F457521

General Info

Members Datasets Scaffolds Average Seq Length
513 241 1026 208

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100554616|Ga0068868_1005546161
Length 227
Sequence MTSGPPEVVPGTAQGPAPLRSQSGSLSSSVAALGGAFGSAIERQFVSSGQTVVYLARDRSHEILAWLKDTPGQEYNYLTDVTAVEYRDPERPLEVVYQLRSLGRKADLRLKVALDKRAPLEVQSIYDLWRGADWLEREVYDMFGITFVGHPDLRRILMWETYAEGFPLRKDFPLRGHFSRAEQTRQALAANPEAHYSLEELSIAENYGELPKEMQERLARGERGCLK

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
156 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
157 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
158 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
159 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
160 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
161 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.58
Rhizosphere 91.23
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100554616 3300005338 Bacteria 1013
2 MBSR1b_contig_8415695 2162886012 Bacteria 1132
3 rootL2_10221127 3300003322 Bacteria 1400
4 Ga0065715_10162094 3300005293 Bacteria 1619
5 Ga0070676_10014529 3300005328 Bacteria 4329
6 Ga0070683_100018532 3300005329 Bacteria 6168
7 Ga0070690_100165006 3300005330 Bacteria 1520
8 Ga0070677_10062371 3300005333 Bacteria 1542
9 Ga0068869_100009604 3300005334 Bacteria 6283
10 Ga0070666_10049082 3300005335 Bacteria 2836
11 Ga0070680_100108646 3300005336 Bacteria 2308
12 Ga0070660_100455874 3300005339 Unclassified 1061
13 Ga0070692_10162495 3300005345 Bacteria 1281
14 Ga0070668_100009824 3300005347 Bacteria 7089
15 Ga0070669_100371115 3300005353 Bacteria 1165
16 Ga0070675_100108958 3300005354 Bacteria 2340
17 Ga0070671_100249928 3300005355 Unclassified 1506
18 Ga0070671_100290361 3300005355 Bacteria 1392
19 Ga0070674_100000493 3300005356 Bacteria 19842
20 Ga0070673_100034798 3300005364 Bacteria 3815
21 Ga0070673_100512564 3300005364 Bacteria 1086
22 Ga0070688_100235861 3300005365 Bacteria 1296
23 Ga0070659_100095583 3300005366 Bacteria 2387
24 Ga0070667_100318141 3300005367 Bacteria 1404
25 Ga0070667_100637199 3300005367 Bacteria 984
26 Ga0070703_10013853 3300005406 Bacteria 2292
27 Ga0070701_10382581 3300005438 Bacteria 887
28 Ga0070705_100003352 3300005440 Bacteria 7864
29 Ga0070705_100007967 3300005440 Bacteria 5236
30 Ga0070705_100028375 3300005440 Bacteria 3065
31 Ga0070705_100120886 3300005440 Bacteria 1691
32 Ga0070708_100003233 3300005445 Bacteria 12711
33 Ga0070663_100078324 3300005455 Bacteria 2423
34 Ga0070678_100013249 3300005456 Bacteria 5162
35 Ga0070678_100508137 3300005456 Bacteria 1064
36 Ga0070662_100004447 3300005457 Bacteria 8864
37 Ga0070662_100236968 3300005457 Bacteria 1462
38 Ga0070681_10079189 3300005458 Bacteria 3242
39 Ga0070681_10376439 3300005458 Bacteria 1330
40 Ga0068867_100014991 3300005459 Bacteria 5495
41 Ga0070706_100312063 3300005467 Bacteria 1467
42 Ga0070707_100044084 3300005468 Bacteria 4269
43 Ga0070707_100084985 3300005468 Bacteria 3058
44 Ga0070698_100026501 3300005471 Bacteria 6034
45 Ga0070698_100255213 3300005471 Bacteria 1686
46 Ga0070698_100454863 3300005471 Bacteria 1216
47 Ga0070698_100767482 3300005471 Bacteria 908
48 Ga0070699_100000224 3300005518 Bacteria 56041
49 Ga0070699_100011913 3300005518 Bacteria 7507
50 Ga0070699_100027984 3300005518 Bacteria 4861
51 Ga0070699_100037295 3300005518 Bacteria 4205
52 Ga0070699_100070495 3300005518 Bacteria 3039
53 Ga0070699_100294418 3300005518 Bacteria 1455
54 Ga0070679_100006938 3300005530 Bacteria 10564
55 Ga0070679_100047205 3300005530 Bacteria 4293
56 Ga0070679_100467536 3300005530 Bacteria 1206
57 Ga0070679_100536271 3300005530 Bacteria 1114
58 Ga0070697_100008980 3300005536 Bacteria 7809
59 Ga0070697_100015408 3300005536 Bacteria 6002
60 Ga0070697_100340140 3300005536 Bacteria 1295
61 Ga0070697_100657058 3300005536 Bacteria 923
62 Ga0070672_100035871 3300005543 Bacteria 3772
63 Ga0070686_100077620 3300005544 Bacteria 2190
64 Ga0070695_100012419 3300005545 Bacteria 5110
65 Ga0070695_100027765 3300005545 Bacteria 3508
66 Ga0070696_100003507 3300005546 Bacteria 10429
67 Ga0070696_100016079 3300005546 Bacteria 5033
68 Ga0070696_100061540 3300005546 Bacteria 2626
69 Ga0070696_100398680 3300005546 Bacteria 1076
70 Ga0070693_100004173 3300005547 Bacteria 6818
71 Ga0070693_100319297 3300005547 Bacteria 1053
72 Ga0070665_100190967 3300005548 Bacteria 2049
73 Ga0070665_100308918 3300005548 Bacteria 1585
74 Ga0070704_100033199 3300005549 Bacteria 3487
75 Ga0070704_100042390 3300005549 Bacteria 3148
76 Ga0068855_100096057 3300005563 Bacteria 3416
77 Ga0070664_100022933 3300005564 Bacteria 5149
78 Ga0070664_100147230 3300005564 Bacteria 2077
79 Ga0070664_100790270 3300005564 Bacteria 887
80 Ga0068857_100091935 3300005577 Bacteria 2716
81 Ga0068857_100550309 3300005577 Bacteria 1087
82 Ga0068856_100291376 3300005614 Bacteria 1649
83 Ga0070702_100062222 3300005615 Bacteria 2176
84 Ga0068852_100095185 3300005616 Bacteria 2674
85 Ga0068859_100083702 3300005617 Bacteria 3234
86 Ga0068859_100104882 3300005617 Bacteria 2886
87 Ga0068859_100660119 3300005617 Bacteria 1137
88 Ga0068859_100853094 3300005617 Bacteria 997
89 Ga0068864_100007997 3300005618 Bacteria 8720
90 Ga0068864_100013441 3300005618 Bacteria 6787
91 Ga0068864_100464092 3300005618 Bacteria 1213
92 Ga0068866_10000250 3300005718 Bacteria 25356
93 Ga0068861_100051535 3300005719 Bacteria 3125
94 Ga0068870_10326544 3300005840 Bacteria 977
95 Ga0068863_100198298 3300005841 Bacteria 1930
96 Ga0068863_100263854 3300005841 Bacteria 1665
97 Ga0068863_100352138 3300005841 Bacteria 1434
98 Ga0068863_101061557 3300005841 Bacteria 814
99 Ga0068858_100030710 3300005842 Bacteria 4990
100 Ga0068860_100444046 3300005843 Bacteria 1289
101 Ga0068862_100028182 3300005844 Bacteria 4729
102 Ga0068862_100210739 3300005844 Bacteria 1756
103 Ga0068862_100210986 3300005844 Bacteria 1755
104 Ga0081455_10045116 3300005937 Bacteria 3838
105 Ga0097621_100052031 3300006237 Bacteria 3335
106 Ga0068871_100068733 3300006358 Bacteria 2909
107 Ga0068871_101201510 3300006358 Bacteria 711
108 Ga0075428_100055047 3300006844 Bacteria 4360
109 Ga0075428_100120276 3300006844 Bacteria 2859
110 Ga0075430_100716577 3300006846 Bacteria 825
111 Ga0075431_100047240 3300006847 Bacteria 4438
112 Ga0075431_100198932 3300006847 Bacteria 2051
113 Ga0075433_10001886 3300006852 Bacteria 15757
114 Ga0075433_10043418 3300006852 Bacteria 3902
115 Ga0075433_10131810 3300006852 Bacteria 2220
116 Ga0075433_10490297 3300006852 Bacteria 1082
117 Ga0075434_100007582 3300006871 Bacteria 10048
118 Ga0075434_100037209 3300006871 Bacteria 4817
119 Ga0075434_100533590 3300006871 Bacteria 1194
120 Ga0075434_101092523 3300006871 Bacteria 811
121 Ga0075429_100002035 3300006880 Bacteria 16830
122 Ga0075429_100115655 3300006880 Bacteria 2345
123 Ga0068865_100004159 3300006881 Bacteria 8705
124 Ga0068865_100622900 3300006881 Bacteria 914
125 Ga0097620_100083702 3300006931 Bacteria 3234
126 Ga0097620_100104883 3300006931 Bacteria 2886
127 Ga0097620_100268234 3300006931 Bacteria 1799
128 Ga0097620_100660126 3300006931 Bacteria 1137
129 Ga0097620_100853052 3300006931 Bacteria 997
130 Ga0075435_100603307 3300007076 Bacteria 952
131 Ga0111539_10154170 3300009094 Bacteria 2688
132 Ga0111539_10208929 3300009094 Bacteria 2275
133 Ga0114129_10000112 3300009147 Bacteria 80956
134 Ga0114129_10027916 3300009147 Bacteria 7992
135 Ga0114129_10165974 3300009147 Bacteria 3013
136 Ga0114129_10996571 3300009147 Bacteria 1055
137 Ga0105243_10030999 3300009148 Bacteria 4121
138 Ga0105241_10003808 3300009174 Bacteria 11182
139 Ga0105242_10008832 3300009176 Bacteria 7734
140 Ga0105248_10027157 3300009177 Bacteria 6368
141 Ga0105237_10499142 3300009545 Bacteria 1223
142 Ga0105237_10613012 3300009545 Bacteria 1095
143 Ga0105249_10036740 3300009553 Bacteria 4444
144 Ga0105239_10026441 3300010375 Bacteria 6387
145 Ga0105239_10064844 3300010375 Bacteria 4010
146 Ga0157373_10366727 3300013100 Unclassified 1029
147 Ga0157378_10000782 3300013297 Bacteria 29520
148 Ga0163162_10296225 3300013306 Bacteria 1749
149 Ga0157372_10207518 3300013307 Bacteria 2270
150 Ga0157375_10107938 3300013308 Bacteria 2878
151 Ga0157375_10721330 3300013308 Bacteria 1150
152 Ga0157375_10816455 3300013308 Bacteria 1081
153 Ga0157375_11139201 3300013308 Bacteria 914
154 Ga0163163_11243019 3300014325 Bacteria 807
155 Ga0157380_10167009 3300014326 Bacteria 1919
156 Ga0157380_10463830 3300014326 Bacteria 1220
157 Ga0157379_10016065 3300014968 Bacteria 6582
158 Ga0157376_10215897 3300014969 Bacteria 1774
159 Ga0207697_10168879 3300025315 Bacteria 956
160 Ga0207653_10016179 3300025885 Bacteria 2342
161 Ga0207642_10001414 3300025899 Bacteria 7443
162 Ga0207680_10009239 3300025903 Bacteria 4879
163 Ga0207647_10071537 3300025904 Bacteria 2092
164 Ga0207645_10004417 3300025907 Bacteria 10409
165 Ga0207645_10260545 3300025907 Bacteria 1148
166 Ga0207643_10037232 3300025908 Bacteria 2729
167 Ga0207684_10060071 3300025910 Bacteria 3228
168 Ga0207684_10069987 3300025910 Bacteria 2981
169 Ga0207654_10013666 3300025911 Bacteria 4180
170 Ga0207707_10004621 3300025912 Bacteria 12097
171 Ga0207671_10474150 3300025914 Bacteria 997
172 Ga0207660_10002149 3300025917 Bacteria 13085
173 Ga0207660_10107215 3300025917 Bacteria 2096
174 Ga0207657_10194063 3300025919 Bacteria 1637
175 Ga0207652_10015448 3300025921 Bacteria 6206
176 Ga0207652_10115181 3300025921 Bacteria 2388
177 Ga0207652_10647860 3300025921 Bacteria 945
178 Ga0207646_10050091 3300025922 Bacteria 3738
179 Ga0207646_10153712 3300025922 Bacteria 2075
180 Ga0207681_10019650 3300025923 Bacteria 4272
181 Ga0207681_10134604 3300025923 Bacteria 1832
182 Ga0207659_10074002 3300025926 Bacteria 2496
183 Ga0207659_10119307 3300025926 Bacteria 2019
184 Ga0207644_10025675 3300025931 Bacteria 4052
185 Ga0207690_10047167 3300025932 Bacteria 2857
186 Ga0207706_10000233 3300025933 Bacteria 60777
187 Ga0207706_10032007 3300025933 Bacteria 4685
188 Ga0207706_10095089 3300025933 Bacteria 2621
189 Ga0207686_10000067 3300025934 Bacteria 94339
190 Ga0207709_10002759 3300025935 Bacteria 10824
191 Ga0207670_10091257 3300025936 Bacteria 2154
192 Ga0207669_10001055 3300025937 Bacteria 11754
193 Ga0207669_10016593 3300025937 Bacteria 3747
194 Ga0207704_10002057 3300025938 Bacteria 9003
195 Ga0207704_10208593 3300025938 Bacteria 1436
196 Ga0207691_10016553 3300025940 Bacteria 7000
197 Ga0207691_10084622 3300025940 Bacteria 2847
198 Ga0207691_10102868 3300025940 Bacteria 2547
199 Ga0207691_10171554 3300025940 Bacteria 1899
200 Ga0207711_10013067 3300025941 Bacteria 6897
201 Ga0207711_10131826 3300025941 Bacteria 2242
202 Ga0207689_10466070 3300025942 Bacteria 1057
203 Ga0207661_10014788 3300025944 Bacteria 5726
204 Ga0207661_10356393 3300025944 Bacteria 1321
205 Ga0207679_10033126 3300025945 Bacteria 3634
206 Ga0207679_10088962 3300025945 Bacteria 2382
207 Ga0207679_10317572 3300025945 Bacteria 1348
208 Ga0207679_10353244 3300025945 Bacteria 1282
209 Ga0207667_10091582 3300025949 Bacteria 3141
210 Ga0207651_10111043 3300025960 Bacteria 2058
211 Ga0207712_10000422 3300025961 Bacteria 36283
212 Ga0207712_10260436 3300025961 Bacteria 1406
213 Ga0207658_10096645 3300025986 Bacteria 2304
214 Ga0207658_10403478 3300025986 Bacteria 1202
215 Ga0207703_10111362 3300026035 Bacteria 2337
216 Ga0207639_11250358 3300026041 Bacteria 697
217 Ga0207678_10089848 3300026067 Bacteria 2625
218 Ga0207678_10225430 3300026067 Bacteria 1604
219 Ga0207708_10384347 3300026075 Bacteria 1158
220 Ga0207702_10203642 3300026078 Bacteria 1836
221 Ga0207641_10055954 3300026088 Bacteria 3351
222 Ga0207641_10325423 3300026088 Bacteria 1459
223 Ga0207648_10000030 3300026089 Bacteria 129654
224 Ga0207648_10349497 3300026089 Bacteria 1333
225 Ga0207676_10005317 3300026095 Bacteria 9121
226 Ga0207676_10102479 3300026095 Bacteria 2376
227 Ga0207676_10443804 3300026095 Bacteria 1222
228 Ga0207674_10018534 3300026116 Bacteria 7562
229 Ga0207674_10693054 3300026116 Bacteria 983
230 Ga0207674_10730243 3300026116 Bacteria 956
231 Ga0207675_100053740 3300026118 Bacteria 3758
232 Ga0207675_100103095 3300026118 Bacteria 2688
233 Ga0207683_10021697 3300026121 Bacteria 5504
234 Ga0207698_10040839 3300026142 Bacteria 3452
235 Ga0209995_1015021 3300027471 Bacteria 1270
236 Ga0209995_1032900 3300027471 Bacteria 870
237 Ga0207428_10215708 3300027907 Bacteria 1440
238 Ga0268266_10110667 3300028379 Bacteria 2433
239 Ga0268266_10285740 3300028379 Bacteria 1535
240 Ga0268265_10053083 3300028380 Bacteria 3069
241 Ga0307408_100032459 3300031548 Bacteria 3641
242 Ga0307408_100103663 3300031548 Bacteria 2172
243 Ga0307408_100136873 3300031548 Bacteria 1917
244 Ga0307408_100258395 3300031548 Bacteria 1440
245 Ga0307408_100668737 3300031548 Bacteria 930
246 Ga0307408_100721876 3300031548 Bacteria 898
247 Ga0307405_10103161 3300031731 Bacteria 1917
248 Ga0307405_10105649 3300031731 Bacteria 1897
249 Ga0307405_10198027 3300031731 Bacteria 1457
250 Ga0307405_10245535 3300031731 Bacteria 1329
251 Ga0307413_10011664 3300031824 Bacteria 4336
252 Ga0307413_10025283 3300031824 Bacteria 3253
253 Ga0307413_10035307 3300031824 Bacteria 2866
254 Ga0307413_10074086 3300031824 Bacteria 2155
255 Ga0307413_10097135 3300031824 Bacteria 1936
256 Ga0307413_10347208 3300031824 Bacteria 1143
257 Ga0307413_10478918 3300031824 Bacteria 994
258 Ga0307410_10003108 3300031852 Bacteria 8236
259 Ga0307410_10011209 3300031852 Bacteria 5117
260 Ga0307410_10045189 3300031852 Bacteria 2931
261 Ga0307410_10080551 3300031852 Bacteria 2284
262 Ga0307410_10083324 3300031852 Bacteria 2251
263 Ga0307410_10152714 3300031852 Bacteria 1721
264 Ga0307410_10210685 3300031852 Bacteria 1489
265 Ga0307410_10230235 3300031852 Bacteria 1430
266 Ga0307410_10454016 3300031852 Bacteria 1046
267 Ga0307410_10482580 3300031852 Bacteria 1017
268 Ga0307406_10022906 3300031901 Bacteria 3710
269 Ga0307406_10070804 3300031901 Bacteria 2284
270 Ga0307406_10121251 3300031901 Bacteria 1818
271 Ga0307406_10543559 3300031901 Bacteria 949
272 Ga0307407_10014401 3300031903 Bacteria 3872
273 Ga0307407_10020214 3300031903 Bacteria 3407
274 Ga0307407_10056478 3300031903 Bacteria 2273
275 Ga0307407_10218023 3300031903 Bacteria 1288
276 Ga0307407_10261605 3300031903 Bacteria 1190
277 Ga0307407_10318297 3300031903 Bacteria 1091
278 Ga0307407_10398676 3300031903 Bacteria 986
279 Ga0307407_10540359 3300031903 Bacteria 860
280 Ga0307412_10034059 3300031911 Bacteria 3243
281 Ga0307412_10664613 3300031911 Bacteria 890
282 Ga0307409_100014652 3300031995 Bacteria 5110
283 Ga0307409_100021685 3300031995 Bacteria 4410
284 Ga0307409_100035026 3300031995 Bacteria 3674
285 Ga0307409_100051731 3300031995 Bacteria 3145
286 Ga0307409_100297692 3300031995 Bacteria 1499
287 Ga0307409_100373855 3300031995 Bacteria 1352
288 Ga0307409_100568727 3300031995 Bacteria 1115
289 Ga0307416_100012452 3300032002 Bacteria 5731
290 Ga0307416_100016692 3300032002 Bacteria 5112
291 Ga0307416_100045778 3300032002 Bacteria 3447
292 Ga0307416_100079436 3300032002 Bacteria 2764
293 Ga0307416_100105943 3300032002 Bacteria 2463
294 Ga0307416_100282366 3300032002 Bacteria 1638
295 Ga0307416_100392675 3300032002 Bacteria 1422
296 Ga0307416_100406860 3300032002 Bacteria 1400
297 Ga0307416_100478016 3300032002 Bacteria 1305
298 Ga0307416_100586049 3300032002 Bacteria 1193
299 Ga0307414_10006041 3300032004 Bacteria 6716
300 Ga0307414_10038723 3300032004 Bacteria 3205
301 Ga0307414_10044951 3300032004 Bacteria 3021
302 Ga0307414_10298651 3300032004 Bacteria 1361
303 Ga0307414_10392818 3300032004 Bacteria 1202
304 Ga0307411_10013204 3300032005 Bacteria 4546
305 Ga0307411_10030365 3300032005 Bacteria 3312
306 Ga0307411_10040123 3300032005 Bacteria 2967
307 Ga0307411_10194618 3300032005 Bacteria 1551
308 Ga0307411_10300559 3300032005 Bacteria 1287
309 Ga0307411_10662076 3300032005 Bacteria 905
310 Ga0307411_10749150 3300032005 Bacteria 855
311 Ga0307415_100046689 3300032126 Bacteria 2910
312 Ga0307415_100060453 3300032126 Bacteria 2618
313 Ga0307415_100123720 3300032126 Bacteria 1945
314 Ga0307415_100455709 3300032126 Bacteria 1107
315 Ga0307415_100600235 3300032126 Bacteria 979
316 Ga0373940_0041972 3300035088 Bacteria 1260
317 Ga0373931_0081795 3300035691 Bacteria 1784
318 Ga0395900_0457749 3300037418 Bacteria 1231
319 Ga0439461_0043916 3300041410 Bacteria 973
320 Ga0439445_0092537 3300042004 Bacteria 852
321 Ga0439450_011571 3300042008 Bacteria 1732
322 Ga0450890_033534 3300042127 Bacteria 738
323 Ga0439446_0085018 3300042156 Bacteria 984
324 Ga0439435_0042355 3300042436 Bacteria 1278
325 Ga0439444_0063866 3300042437 Bacteria 774
326 Ga0451577_0011391 3300042876 Bacteria 8416
327 Ga0451577_0024253 3300042876 Bacteria 5520
328 Ga0451577_0229875 3300042876 Bacteria 1677
329 Ga0453683_0044680 3300044673 Bacteria 2779
330 Ga0453684_0234171 3300044712 Bacteria 2118
331 Ga0451576_0110879 3300045051 Bacteria 2855
332 Ga0451576_0938384 3300045051 Bacteria 907
333 Ga0495603_0184825 3300046455 Bacteria 1206
334 Ga0495580_0119883 3300046472 Bacteria 1827
335 Ga0495580_0369267 3300046472 Bacteria 970
336 Ga0495582_0173164 3300046473 Bacteria 1229
337 Ga0495664_0103511 3300046477 Bacteria 1716
338 Ga0495594_0008345 3300046499 Bacteria 5336
339 Ga0495594_0087166 3300046499 Bacteria 1747
340 Ga0495594_0162844 3300046499 Bacteria 1268
341 Ga0495594_0238510 3300046499 Bacteria 1036
342 Ga0495618_0102069 3300046514 Bacteria 1836
343 Ga0495640_0345263 3300046533 Bacteria 919
344 Ga0495622_0149311 3300046557 Bacteria 1058
345 Ga0495634_0079996 3300046642 Bacteria 2139
346 Ga0495647_0008554 3300046681 Bacteria 3443
347 Ga0495658_0006894 3300046683 Bacteria 5602
348 Ga0495600_0195246 3300046809 Bacteria 1301
349 Ga0495674_0018968 3300047319 Bacteria 6396
350 Ga0495676_0231037 3300047321 Bacteria 1271
351 Ga0495680_0006102 3300047322 Bacteria 11251
352 Ga0495684_0092502 3300047471 Bacteria 2291
353 Ga0495614_0114438 3300048089 Bacteria 1186
354 Ga0496100_0256269 3300048903 Bacteria 1296
355 Ga0496100_0805430 3300048903 Bacteria 736
356 Ga0496101_0086013 3300048904 Bacteria 2331
357 Ga0496101_0104958 3300048904 Bacteria 2120
358 Ga0496102_0000926 3300048905 Bacteria 27614
359 Ga0496102_0112062 3300048905 Bacteria 2544
360 Ga0496102_0141762 3300048905 Bacteria 2254
361 Ga0496102_0480236 3300048905 Bacteria 1164
362 Ga0496103_0274174 3300048906 Bacteria 1085
363 Ga0496104_0013958 3300048907 Bacteria 7247
364 Ga0496104_0024829 3300048907 Bacteria 5518
365 Ga0496104_0089421 3300048907 Bacteria 2942
366 Ga0496104_0149916 3300048907 Bacteria 2239
367 Ga0496105_0019885 3300048908 Bacteria 5419
368 Ga0496105_0125776 3300048908 Bacteria 2113
369 Ga0496105_0165229 3300048908 Bacteria 1816
370 Ga0496106_0056885 3300048909 Bacteria 2957
371 Ga0496106_0150669 3300048909 Bacteria 1834
372 Ga0496106_0297111 3300048909 Bacteria 1295
373 Ga0496107_0190816 3300048910 Bacteria 1522
374 Ga0496107_0205299 3300048910 Bacteria 1465
375 Ga0496108_0001062 3300048911 Bacteria 21438
376 Ga0496108_0004278 3300048911 Bacteria 11495
377 Ga0496108_0010576 3300048911 Bacteria 7491
378 Ga0496109_0034153 3300048912 Bacteria 4578
379 Ga0496109_0066098 3300048912 Bacteria 3310
380 Ga0496109_0088519 3300048912 Bacteria 2861
381 Ga0496109_0091546 3300048912 Bacteria 2813
382 Ga0496110_0002283 3300048913 Bacteria 14320
383 Ga0496110_0004611 3300048913 Bacteria 10705
384 Ga0496110_0326175 3300048913 Bacteria 1398
385 Ga0496111_0003273 3300048914 Bacteria 10002
386 Ga0496111_0008975 3300048914 Bacteria 6651
387 Ga0496111_0063168 3300048914 Bacteria 2685
388 Ga0496112_0000975 3300048915 Bacteria 20872
389 Ga0496112_0014696 3300048915 Bacteria 7277
390 Ga0496112_0038237 3300048915 Bacteria 4686
391 Ga0496112_0148959 3300048915 Bacteria 2308
392 Ga0496113_0020160 3300048916 Bacteria 4681
393 Ga0496113_0037584 3300048916 Bacteria 3554
394 Ga0496114_0043585 3300048917 Bacteria 3721
395 Ga0496114_0103162 3300048917 Bacteria 2438
396 Ga0496114_0515184 3300048917 Bacteria 1058
397 Ga0496115_0316269 3300048918 Bacteria 1278
398 Ga0501031_0123813 3300049568 Bacteria 1689
399 Ga0501034_0019568 3300049571 Bacteria 6922
400 Ga0501034_0081254 3300049571 Bacteria 3243
401 Ga0501036_0058883 3300049572 Bacteria 3255
402 Ga0501037_0209593 3300049573 Bacteria 1375
403 Ga0501038_0050576 3300049574 Bacteria 3590
404 Ga0501039_0183526 3300049575 Bacteria 1645
405 Ga0501040_0004476 3300049576 Bacteria 9078
406 Ga0501041_0134966 3300049577 Bacteria 1538
407 Ga0501041_0217686 3300049577 Bacteria 1198
408 Ga0501042_0105765 3300049578 Bacteria 2025
409 Ga0501042_0142875 3300049578 Bacteria 1726
410 Ga0501042_0338147 3300049578 Bacteria 1088
411 Ga0501046_0160949 3300049580 Bacteria 1688
412 Ga0501047_0196363 3300049581 Bacteria 1880
413 Ga0501048_0026465 3300049582 Bacteria 4224
414 Ga0501067_0000084 3300049583 Bacteria 54706
415 Ga0501067_0012869 3300049583 Bacteria 4633
416 Ga0501067_0017051 3300049583 Bacteria 4013
417 Ga0501067_0030422 3300049583 Bacteria 2994
418 Ga0501067_0099764 3300049583 Bacteria 1613
419 Ga0501067_0178385 3300049583 Bacteria 1183
420 Ga0501068_0001845 3300049584 Bacteria 11241
421 Ga0501068_0006923 3300049584 Bacteria 6272
422 Ga0501068_0046435 3300049584 Bacteria 2619
423 Ga0501068_0106199 3300049584 Bacteria 1743
424 Ga0501069_0000067 3300049585 Bacteria 54874
425 Ga0501069_0012508 3300049585 Bacteria 4514
426 Ga0501069_0044555 3300049585 Bacteria 2456
427 Ga0501069_0056227 3300049585 Bacteria 2192
428 Ga0501070_0000522 3300049586 Bacteria 35229
429 Ga0501070_0025109 3300049586 Bacteria 4996
430 Ga0501070_0095506 3300049586 Bacteria 2459
431 Ga0501070_0119234 3300049586 Bacteria 2181
432 Ga0501070_0625625 3300049586 Bacteria 856
433 Ga0501071_0000194 3300049587 Bacteria 27399
434 Ga0501071_0022263 3300049587 Bacteria 4417
435 Ga0501071_0033283 3300049587 Bacteria 3662
436 Ga0501071_0419024 3300049587 Bacteria 1023
437 Ga0501072_0000039 3300049588 Bacteria 113463
438 Ga0501072_0024879 3300049588 Bacteria 4661
439 Ga0501072_0055793 3300049588 Bacteria 3113
440 Ga0501073_0021030 3300049589 Bacteria 4706
441 Ga0501073_0026147 3300049589 Bacteria 4182
442 Ga0501074_0003108 3300049590 Bacteria 11705
443 Ga0501074_0021909 3300049590 Bacteria 4639
444 Ga0501074_0206303 3300049590 Bacteria 1400
445 Ga0501075_0014631 3300049591 Bacteria 5623
446 Ga0501075_0025543 3300049591 Bacteria 4340
447 Ga0501075_0153797 3300049591 Bacteria 1754
448 Ga0501075_0590190 3300049591 Bacteria 847
449 Ga0501075_0629411 3300049591 Bacteria 818
450 Ga0501076_0007788 3300049592 Bacteria 7808
451 Ga0501076_0079913 3300049592 Bacteria 2624
452 Ga0501076_0147095 3300049592 Bacteria 1916
453 Ga0501077_0000496 3300049593 Bacteria 23850
454 Ga0501077_0025505 3300049593 Bacteria 3754
455 Ga0501217_128861 3300049661 Bacteria 740
456 Ga0501079_0024350 3300049741 Bacteria 4644
457 Ga0501079_0044511 3300049741 Bacteria 3425
458 Ga0501079_0080429 3300049741 Bacteria 2520
459 Ga0501079_0081072 3300049741 Bacteria 2509
460 Ga0501079_0201589 3300049741 Bacteria 1554
461 Ga0501079_0409662 3300049741 Bacteria 1063
462 Ga0501080_0006100 3300049742 Bacteria 10806
463 Ga0501080_0006619 3300049742 Bacteria 10421
464 Ga0501080_0235942 3300049742 Bacteria 1671
465 Ga0501080_0339329 3300049742 Bacteria 1358
466 Ga0501080_0410657 3300049742 Bacteria 1217
467 Ga0501080_0487149 3300049742 Bacteria 1103
468 Ga0501081_0010155 3300049743 Bacteria 6143
469 Ga0501081_0031869 3300049743 Bacteria 3573
470 Ga0501081_0042349 3300049743 Bacteria 3120
471 Ga0501081_0199842 3300049743 Bacteria 1449
472 Ga0501083_0000108 3300049744 Bacteria 55825
473 Ga0501083_0002316 3300049744 Bacteria 13010
474 Ga0501083_0060342 3300049744 Bacteria 2534
475 Ga0501276_012976 3300049773 Bacteria 726
476 Ga0501044_0659436 3300049823 Bacteria 935
477 Ga0501045_0075295 3300049824 Bacteria 2486
478 Ga0501045_0288653 3300049824 Bacteria 1221
479 nmdc:mga05p37_160202_c1 3300050507 Bacteria 2749
480 nmdc:mga05p37_22756_c2 3300050507 Bacteria 7109
481 nmdc:mga05p37_2322_c1 3300050507 Bacteria 22147
482 nmdc:mga09592_177873_c1 3300050508 Bacteria 1840
483 nmdc:mga09592_24308_c1 3300050508 Bacteria 5010
484 nmdc:mga09592_620022_c1 3300050508 Bacteria 925
485 nmdc:mga0qj67_198596_c1 3300050509 Bacteria 1630
486 nmdc:mga0qj67_579151_c1 3300050509 Unclassified 899
487 nmdc:mga06r32_190425_c1 3300050510 Bacteria 2039
488 nmdc:mga06r32_307595_c1 3300050510 Bacteria 1570
489 nmdc:mga06r32_37693_c1 3300050510 Bacteria 4573
490 nmdc:mga06r32_932527_c1 3300050510 Bacteria 823
491 nmdc:mga08y16_104832_c1 3300050511 Bacteria 2943
492 nmdc:mga08y16_182280_c1 3300050511 Bacteria 2180
493 nmdc:mga0n895_176246_c1 3300050512 Bacteria 2169
494 nmdc:mga0n895_33728_c1 3300050512 Bacteria 4920
495 nmdc:mga0n895_44584_c1 3300050512 Bacteria 4325
496 nmdc:mga0n895_508583_c1 3300050512 Bacteria 1213
497 nmdc:mga0n895_756228_c1 3300050512 Bacteria 965
498 nmdc:mga0rr50_542698_c1 3300050513 Bacteria 990
499 nmdc:mga0a205_196448_c1 3300050515 Bacteria 1908
500 nmdc:mga0a205_2075_c1 3300050515 Bacteria 17529
501 Ga0501084_0008593 3300054114 Bacteria 8443
502 Ga0501084_0026943 3300054114 Bacteria 4801
503 Ga0501084_0028727 3300054114 Bacteria 4650
504 Ga0501084_0035199 3300054114 Bacteria 4186
505 Ga0501084_0043972 3300054114 Bacteria 3738
506 Ga0501084_0533675 3300054114 Bacteria 992
507 Ga0590075_012306 3300059424 Bacteria 2077
508 Ga0590077_005113 3300059426 Bacteria 2683
509 Ga0501082_0000449 3300060353 Bacteria 36432
510 Ga0501082_0085474 3300060353 Bacteria 2721
511 Ga0501082_0138251 3300060353 Bacteria 2114
512 Ga0501082_0260796 3300060353 Bacteria 1507
513 Ga0501082_0433835 3300060353 Bacteria 1147
514 Ga0068868_100554616
515 MBSR1b_contig_8415695
516 rootL2_10221127
517 Ga0065715_10162094
518 Ga0070676_10014529
519 Ga0070683_100018532
520 Ga0070690_100165006
521 Ga0070677_10062371
522 Ga0068869_100009604
523 Ga0070666_10049082
524 Ga0070680_100108646
525 Ga0070660_100455874
526 Ga0070692_10162495
527 Ga0070668_100009824
528 Ga0070669_100371115
529 Ga0070675_100108958
530 Ga0070671_100249928
531 Ga0070671_100290361
532 Ga0070674_100000493
533 Ga0070673_100034798
534 Ga0070673_100512564
535 Ga0070688_100235861
536 Ga0070659_100095583
537 Ga0070667_100318141
538 Ga0070667_100637199
539 Ga0070703_10013853
540 Ga0070701_10382581
541 Ga0070705_100003352
542 Ga0070705_100007967
543 Ga0070705_100028375
544 Ga0070705_100120886
545 Ga0070708_100003233
546 Ga0070663_100078324
547 Ga0070678_100013249
548 Ga0070678_100508137
549 Ga0070662_100004447
550 Ga0070662_100236968
551 Ga0070681_10079189
552 Ga0070681_10376439
553 Ga0068867_100014991
554 Ga0070706_100312063
555 Ga0070707_100044084
556 Ga0070707_100084985
557 Ga0070698_100026501
558 Ga0070698_100255213
559 Ga0070698_100454863
560 Ga0070698_100767482
561 Ga0070699_100000224
562 Ga0070699_100011913
563 Ga0070699_100027984
564 Ga0070699_100037295
565 Ga0070699_100070495
566 Ga0070699_100294418
567 Ga0070679_100006938
568 Ga0070679_100047205
569 Ga0070679_100467536
570 Ga0070679_100536271
571 Ga0070697_100008980
572 Ga0070697_100015408
573 Ga0070697_100340140
574 Ga0070697_100657058
575 Ga0070672_100035871
576 Ga0070686_100077620
577 Ga0070695_100012419
578 Ga0070695_100027765
579 Ga0070696_100003507
580 Ga0070696_100016079
581 Ga0070696_100061540
582 Ga0070696_100398680
583 Ga0070693_100004173
584 Ga0070693_100319297
585 Ga0070665_100190967
586 Ga0070665_100308918
587 Ga0070704_100033199
588 Ga0070704_100042390
589 Ga0068855_100096057
590 Ga0070664_100022933
591 Ga0070664_100147230
592 Ga0070664_100790270
593 Ga0068857_100091935
594 Ga0068857_100550309
595 Ga0068856_100291376
596 Ga0070702_100062222
597 Ga0068852_100095185
598 Ga0068859_100083702
599 Ga0068859_100104882
600 Ga0068859_100660119
601 Ga0068859_100853094
602 Ga0068864_100007997
603 Ga0068864_100013441
604 Ga0068864_100464092
605 Ga0068866_10000250
606 Ga0068861_100051535
607 Ga0068870_10326544
608 Ga0068863_100198298
609 Ga0068863_100263854
610 Ga0068863_100352138
611 Ga0068863_101061557
612 Ga0068858_100030710
613 Ga0068860_100444046
614 Ga0068862_100028182
615 Ga0068862_100210739
616 Ga0068862_100210986
617 Ga0081455_10045116
618 Ga0097621_100052031
619 Ga0068871_100068733
620 Ga0068871_101201510
621 Ga0075428_100055047
622 Ga0075428_100120276
623 Ga0075430_100716577
624 Ga0075431_100047240
625 Ga0075431_100198932
626 Ga0075433_10001886
627 Ga0075433_10043418
628 Ga0075433_10131810
629 Ga0075433_10490297
630 Ga0075434_100007582
631 Ga0075434_100037209
632 Ga0075434_100533590
633 Ga0075434_101092523
634 Ga0075429_100002035
635 Ga0075429_100115655
636 Ga0068865_100004159
637 Ga0068865_100622900
638 Ga0097620_100083702
639 Ga0097620_100104883
640 Ga0097620_100268234
641 Ga0097620_100660126
642 Ga0097620_100853052
643 Ga0075435_100603307
644 Ga0111539_10154170
645 Ga0111539_10208929
646 Ga0114129_10000112
647 Ga0114129_10027916
648 Ga0114129_10165974
649 Ga0114129_10996571
650 Ga0105243_10030999
651 Ga0105241_10003808
652 Ga0105242_10008832
653 Ga0105248_10027157
654 Ga0105237_10499142
655 Ga0105237_10613012
656 Ga0105249_10036740
657 Ga0105239_10026441
658 Ga0105239_10064844
659 Ga0157373_10366727
660 Ga0157378_10000782
661 Ga0163162_10296225
662 Ga0157372_10207518
663 Ga0157375_10107938
664 Ga0157375_10721330
665 Ga0157375_10816455
666 Ga0157375_11139201
667 Ga0163163_11243019
668 Ga0157380_10167009
669 Ga0157380_10463830
670 Ga0157379_10016065
671 Ga0157376_10215897
672 Ga0207697_10168879
673 Ga0207653_10016179
674 Ga0207642_10001414
675 Ga0207680_10009239
676 Ga0207647_10071537
677 Ga0207645_10004417
678 Ga0207645_10260545
679 Ga0207643_10037232
680 Ga0207684_10060071
681 Ga0207684_10069987
682 Ga0207654_10013666
683 Ga0207707_10004621
684 Ga0207671_10474150
685 Ga0207660_10002149
686 Ga0207660_10107215
687 Ga0207657_10194063
688 Ga0207652_10015448
689 Ga0207652_10115181
690 Ga0207652_10647860
691 Ga0207646_10050091
692 Ga0207646_10153712
693 Ga0207681_10019650
694 Ga0207681_10134604
695 Ga0207659_10074002
696 Ga0207659_10119307
697 Ga0207644_10025675
698 Ga0207690_10047167
699 Ga0207706_10000233
700 Ga0207706_10032007
701 Ga0207706_10095089
702 Ga0207686_10000067
703 Ga0207709_10002759
704 Ga0207670_10091257
705 Ga0207669_10001055
706 Ga0207669_10016593
707 Ga0207704_10002057
708 Ga0207704_10208593
709 Ga0207691_10016553
710 Ga0207691_10084622
711 Ga0207691_10102868
712 Ga0207691_10171554
713 Ga0207711_10013067
714 Ga0207711_10131826
715 Ga0207689_10466070
716 Ga0207661_10014788
717 Ga0207661_10356393
718 Ga0207679_10033126
719 Ga0207679_10088962
720 Ga0207679_10317572
721 Ga0207679_10353244
722 Ga0207667_10091582
723 Ga0207651_10111043
724 Ga0207712_10000422
725 Ga0207712_10260436
726 Ga0207658_10096645
727 Ga0207658_10403478
728 Ga0207703_10111362
729 Ga0207639_11250358
730 Ga0207678_10089848
731 Ga0207678_10225430
732 Ga0207708_10384347
733 Ga0207702_10203642
734 Ga0207641_10055954
735 Ga0207641_10325423
736 Ga0207648_10000030
737 Ga0207648_10349497
738 Ga0207676_10005317
739 Ga0207676_10102479
740 Ga0207676_10443804
741 Ga0207674_10018534
742 Ga0207674_10693054
743 Ga0207674_10730243
744 Ga0207675_100053740
745 Ga0207675_100103095
746 Ga0207683_10021697
747 Ga0207698_10040839
748 Ga0209995_1015021
749 Ga0209995_1032900
750 Ga0207428_10215708
751 Ga0268266_10110667
752 Ga0268266_10285740
753 Ga0268265_10053083
754 Ga0307408_100032459
755 Ga0307408_100103663
756 Ga0307408_100136873
757 Ga0307408_100258395
758 Ga0307408_100668737
759 Ga0307408_100721876
760 Ga0307405_10103161
761 Ga0307405_10105649
762 Ga0307405_10198027
763 Ga0307405_10245535
764 Ga0307413_10011664
765 Ga0307413_10025283
766 Ga0307413_10035307
767 Ga0307413_10074086
768 Ga0307413_10097135
769 Ga0307413_10347208
770 Ga0307413_10478918
771 Ga0307410_10003108
772 Ga0307410_10011209
773 Ga0307410_10045189
774 Ga0307410_10080551
775 Ga0307410_10083324
776 Ga0307410_10152714
777 Ga0307410_10210685
778 Ga0307410_10230235
779 Ga0307410_10454016
780 Ga0307410_10482580
781 Ga0307406_10022906
782 Ga0307406_10070804
783 Ga0307406_10121251
784 Ga0307406_10543559
785 Ga0307407_10014401
786 Ga0307407_10020214
787 Ga0307407_10056478
788 Ga0307407_10218023
789 Ga0307407_10261605
790 Ga0307407_10318297
791 Ga0307407_10398676
792 Ga0307407_10540359
793 Ga0307412_10034059
794 Ga0307412_10664613
795 Ga0307409_100014652
796 Ga0307409_100021685
797 Ga0307409_100035026
798 Ga0307409_100051731
799 Ga0307409_100297692
800 Ga0307409_100373855
801 Ga0307409_100568727
802 Ga0307416_100012452
803 Ga0307416_100016692
804 Ga0307416_100045778
805 Ga0307416_100079436
806 Ga0307416_100105943
807 Ga0307416_100282366
808 Ga0307416_100392675
809 Ga0307416_100406860
810 Ga0307416_100478016
811 Ga0307416_100586049
812 Ga0307414_10006041
813 Ga0307414_10038723
814 Ga0307414_10044951
815 Ga0307414_10298651
816 Ga0307414_10392818
817 Ga0307411_10013204
818 Ga0307411_10030365
819 Ga0307411_10040123
820 Ga0307411_10194618
821 Ga0307411_10300559
822 Ga0307411_10662076
823 Ga0307411_10749150
824 Ga0307415_100046689
825 Ga0307415_100060453
826 Ga0307415_100123720
827 Ga0307415_100455709
828 Ga0307415_100600235
829 Ga0373940_0041972
830 Ga0373931_0081795
831 Ga0395900_0457749
832 Ga0439461_0043916
833 Ga0439445_0092537
834 Ga0439450_011571
835 Ga0450890_033534
836 Ga0439446_0085018
837 Ga0439435_0042355
838 Ga0439444_0063866
839 Ga0451577_0011391
840 Ga0451577_0024253
841 Ga0451577_0229875
842 Ga0453683_0044680
843 Ga0453684_0234171
844 Ga0451576_0110879
845 Ga0451576_0938384
846 Ga0495603_0184825
847 Ga0495580_0119883
848 Ga0495580_0369267
849 Ga0495582_0173164
850 Ga0495664_0103511
851 Ga0495594_0008345
852 Ga0495594_0087166
853 Ga0495594_0162844
854 Ga0495594_0238510
855 Ga0495618_0102069
856 Ga0495640_0345263
857 Ga0495622_0149311
858 Ga0495634_0079996
859 Ga0495647_0008554
860 Ga0495658_0006894
861 Ga0495600_0195246
862 Ga0495674_0018968
863 Ga0495676_0231037
864 Ga0495680_0006102
865 Ga0495684_0092502
866 Ga0495614_0114438
867 Ga0496100_0256269
868 Ga0496100_0805430
869 Ga0496101_0086013
870 Ga0496101_0104958
871 Ga0496102_0000926
872 Ga0496102_0112062
873 Ga0496102_0141762
874 Ga0496102_0480236
875 Ga0496103_0274174
876 Ga0496104_0013958
877 Ga0496104_0024829
878 Ga0496104_0089421
879 Ga0496104_0149916
880 Ga0496105_0019885
881 Ga0496105_0125776
882 Ga0496105_0165229
883 Ga0496106_0056885
884 Ga0496106_0150669
885 Ga0496106_0297111
886 Ga0496107_0190816
887 Ga0496107_0205299
888 Ga0496108_0001062
889 Ga0496108_0004278
890 Ga0496108_0010576
891 Ga0496109_0034153
892 Ga0496109_0066098
893 Ga0496109_0088519
894 Ga0496109_0091546
895 Ga0496110_0002283
896 Ga0496110_0004611
897 Ga0496110_0326175
898 Ga0496111_0003273
899 Ga0496111_0008975
900 Ga0496111_0063168
901 Ga0496112_0000975
902 Ga0496112_0014696
903 Ga0496112_0038237
904 Ga0496112_0148959
905 Ga0496113_0020160
906 Ga0496113_0037584
907 Ga0496114_0043585
908 Ga0496114_0103162
909 Ga0496114_0515184
910 Ga0496115_0316269
911 Ga0501031_0123813
912 Ga0501034_0019568
913 Ga0501034_0081254
914 Ga0501036_0058883
915 Ga0501037_0209593
916 Ga0501038_0050576
917 Ga0501039_0183526
918 Ga0501040_0004476
919 Ga0501041_0134966
920 Ga0501041_0217686
921 Ga0501042_0105765
922 Ga0501042_0142875
923 Ga0501042_0338147
924 Ga0501046_0160949
925 Ga0501047_0196363
926 Ga0501048_0026465
927 Ga0501067_0000084
928 Ga0501067_0012869
929 Ga0501067_0017051
930 Ga0501067_0030422
931 Ga0501067_0099764
932 Ga0501067_0178385
933 Ga0501068_0001845
934 Ga0501068_0006923
935 Ga0501068_0046435
936 Ga0501068_0106199
937 Ga0501069_0000067
938 Ga0501069_0012508
939 Ga0501069_0044555
940 Ga0501069_0056227
941 Ga0501070_0000522
942 Ga0501070_0025109
943 Ga0501070_0095506
944 Ga0501070_0119234
945 Ga0501070_0625625
946 Ga0501071_0000194
947 Ga0501071_0022263
948 Ga0501071_0033283
949 Ga0501071_0419024
950 Ga0501072_0000039
951 Ga0501072_0024879
952 Ga0501072_0055793
953 Ga0501073_0021030
954 Ga0501073_0026147
955 Ga0501074_0003108
956 Ga0501074_0021909
957 Ga0501074_0206303
958 Ga0501075_0014631
959 Ga0501075_0025543
960 Ga0501075_0153797
961 Ga0501075_0590190
962 Ga0501075_0629411
963 Ga0501076_0007788
964 Ga0501076_0079913
965 Ga0501076_0147095
966 Ga0501077_0000496
967 Ga0501077_0025505
968 Ga0501217_128861
969 Ga0501079_0024350
970 Ga0501079_0044511
971 Ga0501079_0080429
972 Ga0501079_0081072
973 Ga0501079_0201589
974 Ga0501079_0409662
975 Ga0501080_0006100
976 Ga0501080_0006619
977 Ga0501080_0235942
978 Ga0501080_0339329
979 Ga0501080_0410657
980 Ga0501080_0487149
981 Ga0501081_0010155
982 Ga0501081_0031869
983 Ga0501081_0042349
984 Ga0501081_0199842
985 Ga0501083_0000108
986 Ga0501083_0002316
987 Ga0501083_0060342
988 Ga0501276_012976
989 Ga0501044_0659436
990 Ga0501045_0075295
991 Ga0501045_0288653
992 nmdc:mga05p37_160202_c1
993 nmdc:mga05p37_22756_c2
994 nmdc:mga05p37_2322_c1
995 nmdc:mga09592_177873_c1
996 nmdc:mga09592_24308_c1
997 nmdc:mga09592_620022_c1
998 nmdc:mga0qj67_198596_c1
999 nmdc:mga0qj67_579151_c1
1000 nmdc:mga06r32_190425_c1
1001 nmdc:mga06r32_307595_c1
1002 nmdc:mga06r32_37693_c1
1003 nmdc:mga06r32_932527_c1
1004 nmdc:mga08y16_104832_c1
1005 nmdc:mga08y16_182280_c1
1006 nmdc:mga0n895_176246_c1
1007 nmdc:mga0n895_33728_c1
1008 nmdc:mga0n895_44584_c1
1009 nmdc:mga0n895_508583_c1
1010 nmdc:mga0n895_756228_c1
1011 nmdc:mga0rr50_542698_c1
1012 nmdc:mga0a205_196448_c1
1013 nmdc:mga0a205_2075_c1
1014 Ga0501084_0008593
1015 Ga0501084_0026943
1016 Ga0501084_0028727
1017 Ga0501084_0035199
1018 Ga0501084_0043972
1019 Ga0501084_0533675
1020 Ga0590075_012306
1021 Ga0590077_005113
1022 Ga0501082_0000449
1023 Ga0501082_0085474
1024 Ga0501082_0138251
1025 Ga0501082_0260796
1026 Ga0501082_0433835

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00329

Complex1_30kDa

Respiratory-chain NADH dehydrogenase, 30 Kd subunit

53

178

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mcr-assembly1.cif.gz_A crystal structure of nadh dehydrogenase subunit c (tfu_2693) from thermobifida fusca yx-er1 at 2.65 a resolution 0.9238 15 131
7zmg-assembly1.cif.gz_G cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) 0.8537 9 154
8esw-assembly1.cif.gz_S3 structure of mitochondrial complex i from drosophila melanogaster, flexible-class 1 0.8502 9 154
6rfq-assembly1.cif.gz_G cryo-em structure of a respiratory complex i assembly intermediate with ndufaf2 0.8492 9 154
7v2f-assembly1.cif.gz_P deactive state complex i from q10-nadh dataset 0.8444 9 154
ID Description Score Start End Superfamily
af_A0A1D8PJ73_47_194_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9222 9 133 3.30.460.80
af_P22237_2_142_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9197 9 133 3.30.460.80
af_Q9VZU4_36_188_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.919 9 133 3.30.460.80
af_A0A2P2CLF6_6_131_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.893 10 133 3.30.460.80
af_P9WJH3_48_196_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.8874 8 133 3.30.460.80
ID Description Score Start End GO Terms
AF-A0A2N1W1R4-F1-model_v4 NADH:ubiquinone oxidoreductase 30kDa subunit domain-containing protein 0.9787 5 120 GO:0008137
AF-A0A257RUT5-F1-model_v4 NADH:ubiquinone oxidoreductase 30kDa subunit domain-containing protein 0.9724 4 130 GO:0008137
AF-A0A1G3BQI8-F1-model_v4 NADH dehydrogenase 0.9614 8 114 GO:0008137
AF-A0A2V9Z0Z0-F1-model_v4 NADH-quinone oxidoreductase subunit C 0.9528 8 119 GO:0008137
AF-A0A1F8R7N8-F1-model_v4 NADH:ubiquinone oxidoreductase 30kDa subunit domain-containing protein 0.9525 8 127 GO:0008137

Map