025972 Bacteria 5738
196 Ga0207668_10120576 3300025972 Bacteria 1985
197 Ga0207640_10006068 3300025981 Bacteria 6605
198 Ga0207658_10000290 3300025986 Bacteria 52606
199 Ga0207658_10024862 3300025986 Bacteria 4190
200 Ga0207658_10045215 3300025986 Bacteria 3209
201 Ga0207658_10073412 3300025986 Bacteria 2597
202 Ga0207658_10212191 3300025986 Bacteria 1623
203 Ga0207677_10001972 3300026023 Bacteria 10861
204 Ga0207703_10035361 3300026035 Bacteria 3970
205 Ga0207703_10104679 3300026035 Bacteria 2404
206 Ga0207678_10049138 3300026067 Bacteria 3645
207 Ga0207678_10248641 3300026067 Bacteria 1523
208 Ga0207708_10002670 3300026075 Bacteria 13101
209 Ga0207702_10256986 3300026078 Bacteria 1643
210 Ga0207641_10030574 3300026088 Bacteria 4462
211 Ga0207641_10076880 3300026088 Bacteria 2887
212 Ga0207648_10000899 3300026089 Bacteria 33528
213 Ga0207648_10028798 3300026089 Bacteria 4924
214 Ga0207676_10310619 3300026095 Bacteria 1443
215 Ga0207675_100000475 3300026118 Bacteria 39052
216 Ga0207675_100026574 3300026118 Bacteria 5389
217 Ga0207683_10000256 3300026121 Bacteria 47418
218 Ga0207683_10027782 3300026121 Bacteria 4889
219 Ga0207683_10239125 3300026121 Bacteria 1656
220 Ga0207698_10040508 3300026142 Bacteria 3463
221 Ga0207698_10364363 3300026142 Bacteria 1370
222 Ga0209813_10027586 3300027866 Bacteria 1650
223 Ga0209813_10063367 3300027866 Bacteria 1185
224 Ga0268266_10002553 3300028379 Bacteria 19324
225 Ga0268265_10000012 3300028380 Bacteria 343132
226 Ga0268264_10000104 3300028381 Bacteria 217837
227 Ga0268264_10045432 3300028381 Bacteria 3646
228 Ga0265327_10000004 3300031251 Bacteria 803973
229 Ga0316575_10016913 3300031665 Bacteria 2765
230 Ga0316579_10030517 3300031691 Bacteria 2464
231 Ga0316576_10014417 3300031727 Bacteria 5281
232 Ga0316578_10017033 3300031728 Bacteria 3946
233 Ga0307405_10037428 3300031731 Bacteria 2916
234 Ga0307405_10113648 3300031731 Bacteria 1839
235 Ga0307410_10013184 3300031852 Bacteria 4812
236 Ga0307410_10187751 3300031852 Bacteria 1570
237 Ga0307407_10033506 3300031903 Bacteria 2804
238 Ga0307409_100013026 3300031995 Bacteria 5329
239 Ga0307409_100216879 3300031995 Bacteria 1724
240 Ga0307416_100031805 3300032002 Bacteria 3978
241 Ga0307416_100038629 3300032002 Bacteria 3685
242 Ga0307416_100067778 3300032002 Bacteria 2945
243 Ga0307414_10063443 3300032004 Bacteria 2626
244 Ga0307411_10189573 3300032005 Bacteria 1569
245 Ga0307415_100019621 3300032126 Bacteria 4109
246 Ga0307415_100060074 3300032126 Bacteria 2625
247 Ga0316585_10027020 3300032137 Bacteria 1788
248 Ga0316580_10001069 3300032139 Bacteria 6891
249 Ga0316580_10036153 3300032139 Bacteria 1529
250 Ga0316574_0000536 3300035398 Bacteria 15600
251 Ga0316574_0005152 3300035398 Bacteria 6950
252 Ga0373947_0094510 3300035725 Bacteria 1870
253 Ga0316582_0003860 3300036647 Bacteria 7456
254 Ga0316582_0370091 3300036647 Bacteria 986
255 Ga0316584_0008053 3300036712 Bacteria 7238
256 Ga0316584_0019274 3300036712 Bacteria 4931
257 Ga0395900_0016786 3300037418 Bacteria 7468
258 Ga0395900_0192498 3300037418 Bacteria 2068
259 Ga0436364_0017256 3300037853 Bacteria 10399
260 Ga0436364_0127308 3300037853 Bacteria 15139
261 Ga0436365_1936949 3300039437 Bacteria 4857
262 Ga0436363_0195135 3300039450 Bacteria 2847
263 Ga0439461_0000057 3300041410 Bacteria 13747
264 Ga0439461_0005684 3300041410 Bacteria 2139
265 Ga0439466_0001478 3300041411 Bacteria 9175
266 Ga0439466_0013821 3300041411 Bacteria 2951
267 Ga0439466_0030871 3300041411 Bacteria 1835
268 Ga0439465_0001085 3300041413 Bacteria 8704
269 Ga0439465_0003456 3300041413 Bacteria 5150
270 Ga0439465_0013910 3300041413 Bacteria 2505
271 Ga0439431_0000502 3300041997 Bacteria 8282
272 Ga0439431_0008641 3300041997 Bacteria 2292
273 Ga0439445_0003316 3300042004 Bacteria 3617
274 Ga0466972_0012420 3300044658 Bacteria 4280
275 Ga0466972_0013784 3300044658 Bacteria 4057
276 Ga0466972_0030185 3300044658 Bacteria 2669
277 Ga0466972_0053267 3300044658 Bacteria 1948
278 Ga0466972_0122678 3300044658 Bacteria 1225
279 Ga0466965_0000426 3300044683 Bacteria 14623
280 Ga0466965_0002241 3300044683 Bacteria 8147
281 Ga0466965_0017752 3300044683 Bacteria 3403
282 Ga0466966_0013095 3300044684 Bacteria 5490
283 Ga0466966_0035159 3300044684 Bacteria 3239
284 Ga0466966_0043004 3300044684 Bacteria 2897
285 Ga0466966_0078649 3300044684 Bacteria 2056
286 Ga0466966_0095060 3300044684 Bacteria 1847
287 Ga0466961_0007134 3300044693 Bacteria 7109
288 Ga0466961_0017790 3300044693 Bacteria 4566
289 Ga0466961_0033574 3300044693 Bacteria 3296
290 Ga0466961_0054117 3300044693 Bacteria 2560
291 Ga0466961_0070184 3300044693 Bacteria 2224
292 Ga0466961_0094133 3300044693 Bacteria 1890
293 Ga0466961_0115522 3300044693 Bacteria 1687
294 Ga0466963_0015008 3300044694 Bacteria 4788
295 Ga0466963_0021189 3300044694 Bacteria 4097
296 Ga0466963_0040686 3300044694 Bacteria 3047
297 Ga0466963_0108080 3300044694 Bacteria 1908
298 Ga0466971_0095881 3300044719 Bacteria 1360
299 Ga0466968_0001848 3300044735 Bacteria 7646
300 Ga0466968_0001945 3300044735 Bacteria 7490
301 Ga0466968_0014914 3300044735 Bacteria 3075
302 Ga0466970_0004941 3300044765 Bacteria 6584
303 Ga0466970_0011299 3300044765 Bacteria 4550
304 Ga0466970_0016161 3300044765 Bacteria 3844
305 Ga0466970_0032542 3300044765 Bacteria 2755
306 Ga0466970_0195271 3300044765 Bacteria 1125
307 Ga0466957_0004418 3300044842 Bacteria 7826
308 Ga0466957_0009553 3300044842 Bacteria 5539
309 Ga0466957_0009874 3300044842 Bacteria 5458
310 Ga0466957_0015425 3300044842 Bacteria 4464
311 Ga0466957_0049778 3300044842 Bacteria 2548
312 Ga0466957_0094577 3300044842 Bacteria 1877
313 Ga0466960_0000399 3300044901 Bacteria 14825
314 Ga0466960_0068127 3300044901 Bacteria 1764
315 Ga0466959_0002507 3300045049 Bacteria 11763
316 Ga0466959_0005920 3300045049 Bacteria 8423
317 Ga0466959_0025699 3300045049 Bacteria 4366
318 Ga0466959_0100383 3300045049 Bacteria 2072
319 Ga0466959_0104746 3300045049 Bacteria 2023
320 Ga0466958_0001682 3300045836 Bacteria 10668
321 Ga0466958_0006309 3300045836 Bacteria 6445
322 Ga0466958_0022838 3300045836 Bacteria 3667
323 Ga0466958_0060893 3300045836 Bacteria 2298
324 Ga0466958_0240654 3300045836 Bacteria 1156
325 Ga0466967_0007286 3300045976 Bacteria 7962
326 Ga0466967_0009511 3300045976 Bacteria 7217
327 Ga0466967_0009954 3300045976 Bacteria 7099
328 Ga0466967_0018623 3300045976 Bacteria 5556
329 Ga0466967_0075274 3300045976 Bacteria 3034
330 Ga0466967_0142916 3300045976 Bacteria 2230
331 Ga0466967_0322977 3300045976 Bacteria 1489
332 Ga0495629_0008795 3300046459 Bacteria 7425
333 Ga0495638_0066001 3300046460 Bacteria 2225
334 Ga0495641_0022692 3300046461 Bacteria 3134
335 Ga0495582_0032253 3300046473 Bacteria 2882
336 Ga0495662_0065523 3300046476 Bacteria 1756
337 Ga0495606_0041636 3300046507 Bacteria 3079
338 Ga0495608_0135517 3300046511 Bacteria 1574
339 Ga0495620_0128429 3300046515 Bacteria 996
340 Ga0495648_0003145 3300046524 Bacteria 14696
341 Ga0495640_0017664 3300046533 Bacteria 5310
342 Ga0495668_0041664 3300046616 Bacteria 2557
343 Ga0495581_0014247 3300047315 Bacteria 4610
344 Ga0495674_0057995 3300047319 Bacteria 3387
345 Ga0495672_0002466 3300047320 Bacteria 17010
346 Ga0495676_0107320 3300047321 Bacteria 2056
347 Ga0495680_0256018 3300047322 Bacteria 1239
348 Ga0495673_0000617 3300047469 Bacteria 35151
349 Ga0495686_0001525 3300047472 Bacteria 24906
350 Ga0495686_0204290 3300047472 Bacteria 1132
351 Ga0495593_0026619 3300047673 Bacteria 3191
352 Ga0496100_0003787 3300048903 Bacteria 7918
353 Ga0496100_0012530 3300048903 Bacteria 4864
354 Ga0496100_0027255 3300048903 Bacteria 3512
355 Ga0496101_0000037 3300048904 Bacteria 166198
356 Ga0496101_0011600 3300048904 Bacteria 5853
357 Ga0496101_0036793 3300048904 Bacteria 3468
358 Ga0496101_0092724 3300048904 Bacteria 2249
359 Ga0496101_0275921 3300048904 Bacteria 1313
360 Ga0496102_0000083 3300048905 Bacteria 138102
361 Ga0496102_0000214 3300048905 Bacteria 76691
362 Ga0496102_0000919 3300048905 Bacteria 27779
363 Ga0496102_0033494 3300048905 Bacteria 4618
364 Ga0496102_0052213 3300048905 Bacteria 3724
365 Ga0496102_0122585 3300048905 Bacteria 2428
366 Ga0496102_0194261 3300048905 Bacteria 1913
367 Ga0496103_0000060 3300048906 Bacteria 138526
368 Ga0496103_0000962 3300048906 Bacteria 20448
369 Ga0496103_0002078 3300048906 Bacteria 12794
370 Ga0496103_0154174 3300048906 Bacteria 1472
371 Ga0496104_0001820 3300048907 Bacteria 18473
372 Ga0496104_0363777 3300048907 Bacteria 1359
373 Ga0496105_0031467 3300048908 Bacteria 4350
374 Ga0496105_0237476 3300048908 Bacteria 1480
375 Ga0496106_0000492 3300048909 Bacteria 28002
376 Ga0496106_0010992 3300048909 Bacteria 6693
377 Ga0496106_0038658 3300048909 Bacteria 3572
378 Ga0496107_0004512 3300048910 Bacteria 9435
379 Ga0496107_0023517 3300048910 Bacteria 4356
380 Ga0496107_0067300 3300048910 Bacteria 2599
381 Ga0496108_0015998 3300048911 Bacteria 6116
382 Ga0496108_0019230 3300048911 Bacteria 5607
383 Ga0496108_0043605 3300048911 Bacteria 3746
384 Ga0496108_0210743 3300048911 Bacteria 1687
385 Ga0496109_0039660 3300048912 Bacteria 4263
386 Ga0496109_0050241 3300048912 Bacteria 3798
387 Ga0496109_0081954 3300048912 Bacteria 2973
388 Ga0496109_0174577 3300048912 Bacteria 2017
389 Ga0496109_0350758 3300048912 Bacteria 1394
390 Ga0496109_0359079 3300048912 Bacteria 1376
391 Ga0496110_0000314 3300048913 Bacteria 32034
392 Ga0496110_0015233 3300048913 Bacteria 6395
393 Ga0496110_0017694 3300048913 Bacteria 5962
394 Ga0496110_0077083 3300048913 Bacteria 2965
395 Ga0496110_0156313 3300048913 Bacteria 2066
396 Ga0496111_0001378 3300048914 Bacteria 13786
397 Ga0496111_0169670 3300048914 Bacteria 1621
398 Ga0496112_0006259 3300048915 Bacteria 10433
399 Ga0496112_0083273 3300048915 Bacteria 3164
400 Ga0496112_0086114 3300048915 Bacteria 3109
401 Ga0496112_0133715 3300048915 Bacteria 2451
402 Ga0496112_0285912 3300048915 Bacteria 1595
403 Ga0496113_0033185 3300048916 Bacteria 3757
404 Ga0496113_0169452 3300048916 Bacteria 1729
405 Ga0496113_0182401 3300048916 Bacteria 1664
406 Ga0496113_0240802 3300048916 Bacteria 1443
407 Ga0496114_0005948 3300048917 Bacteria 9592
408 Ga0496114_0069437 3300048917 Bacteria 2959
409 Ga0496115_0099635 3300048918 Bacteria 2381
410 Ga0496116_0000159 3300048919 Bacteria 138102
411 Ga0496117_0000167 3300048920 Bacteria 138102
412 Ga0496117_0001209 3300048920 Bacteria 38718
413 Ga0496118_0000121 3300048921 Bacteria 138102
414 Ga0496118_0000331 3300048921 Bacteria 80747
415 Ga0496119_0003922 3300048922 Bacteria 15091
416 Ga0496119_0008446 3300048922 Bacteria 9041
417 Ga0496119_0014691 3300048922 Bacteria 6100
418 Ga0496121_0000062 3300048924 Bacteria 274819
419 Ga0496121_0002221 3300048924 Bacteria 30314
420 Ga0496121_0018530 3300048924 Bacteria 7014
421 Ga0496121_0126310 3300048924 Bacteria 1922
422 Ga0496122_0004865 3300048925 Bacteria 16331
423 Ga0496123_0008886 3300048926 Bacteria 9142
424 Ga0496124_0146618 3300048927 Bacteria 1856
425 Ga0496126_0000368 3300048929 Bacteria 92918
426 Ga0496126_0010731 3300048929 Bacteria 9564
427 Ga0501032_0014352 3300049569 Bacteria 5610
428 Ga0501033_0204011 3300049570 Bacteria 1411
429 Ga0501034_0002428 3300049571 Bacteria 22520
430 Ga0501034_0006313 3300049571 Bacteria 12761
431 Ga0501036_0139357 3300049572 Bacteria 2047
432 Ga0501037_0000252 3300049573 Bacteria 45847
433 Ga0501037_0103184 3300049573 Bacteria 2057
434 Ga0501038_0045737 3300049574 Bacteria 3798
435 Ga0501038_0313739 3300049574 Bacteria 1228
436 Ga0501039_0000203 3300049575 Bacteria 43175
437 Ga0501043_0001822 3300049579 Bacteria 18294
438 Ga0501046_0111069 3300049580 Bacteria 2094
439 Ga0501047_0038827 3300049581 Bacteria 4606
440 Ga0501067_0029967 3300049583 Bacteria 3017
441 Ga0501070_0001055 3300049586 Bacteria 24784
442 Ga0501070_0033395 3300049586 Bacteria 4306
443 Ga0501070_0223667 3300049586 Bacteria 1543
444 Ga0501073_0031521 3300049589 Bacteria 3782
445 Ga0501079_0206203 3300049741 Bacteria 1536
446 Ga0501080_0139743 3300049742 Bacteria 2240
447 Ga0501080_0201129 3300049742 Bacteria 1829
448 Ga0501035_0000679 3300049822 Bacteria 37221
449 Ga0501044_0000410 3300049823 Bacteria 52916
450 Ga0501044_0060069 3300049823 Bacteria 3894
451 Ga0501044_0065212 3300049823 Bacteria 3715
452 nmdc:mga03n38_12715_c1 3300050490 Bacteria 3177
453 nmdc:mga03n38_5075_c1 3300050490 Bacteria 4443
454 nmdc:mga03n38_62941_c1 3300050490 Bacteria 1694
455 nmdc:mga03n38_9214_c1 3300050490 Bacteria 3579
456 nmdc:mga00v17_133554_c1 3300050491 Bacteria 1587
457 nmdc:mga00v17_15909_c1 3300050491 Bacteria 4232
458 nmdc:mga00v17_31300_c1 3300050491 Bacteria 3137
459 nmdc:mga00v17_44234_c1 3300050491 Bacteria 2685
460 nmdc:mga00v17_6708_c1 3300050491 Bacteria 6117
461 nmdc:mga00v17_80841_c1 3300050491 Bacteria 2029
462 nmdc:mga0yw44_106426_c1 3300050492 Bacteria 1793
463 nmdc:mga0yw44_29777_c1 3300050492 Bacteria 3155
464 nmdc:mga0yw44_3684_c1 3300050492 Bacteria 6857
465 nmdc:mga06z11_35852_c1 3300050494 Bacteria 2444
466 nmdc:mga04h51_32749_c1 3300050495 Bacteria 1650
467 nmdc:mga07m45_19674_c1 3300050496 Bacteria 3659
468 nmdc:mga07m45_42316_c1 3300050496 Bacteria 2553
469 nmdc:mga09592_241416_c1 3300050508 Bacteria 1565
470 nmdc:mga0qj67_475262_c1 3300050509 Bacteria 1006
471 nmdc:mga08y16_599757_c1 3300050511 Bacteria 1110
472 nmdc:mga0sz30_104681_c1 3300050516 Bacteria 1237
473 nmdc:mga0sz30_113751_c1 3300050516 Bacteria 1187
474 nmdc:mga0sz30_13178_c1 3300050516 Bacteria 3232
475 nmdc:mga0sz30_17472_c1 3300050516 Bacteria 2861
476 nmdc:mga0sz30_4250_c1 3300050516 Bacteria 5165
477 nmdc:mga0sz30_5149_c1 3300050516 Bacteria 2183
478 nmdc:mga0sz30_72497_c1 3300050516 Bacteria 1484
479 Ga0500635_0009614 3300053080 Bacteria 2689
480 Ga0495655_0014051 3300053083 Bacteria 1671
481 Ga0500644_0000164 3300053088 Bacteria 41953
482 Ga0500556_0000721 3300053104 Bacteria 19917
483 Ga0500593_000209 3300053117 Bacteria 24034
484 Ga0500608_054988 3300053122 Bacteria 1909
485 Ga0500652_000250 3300053131 Bacteria 20250
486 Ga0500616_0005818 3300053153 Bacteria 8273
487 Ga0500645_000082 3300053730 Bacteria 76473
488 Ga0466962_0000668 3300061719 Bacteria 15239
489 Ga0466962_0008591 3300061719 Bacteria 4895
490 2643825120 2643221561 Bacteria 4984412
491 2643891769 2643221576 Bacteria 5214352
492 2643960817 2643221590 Bacteria 5214697
493 2644034252 2643221604 Bacteria 5014917
494 2644089924 2643221615 Bacteria 5487866
495 2644098646 2643221617 Bacteria 5139111
496 2644116007 2643221620 Bacteria 5134593
497 2644319769 2643221657 Bacteria 5490246
498 2644534576 2643221696 Bacteria 5431823
499 2644639638 2643221715 Bacteria 6671032
500 2738703517 2738541274 Bacteria 6909446
501 2738871480 2738541305 Bacteria 4910150
502 2739329022 2738543028 Bacteria 6917070
503 2744957240 2744054611 Bacteria 5611514
504 2812333588 2811994874 Bacteria 5367947
505 2842136479 2842134933 Bacteria 5847019
506 2855388684 2855386786 Bacteria 4752232
507 2902795650 2902792274 Bacteria 7270173
508 2902800869 2902799365 Bacteria 5419524
509 2902814276 2902810491 Bacteria 6794147
510 2902842602 2902837492 Bacteria 6697721
511 2929218114 2929212328 Bacteria 7708288
512 2939584033 2939582691 Bacteria 7088898
513 3001890120 3001889506 Bacteria 2975194
514 Ga0496120_0049899
515 JGI24742J22300_10001568
516 Ga0055540_1000332
517 Ga0070683_100220139
518 Ga0070690_100007705
519 Ga0070670_100146735
520 Ga0068869_100024891
521 Ga0070666_10010462
522 Ga0070682_100013235
523 Ga0070682_100054375
524 Ga0068868_100007488
525 Ga0070687_100226527
526 Ga0070668_100001930
527 Ga0070668_100019451
528 Ga0070669_100000974
529 Ga0070671_100007204
530 Ga0070671_100032131
531 Ga0070674_100001949
532 Ga0070688_100009863
533 Ga0070659_100138130
534 Ga0070667_100000220
535 Ga0070667_100048632
536 Ga0070667_100062646
537 Ga0070667_100372393
538 Ga0070714_100025705
539 Ga0070701_10004346
540 Ga0070701_10192028
541 Ga0070711_100011015
542 Ga0070711_100389350
543 Ga0070705_100003339
544 Ga0070700_100002414
545 Ga0070663_100104605
546 Ga0070663_100192895
547 Ga0070678_100001019
548 Ga0070662_100003538
549 Ga0070662_100025892
550 Ga0068853_100004268
551 Ga0068853_100029723
552 Ga0070696_100001399
553 Ga0070693_100015319
554 Ga0070665_100003829
555 Ga0070665_100011466
556 Ga0070665_100503536
557 Ga0070665_100545148
558 Ga0070704_100017773
559 Ga0070704_100068990
560 Ga0068855_100427949
561 Ga0068855_100581087
562 Ga0068854_100001142
563 Ga0068854_100238225
564 Ga0070702_100006934
565 Ga0068852_100080567
566 Ga0068852_100087243
567 Ga0068852_100181801
568 Ga0068859_100005670
569 Ga0068859_100067695
570 Ga0068859_100071300
571 Ga0068864_100085013
572 Ga0068864_100365075
573 Ga0068866_10001263
574 Ga0068861_100014924
575 Ga0068861_100188750
576 Ga0068863_100015889
577 Ga0068863_100016513
578 Ga0068863_100081526
579 Ga0068858_100208307
580 Ga0068860_100000150
581 Ga0068860_100003008
582 Ga0068862_100000078
583 Ga0068862_100000569
584 Ga0068862_100056700
585 Ga0068862_100065364
586 Ga0081455_10003328
587 Ga0081455_10052964
588 Ga0075365_10000492
589 Ga0075365_10001223
590 Ga0075365_10004243
591 Ga0075365_10019760
592 Ga0075365_10129928
593 Ga0075368_10004216
594 Ga0075368_10067808
595 Ga0075363_100001386
596 Ga0075363_100002067
597 Ga0075363_100006316
598 Ga0075363_100187314
599 Ga0075364_10001434
600 Ga0075364_10006670
601 Ga0075364_10110068
602 Ga0070715_10017646
603 Ga0070716_100001464
604 Ga0070716_100009984
605 Ga0070712_100003275
606 Ga0075362_10014629
607 Ga0075362_10087702
608 Ga0075367_10021307
609 Ga0075367_10035759
610 Ga0075367_10068847
611 Ga0075369_10000676
612 Ga0075369_10015622
613 Ga0075369_10047890
614 Ga0075369_10050988
615 Ga0075369_10055119
616 Ga0075370_10005265
617 Ga0075370_10117000
618 Ga0068871_100107615
619 Ga0075428_100023235
620 Ga0075431_100116819
621 Ga0075429_100179436
622 Ga0068865_100003418
623 Ga0097620_100005671
624 Ga0097620_100067695
625 Ga0097620_100071300
626 Ga0105250_10131334
627 Ga0105245_10020687
628 Ga0105245_10030182
629 Ga0105245_10058118
630 Ga0105247_10000074
631 Ga0114129_10016083
632 Ga0105243_10006541
633 Ga0105242_10001099
634 Ga0105248_10000077
635 Ga0105248_10008850
636 Ga0105237_10004195
637 Ga0105237_10098304
638 Ga0105237_10339794
639 Ga0105238_10272119
640 Ga0105249_10000111
641 Ga0105249_10003780
642 Ga0105249_10037912
643 Ga0099796_10010705
644 Ga0105239_10081261
645 Ga0105246_10032968
646 Ga0157371_10128090
647 Ga0157374_10117122
648 Ga0157378_10005481
649 Ga0163162_10003427
650 Ga0163162_10020836
651 Ga0157372_10002067
652 Ga0157372_10394290
653 Ga0157375_10005799
654 Ga0157375_10082362
655 Ga0163163_10004383
656 Ga0163163_10005638
657 Ga0163163_10164151
658 Ga0157380_10000655
659 Ga0157377_10187405
660 Ga0157379_10000746
661 Ga0157379_10024361
662 Ga0157379_10073686
663 Ga0157376_10014063
664 Ga0163161_10003326
665 Ga0163161_10024384
666 Ga0213875_10014567
667 Ga0213875_10051526
668 Ga0209051_1000557
669 Ga0209051_1000728
670 Ga0207692_10019301
671 Ga0207692_10036593
672 Ga0207692_10169699
673 Ga0207642_10005334
674 Ga0207642_10017551
675 Ga0207710_10000086
676 Ga0207688_10002788
677 Ga0207680_10008079
678 Ga0207647_10031852
679 Ga0207685_10004626
680 Ga0207685_10093199
681 Ga0207671_10005856
682 Ga0207693_10000380
683 Ga0207693_10004573
684 Ga0207663_10001584
685 Ga0207657_10050116
686 Ga0207681_10000755
687 Ga0207687_10000607
688 Ga0207687_10054211
689 Ga0207664_10049750
690 Ga0207644_10017560
691 Ga0207644_10022808
692 Ga0207706_10004704
693 Ga0207706_10053537
694 Ga0207686_10156688
695 Ga0207686_10296569
696 Ga0207709_10007651
697 Ga0207669_10044398
698 Ga0207704_10177048
699 Ga0207665_10004691
700 Ga0207665_10008231
701 Ga0207711_10000577
702 Ga0207711_10307298
703 Ga0207689_10015295
704 Ga0207689_10063375
705 Ga0207712_10000162
706 Ga0207712_10026821
707 Ga0207712_10031636
708 Ga0207668_10009864
709 Ga0207668_10120576
710 Ga0207640_10006068
711 Ga0207658_10000290
712 Ga0207658_10024862
713 Ga0207658_10045215
714 Ga0207658_10073412
715 Ga0207658_10212191
716 Ga0207677_10001972
717 Ga0207703_10035361
718 Ga0207703_10104679
719 Ga0207678_10049138
720 Ga0207678_10248641
721 Ga0207708_10002670
722 Ga0207702_10256986
723 Ga0207641_10030574
724 Ga0207641_10076880
725 Ga0207648_10000899
726 Ga0207648_10028798
727 Ga0207676_10310619
728 Ga0207675_100000475
729 Ga0207675_100026574
730 Ga0207683_10000256
731 Ga0207683_10027782
732 Ga0207683_10239125
733 Ga0207698_10040508
734 Ga0207698_10364363
735 Ga0209813_10027586
736 Ga0209813_10063367
737 Ga0268266_10002553
738 Ga0268265_10000012
739 Ga0268264_10000104
740 Ga0268264_10045432
741 Ga0265327_10000004
742 Ga0316575_10016913
743 Ga0316579_10030517
744 Ga0316576_10014417
745 Ga0316578_10017033
746 Ga0307405_10037428
747 Ga0307405_10113648
748 Ga0307410_10013184
749 Ga0307410_10187751
750 Ga0307407_10033506
751 Ga0307409_100013026
752 Ga0307409_100216879
753 Ga0307416_100031805
754 Ga0307416_100038629
755 Ga0307416_100067778
756 Ga0307414_10063443
757 Ga0307411_10189573
758 Ga0307415_100019621
759 Ga0307415_100060074
760 Ga0316585_10027020
761 Ga0316580_10001069
762 Ga0316580_10036153
763 Ga0316574_0000536
764 Ga0316574_0005152
765 Ga0373947_0094510
766 Ga0316582_0003860
767 Ga0316582_0370091
768 Ga0316584_0008053
769 Ga0316584_0019274
770 Ga0395900_0016786
771 Ga0395900_0192498
772 Ga0436364_0017256
773 Ga0436364_0127308
774 Ga0436365_1936949
775 Ga0436363_0195135
776 Ga0439461_0000057
777 Ga0439461_0005684
778 Ga0439466_0001478
779 Ga0439466_0013821
780 Ga0439466_0030871
781 Ga0439465_0001085
782 Ga0439465_0003456
783 Ga0439465_0013910
784 Ga0439431_0000502
785 Ga0439431_0008641
786 Ga0439445_0003316
787 Ga0466972_0012420
788 Ga0466972_0013784
789 Ga0466972_0030185
790 Ga0466972_0053267
791 Ga0466972_0122678
792 Ga0466965_0000426
793 Ga0466965_0002241
794 Ga0466965_0017752
795 Ga0466966_0013095
796 Ga0466966_0035159
797 Ga0466966_0043004
798 Ga0466966_0078649
799 Ga0466966_0095060
800 Ga0466961_0007134
801 Ga0466961_0017790
802 Ga0466961_0033574
803 Ga0466961_0054117
804 Ga0466961_0070184
805 Ga0466961_0094133
806 Ga0466961_0115522
807 Ga0466963_0015008
808 Ga0466963_0021189
809 Ga0466963_0040686
810 Ga0466963_0108080
811 Ga0466971_0095881
812 Ga0466968_0001848
813 Ga0466968_0001945
814 Ga0466968_0014914
815 Ga0466970_0004941
816 Ga0466970_0011299
817 Ga0466970_0016161
818 Ga0466970_0032542
819 Ga0466970_0195271
820 Ga0466957_0004418
821 Ga0466957_0009553
822 Ga0466957_0009874
823 Ga0466957_0015425
824 Ga0466957_0049778
825 Ga0466957_0094577
826 Ga0466960_0000399
827 Ga0466960_0068127
828 Ga0466959_0002507
829 Ga0466959_0005920
830 Ga0466959_0025699
831 Ga0466959_0100383
832 Ga0466959_0104746
833 Ga0466958_0001682
834 Ga0466958_0006309
835 Ga0466958_0022838
836 Ga0466958_0060893
837 Ga0466958_0240654
838 Ga0466967_0007286
839 Ga0466967_0009511
840 Ga0466967_0009954
841 Ga0466967_0018623
842 Ga0466967_0075274
843 Ga0466967_0142916
844 Ga0466967_0322977
845 Ga0495629_0008795
846 Ga0495638_0066001
847 Ga0495641_0022692
848 Ga0495582_0032253
849 Ga0495662_0065523
850 Ga0495606_0041636
851 Ga0495608_0135517
852 Ga0495620_0128429
853 Ga0495648_0003145
854 Ga0495640_0017664
855 Ga0495668_0041664
856 Ga0495581_0014247
857 Ga0495674_0057995
858 Ga0495672_0002466
859 Ga0495676_0107320
860 Ga0495680_0256018
861 Ga0495673_0000617
862 Ga0495686_0001525
863 Ga0495686_0204290
864 Ga0495593_0026619
865 Ga0496100_0003787
866 Ga0496100_0012530
867 Ga0496100_0027255
868 Ga0496101_0000037
869 Ga0496101_0011600
870 Ga0496101_0036793
871 Ga0496101_0092724
872 Ga0496101_0275921
873 Ga0496102_0000083
874 Ga0496102_0000214
875 Ga0496102_0000919
876 Ga0496102_0033494
877 Ga0496102_0052213
878 Ga0496102_0122585
879 Ga0496102_0194261
880 Ga0496103_0000060
881 Ga0496103_0000962
882 Ga0496103_0002078
883 Ga0496103_0154174
884 Ga0496104_0001820
885 Ga0496104_0363777
886 Ga0496105_0031467
887 Ga0496105_0237476
888 Ga0496106_0000492
889 Ga0496106_0010992
890 Ga0496106_0038658
891 Ga0496107_0004512
892 Ga0496107_0023517
893 Ga0496107_0067300
894 Ga0496108_0015998
895 Ga0496108_0019230
896 Ga0496108_0043605
897 Ga0496108_0210743
898 Ga0496109_0039660
899 Ga0496109_0050241
900 Ga0496109_0081954
901 Ga0496109_0174577
902 Ga0496109_0350758
903 Ga0496109_0359079
904 Ga0496110_0000314
905 Ga0496110_0015233
906 Ga0496110_0017694
907 Ga0496110_0077083
908 Ga0496110_0156313
909 Ga0496111_0001378
910 Ga0496111_0169670
911 Ga0496112_0006259
912 Ga0496112_0083273
913 Ga0496112_0086114
914 Ga0496112_0133715
915 Ga0496112_0285912
916 Ga0496113_0033185
917 Ga0496113_0169452
918 Ga0496113_0182401
919 Ga0496113_0240802
920 Ga0496114_0005948
921 Ga0496114_0069437
922 Ga0496115_0099635
923 Ga0496116_0000159
924 Ga0496117_0000167
925 Ga0496117_0001209
926 Ga0496118_0000121
927 Ga0496118_0000331
928 Ga0496119_0003922
929 Ga0496119_0008446
930 Ga0496119_0014691
931 Ga0496121_0000062
932 Ga0496121_0002221
933 Ga0496121_0018530
934 Ga0496121_0126310
935 Ga0496122_0004865
936 Ga0496123_0008886
937 Ga0496124_0146618
938 Ga0496126_0000368
939 Ga0496126_0010731
940 Ga0501032_0014352
941 Ga0501033_0204011
942 Ga0501034_0002428
943 Ga0501034_0006313
944 Ga0501036_0139357
945 Ga0501037_0000252
946 Ga0501037_0103184
947 Ga0501038_0045737
948 Ga0501038_0313739
949 Ga0501039_0000203
950 Ga0501043_0001822
951 Ga0501046_0111069
952 Ga0501047_0038827
953 Ga0501067_0029967
954 Ga0501070_0001055
955 Ga0501070_0033395
956 Ga0501070_0223667
957 Ga0501073_0031521
958 Ga0501079_0206203
959 Ga0501080_0139743
960 Ga0501080_0201129
961 Ga0501035_0000679
962 Ga0501044_0000410
963 Ga0501044_0060069
964 Ga0501044_0065212
965 nmdc:mga03n38_12715_c1
966 nmdc:mga03n38_5075_c1
967 nmdc:mga03n38_62941_c1
968 nmdc:mga03n38_9214_c1
969 nmdc:mga00v17_133554_c1
970 nmdc:mga00v17_15909_c1
971 nmdc:mga00v17_31300_c1
972 nmdc:mga00v17_44234_c1
973 nmdc:mga00v17_6708_c1
974 nmdc:mga00v17_80841_c1
975 nmdc:mga0yw44_106426_c1
976 nmdc:mga0yw44_29777_c1
977 nmdc:mga0yw44_3684_c1
978 nmdc:mga06z11_35852_c1
979 nmdc:mga04h51_32749_c1
980 nmdc:mga07m45_19674_c1
981 nmdc:mga07m45_42316_c1
982 nmdc:mga09592_241416_c1
983 nmdc:mga0qj67_475262_c1
984 nmdc:mga08y16_599757_c1
985 nmdc:mga0sz30_104681_c1
986 nmdc:mga0sz30_113751_c1
987 nmdc:mga0sz30_13178_c1
988 nmdc:mga0sz30_17472_c1
989 nmdc:mga0sz30_4250_c1
990 nmdc:mga0sz30_5149_c1
991 nmdc:mga0sz30_72497_c1
992 Ga0500635_0009614
993 Ga0495655_0014051
994 Ga0500644_0000164
995 Ga0500556_0000721
996 Ga0500593_000209
997 Ga0500608_054988
998 Ga0500652_000250
999 Ga0500616_0005818
1000 Ga0500645_000082
1001 Ga0466962_0000668
1002 Ga0466962_0008591
1003 2643825120
1004 2643891769
1005 2643960817
1006 2644034252
1007 2644089924
1008 2644098646
1009 2644116007
1010 2644319769
1011 2644534576
1012 2644639638
1013 2738703517
1014 2738871480
1015 2739329022
1016 2744957240
1017 2812333588
1018 2842136479
1019 2855388684
1020 2902795650
1021 2902800869
1022 2902814276
1023 2902842602
1024 2929218114
1025 2939584033
1026 3001890120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01197

Ribosomal_L31

Ribosomal protein L31

1

57

0.88

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

95

316

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3x2x-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h48a from thermotoga maritima 0.7654 28 301
1vjn-assembly1.cif.gz_A crystal structure of a putative zn-dependent hydrolase of the metallo-beta-lactamase superfamily (tm0207) from thermotoga maritima at 2.00 a resolution 0.7652 28 281
3x2y-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h8a from thermotoga maritima 0.7548 28 301
1vjn-assembly2.cif.gz_B crystal structure of a putative zn-dependent hydrolase of the metallo-beta-lactamase superfamily (tm0207) from thermotoga maritima at 2.00 a resolution 0.7544 28 254
3x2x-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h48a from thermotoga maritima 0.7505 28 301
ID Description Score Start End Superfamily
af_P96859_2_261_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9995 20 278 3.60.15.10
af_P96859_2_261_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9918 20 278 3.60.15.10
af_Q8IK95_37_136_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7721 87 202 3.60.15.10
3x30A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7688 29 301 3.60.15.10
3x30A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7532 29 301 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A385HJ81-F1-model_v4 deleted 0.9971 1 306
AF-Q7D588-F1-model_v4 MBL fold metallo-hydrolase 0.997 1 306
AF-A0A2C9T5T8-F1-model_v4 MBL fold metallo-hydrolase 0.9969 1 306 GO:0016787
AF-A0A655ATR7-F1-model_v4 Putative Zn-dependent hydrolases 0.9967 66 306 GO:0016787
AF-A0A847CNQ2-F1-model_v4 MBL fold metallo-hydrolase 0.9938 1 306 GO:0016787

Map