F457520

General Info

Members Datasets Scaffolds Average Seq Length
513 264 1026 84

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100604307|Ga0070683_1006043072
Length 95
Sequence MARTFVWHPTRGPKKTDKLAPAGNGQLEITQVRSAIGHAQTMRDTLAALGLRHPNDTVVLNDSPALRGQIKKVRHLIKVAPAAADTSANASGARQ

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
172 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
241 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
242 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
243 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
244 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
245 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
249 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
260 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 0.39
Rhizosphere 99.03
Stem 0
Stem Tuber 0
Unclassified 7.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100604307 3300005329 Bacteria 1050
2 JGI25406J46586_10045825 3300003203 Bacteria 1502
3 JGI26128J50194_1011942 3300003347 Unclassified 545
4 Ga0058861_11896993 3300004800 Unclassified 891
5 Ga0058862_12668736 3300004803 Bacteria 805
6 Ga0065704_10810338 3300005289 Bacteria 514
7 Ga0065712_10346147 3300005290 Bacteria 769
8 Ga0070658_10039826 3300005327 Bacteria 3791
9 Ga0070658_10154171 3300005327 Bacteria 1925
10 Ga0070658_10663491 3300005327 Bacteria 905
11 Ga0070676_10350486 3300005328 Bacteria 1015
12 Ga0070676_10629095 3300005328 Bacteria 777
13 Ga0070683_100017261 3300005329 Bacteria 6377
14 Ga0070683_100145954 3300005329 Bacteria 2242
15 Ga0070690_100023994 3300005330 Bacteria 3748
16 Ga0070670_100025380 3300005331 Bacteria 5099
17 Ga0070670_100953833 3300005331 Bacteria 779
18 Ga0070677_10098318 3300005333 Bacteria 1286
19 Ga0068869_101148962 3300005334 Unclassified 681
20 Ga0070666_10179880 3300005335 Bacteria 1483
21 Ga0070666_11284787 3300005335 Bacteria 546
22 Ga0070680_100222634 3300005336 Bacteria 1593
23 Ga0070680_100711976 3300005336 Unclassified 864
24 Ga0070682_100944085 3300005337 Bacteria 712
25 Ga0068868_101686894 3300005338 Bacteria 597
26 Ga0070660_100051318 3300005339 Bacteria 3176
27 Ga0070660_100480026 3300005339 Bacteria 1033
28 Ga0070660_100643804 3300005339 Bacteria 887
29 Ga0070660_100681442 3300005339 Bacteria 861
30 Ga0070689_100156362 3300005340 Bacteria 1841
31 Ga0070689_101151872 3300005340 Unclassified 695
32 Ga0070689_101269109 3300005340 Bacteria 663
33 Ga0070691_10022394 3300005341 Bacteria 2931
34 Ga0070691_11025538 3300005341 Unclassified 516
35 Ga0070687_100522224 3300005343 Bacteria 803
36 Ga0070687_100621498 3300005343 Bacteria 745
37 Ga0070687_100688067 3300005343 Bacteria 713
38 Ga0070661_100001922 3300005344 Bacteria 14385
39 Ga0070661_100094505 3300005344 Bacteria 2216
40 Ga0070661_101440968 3300005344 Bacteria 580
41 Ga0070669_100061985 3300005353 Bacteria 2749
42 Ga0070669_100206120 3300005353 Bacteria 1549
43 Ga0070675_100005173 3300005354 Bacteria 9948
44 Ga0070671_100076594 3300005355 Bacteria 2794
45 Ga0070674_100151631 3300005356 Bacteria 1750
46 Ga0070673_100022620 3300005364 Bacteria 4579
47 Ga0070673_100231058 3300005364 Bacteria 1604
48 Ga0070688_100414334 3300005365 Bacteria 1000
49 Ga0070688_100992063 3300005365 Unclassified 667
50 Ga0070659_100505146 3300005366 Bacteria 1031
51 Ga0070659_101113882 3300005366 Unclassified 696
52 Ga0070667_100038074 3300005367 Bacteria 4032
53 Ga0070667_100456436 3300005367 Bacteria 1168
54 Ga0070709_10015248 3300005434 Bacteria 4368
55 Ga0070709_10019843 3300005434 Bacteria 3893
56 Ga0070709_10218522 3300005434 Bacteria 1358
57 Ga0070709_10434432 3300005434 Bacteria 986
58 Ga0070714_100027317 3300005435 Bacteria 4725
59 Ga0070714_100099236 3300005435 Bacteria 2562
60 Ga0070714_100247299 3300005435 Bacteria 1648
61 Ga0070713_100000157 3300005436 Bacteria 46028
62 Ga0070713_100108093 3300005436 Bacteria 2421
63 Ga0070710_10090189 3300005437 Bacteria 1807
64 Ga0070711_100563044 3300005439 Bacteria 947
65 Ga0070700_100053841 3300005441 Bacteria 2513
66 Ga0070662_100692477 3300005457 Bacteria 862
67 Ga0070662_101597170 3300005457 Bacteria 563
68 Ga0070681_10157362 3300005458 Bacteria 2196
69 Ga0068867_100435618 3300005459 Unclassified 1114
70 Ga0070706_100580628 3300005467 Bacteria 1042
71 Ga0070707_100022852 3300005468 Bacteria 5913
72 Ga0070707_100914980 3300005468 Bacteria 842
73 Ga0070698_100005143 3300005471 Bacteria 14306
74 Ga0070698_100142113 3300005471 Bacteria 2351
75 Ga0070698_100323481 3300005471 Bacteria 1473
76 Ga0070698_100337455 3300005471 Bacteria 1439
77 Ga0070699_100024725 3300005518 Bacteria 5179
78 Ga0070699_100071844 3300005518 Bacteria 3010
79 Ga0070699_100210662 3300005518 Bacteria 1730
80 Ga0070699_100890962 3300005518 Bacteria 815
81 Ga0070679_100302387 3300005530 Bacteria 1550
82 Ga0070679_101744996 3300005530 Unclassified 571
83 Ga0070679_102046230 3300005530 Bacteria 522
84 Ga0070684_100172125 3300005535 Bacteria 1967
85 Ga0070684_100638899 3300005535 Bacteria 990
86 Ga0070684_101007492 3300005535 Bacteria 782
87 Ga0070684_101961548 3300005535 Bacteria 552
88 Ga0070697_100469164 3300005536 Bacteria 1098
89 Ga0068853_100702427 3300005539 Bacteria 965
90 Ga0068853_100730305 3300005539 Bacteria 946
91 Ga0070672_100049540 3300005543 Bacteria 3268
92 Ga0070672_100143001 3300005543 Bacteria 1975
93 Ga0070696_100000402 3300005546 Bacteria 26803
94 Ga0070696_100004370 3300005546 Bacteria 9415
95 Ga0070693_100187432 3300005547 Bacteria 1336
96 Ga0070665_100818094 3300005548 Unclassified 944
97 Ga0070665_100846258 3300005548 Unclassified 928
98 Ga0070704_101218964 3300005549 Bacteria 687
99 Ga0068855_100063511 3300005563 Bacteria 4309
100 Ga0068855_100468956 3300005563 Bacteria 1372
101 Ga0068855_100486975 3300005563 Bacteria 1342
102 Ga0068855_102260376 3300005563 Bacteria 545
103 Ga0070664_100051312 3300005564 Bacteria 3492
104 Ga0070664_100120853 3300005564 Bacteria 2293
105 Ga0070664_100170990 3300005564 Bacteria 1928
106 Ga0070664_100236259 3300005564 Bacteria 1639
107 Ga0070664_100627606 3300005564 Unclassified 998
108 Ga0068854_100021737 3300005578 Bacteria 4358
109 Ga0068854_100368765 3300005578 Bacteria 1180
110 Ga0068854_100666813 3300005578 Unclassified 894
111 Ga0068856_100482267 3300005614 Bacteria 1261
112 Ga0068856_101598037 3300005614 Bacteria 665
113 Ga0068852_100238666 3300005616 Bacteria 1736
114 Ga0068852_101253868 3300005616 Bacteria 763
115 Ga0068859_100998691 3300005617 Bacteria 919
116 Ga0068864_100385617 3300005618 Bacteria 1329
117 Ga0068864_100636041 3300005618 Bacteria 1038
118 Ga0068861_100790087 3300005719 Bacteria 890
119 Ga0068870_10152943 3300005840 Bacteria 1361
120 Ga0068863_100312421 3300005841 Bacteria 1526
121 Ga0068863_100726882 3300005841 Bacteria 988
122 Ga0068858_101019881 3300005842 Bacteria 811
123 Ga0081539_10006262 3300005985 Bacteria 11517
124 Ga0081539_10354020 3300005985 Bacteria 616
125 Ga0070717_10019695 3300006028 Bacteria 5297
126 Ga0070717_10424509 3300006028 Bacteria 1196
127 Ga0070717_10465863 3300006028 Bacteria 1140
128 Ga0070716_100749241 3300006173 Bacteria 751
129 Ga0070712_100291312 3300006175 Bacteria 1318
130 Ga0068871_100861425 3300006358 Bacteria 838
131 Ga0075428_100226732 3300006844 Bacteria 2017
132 Ga0075428_100483243 3300006844 Bacteria 1326
133 Ga0075430_100366585 3300006846 Bacteria 1189
134 Ga0075429_100221902 3300006880 Bacteria 1656
135 Ga0075429_100384393 3300006880 Bacteria 1229
136 Ga0068865_102098436 3300006881 Bacteria 514
137 Ga0097620_100998632 3300006931 Bacteria 919
138 Ga0105240_10251280 3300009093 Bacteria 2045
139 Ga0105240_10258655 3300009093 Bacteria 2009
140 Ga0105240_10316647 3300009093 Bacteria 1780
141 Ga0111539_12806745 3300009094 Bacteria 564
142 Ga0114129_10029107 3300009147 Bacteria 7824
143 Ga0114129_13022736 3300009147 Bacteria 552
144 Ga0105243_10797351 3300009148 Bacteria 930
145 Ga0105241_10048649 3300009174 Bacteria 3227
146 Ga0105242_12366356 3300009176 Bacteria 578
147 Ga0105248_10051202 3300009177 Bacteria 4634
148 Ga0105239_10423222 3300010375 Bacteria 1509
149 Ga0105239_10773135 3300010375 Bacteria 1100
150 Ga0105246_12323883 3300011119 Unclassified 524
151 Ga0157373_10001735 3300013100 Bacteria 16567
152 Ga0157373_10528766 3300013100 Bacteria 854
153 Ga0157373_10919228 3300013100 Unclassified 650
154 Ga0157371_10096469 3300013102 Bacteria 2095
155 Ga0157370_10482941 3300013104 Bacteria 1138
156 Ga0157370_10738000 3300013104 Bacteria 898
157 Ga0157369_10304357 3300013105 Bacteria 1658
158 Ga0157369_10540825 3300013105 Bacteria 1204
159 Ga0157369_10642953 3300013105 Bacteria 1094
160 Ga0157374_12331149 3300013296 Bacteria 563
161 Ga0157378_10128545 3300013297 Bacteria 2342
162 Ga0163162_10424502 3300013306 Bacteria 1462
163 Ga0163162_11338377 3300013306 Bacteria 814
164 Ga0157372_10041811 3300013307 Bacteria 5068
165 Ga0157372_10111344 3300013307 Bacteria 3136
166 Ga0157372_10294901 3300013307 Bacteria 1886
167 Ga0157372_10592359 3300013307 Bacteria 1292
168 Ga0157375_10011929 3300013308 Bacteria 7689
169 Ga0157375_10180492 3300013308 Bacteria 2262
170 Ga0163163_10367712 3300014325 Bacteria 1495
171 Ga0157377_10274963 3300014745 Bacteria 1101
172 Ga0157376_10427190 3300014969 Bacteria 1287
173 Ga0182007_10118918 3300015262 Unclassified 883
174 Ga0197907_10465454 3300020069 Bacteria 1016
175 Ga0206353_10483970 3300020082 Bacteria 1062
176 Ga0207682_10141825 3300025893 Bacteria 1079
177 Ga0207692_10335688 3300025898 Bacteria 928
178 Ga0207692_10437816 3300025898 Bacteria 821
179 Ga0207688_10592320 3300025901 Bacteria 698
180 Ga0207680_10241787 3300025903 Bacteria 1244
181 Ga0207699_10032477 3300025906 Bacteria 2941
182 Ga0207699_10110704 3300025906 Bacteria 1759
183 Ga0207699_10286740 3300025906 Bacteria 1146
184 Ga0207645_10039339 3300025907 Bacteria 3030
185 Ga0207645_10260686 3300025907 Bacteria 1148
186 Ga0207645_10516045 3300025907 Bacteria 810
187 Ga0207645_10709525 3300025907 Bacteria 684
188 Ga0207643_10269830 3300025908 Bacteria 1053
189 Ga0207705_10054467 3300025909 Bacteria 2883
190 Ga0207705_10731327 3300025909 Bacteria 769
191 Ga0207705_10875529 3300025909 Bacteria 696
192 Ga0207705_10900885 3300025909 Bacteria 685
193 Ga0207684_10239888 3300025910 Bacteria 1564
194 Ga0207654_10046590 3300025911 Bacteria 2473
195 Ga0207707_10000784 3300025912 Bacteria 31134
196 Ga0207707_10175482 3300025912 Bacteria 1872
197 Ga0207695_10002690 3300025913 Bacteria 25925
198 Ga0207695_10286021 3300025913 Bacteria 1542
199 Ga0207695_10704753 3300025913 Unclassified 890
200 Ga0207693_10377964 3300025915 Bacteria 1108
201 Ga0207660_10001291 3300025917 Bacteria 16748
202 Ga0207660_10528292 3300025917 Unclassified 959
203 Ga0207660_10575157 3300025917 Unclassified 917
204 Ga0207660_10854315 3300025917 Bacteria 743
205 Ga0207662_10130819 3300025918 Bacteria 1582
206 Ga0207662_10152622 3300025918 Bacteria 1470
207 Ga0207657_10101285 3300025919 Bacteria 2391
208 Ga0207657_10118466 3300025919 Bacteria 2179
209 Ga0207649_10002377 3300025920 Bacteria 10552
210 Ga0207649_10104427 3300025920 Bacteria 1881
211 Ga0207652_10002905 3300025921 Bacteria 14334
212 Ga0207652_10162168 3300025921 Bacteria 2004
213 Ga0207652_10178922 3300025921 Bacteria 1905
214 Ga0207646_10020496 3300025922 Bacteria 6125
215 Ga0207646_10141797 3300025922 Bacteria 2165
216 Ga0207681_10010839 3300025923 Bacteria 5600
217 Ga0207681_10532960 3300025923 Bacteria 965
218 Ga0207650_10073165 3300025925 Bacteria 2581
219 Ga0207650_10907539 3300025925 Bacteria 748
220 Ga0207659_10008049 3300025926 Bacteria 6526
221 Ga0207700_10001123 3300025928 Bacteria 15356
222 Ga0207700_10132533 3300025928 Bacteria 2037
223 Ga0207664_10021082 3300025929 Bacteria 4838
224 Ga0207664_10225426 3300025929 Bacteria 1627
225 Ga0207664_10527335 3300025929 Bacteria 1059
226 Ga0207664_10911402 3300025929 Bacteria 789
227 Ga0207644_10163678 3300025931 Bacteria 1731
228 Ga0207644_10245225 3300025931 Bacteria 1428
229 Ga0207644_10320270 3300025931 Bacteria 1254
230 Ga0207690_10037619 3300025932 Bacteria 3143
231 Ga0207690_10247552 3300025932 Bacteria 1375
232 Ga0207706_10066708 3300025933 Bacteria 3167
233 Ga0207706_10199214 3300025933 Bacteria 1756
234 Ga0207706_10577684 3300025933 Bacteria 966
235 Ga0207670_10264827 3300025936 Bacteria 1334
236 Ga0207670_10453827 3300025936 Bacteria 1034
237 Ga0207669_10109666 3300025937 Bacteria 1846
238 Ga0207704_10562076 3300025938 Bacteria 929
239 Ga0207704_11783379 3300025938 Bacteria 529
240 Ga0207665_10674226 3300025939 Bacteria 812
241 Ga0207691_10003543 3300025940 Bacteria 15184
242 Ga0207691_10636220 3300025940 Bacteria 902
243 Ga0207689_10396514 3300025942 Bacteria 1150
244 Ga0207661_10017202 3300025944 Bacteria 5346
245 Ga0207661_10156644 3300025944 Bacteria 1973
246 Ga0207661_10314595 3300025944 Bacteria 1406
247 Ga0207661_11266680 3300025944 Bacteria 678
248 Ga0207679_10099752 3300025945 Bacteria 2268
249 Ga0207679_10495318 3300025945 Bacteria 1090
250 Ga0207679_10840923 3300025945 Bacteria 838
251 Ga0207667_10057146 3300025949 Bacteria 4096
252 Ga0207667_10608372 3300025949 Bacteria 1101
253 Ga0207651_10053787 3300025960 Bacteria 2754
254 Ga0207651_10480839 3300025960 Bacteria 1070
255 Ga0207668_10331852 3300025972 Bacteria 1266
256 Ga0207640_10000324 3300025981 Bacteria 31977
257 Ga0207640_10001124 3300025981 Bacteria 14743
258 Ga0207640_10685113 3300025981 Unclassified 877
259 Ga0207658_10404450 3300025986 Bacteria 1201
260 Ga0207658_10618225 3300025986 Bacteria 974
261 Ga0207677_11390366 3300026023 Bacteria 646
262 Ga0207677_11779375 3300026023 Bacteria 572
263 Ga0207639_10110641 3300026041 Bacteria 2238
264 Ga0207639_10164582 3300026041 Bacteria 1872
265 Ga0207678_10100206 3300026067 Bacteria 2475
266 Ga0207678_10205047 3300026067 Bacteria 1686
267 Ga0207678_10728142 3300026067 Bacteria 874
268 Ga0207708_10194377 3300026075 Bacteria 1616
269 Ga0207702_10432017 3300026078 Bacteria 1275
270 Ga0207702_10760342 3300026078 Bacteria 957
271 Ga0207641_11361081 3300026088 Bacteria 711
272 Ga0207648_10944036 3300026089 Bacteria 807
273 Ga0207648_12132697 3300026089 Unclassified 521
274 Ga0207676_10427052 3300026095 Bacteria 1244
275 Ga0207675_100363779 3300026118 Bacteria 1420
276 Ga0207675_102093442 3300026118 Bacteria 582
277 Ga0207675_102472257 3300026118 Unclassified 531
278 Ga0207683_10340408 3300026121 Bacteria 1376
279 Ga0207698_10066516 3300026142 Bacteria 2837
280 Ga0207698_10345115 3300026142 Bacteria 1404
281 Ga0207698_10577915 3300026142 Bacteria 1105
282 Ga0207698_12453010 3300026142 Bacteria 532
283 Ga0268264_10087060 3300028381 Bacteria 2685
284 Ga0316182_1239585 3300030745 Bacteria 530
285 Ga0307408_100010979 3300031548 Bacteria 5976
286 Ga0307408_100089965 3300031548 Bacteria 2315
287 Ga0307408_100097713 3300031548 Bacteria 2231
288 Ga0307408_100127633 3300031548 Bacteria 1980
289 Ga0307408_100186978 3300031548 Bacteria 1666
290 Ga0307408_100619991 3300031548 Bacteria 963
291 Ga0307408_101602037 3300031548 Bacteria 618
292 Ga0307405_10003061 3300031731 Bacteria 7578
293 Ga0307405_10059292 3300031731 Bacteria 2411
294 Ga0307405_10113026 3300031731 Bacteria 1843
295 Ga0307405_10411570 3300031731 Bacteria 1061
296 Ga0307405_10469715 3300031731 Bacteria 1002
297 Ga0307405_10743395 3300031731 Unclassified 816
298 Ga0307413_10009739 3300031824 Bacteria 4615
299 Ga0307413_10011536 3300031824 Bacteria 4354
300 Ga0307413_10060530 3300031824 Bacteria 2331
301 Ga0307413_10100171 3300031824 Bacteria 1912
302 Ga0307413_10528610 3300031824 Bacteria 952
303 Ga0307413_10565857 3300031824 Bacteria 924
304 Ga0307413_10809529 3300031824 Bacteria 788
305 Ga0307410_10013257 3300031852 Bacteria 4801
306 Ga0307410_10022620 3300031852 Bacteria 3889
307 Ga0307410_10048579 3300031852 Bacteria 2843
308 Ga0307410_10147105 3300031852 Bacteria 1749
309 Ga0307410_10269431 3300031852 Unclassified 1331
310 Ga0307410_10513648 3300031852 Bacteria 987
311 Ga0307410_10552823 3300031852 Bacteria 954
312 Ga0307406_10007186 3300031901 Bacteria 6170
313 Ga0307406_10016304 3300031901 Bacteria 4316
314 Ga0307406_10016804 3300031901 Bacteria 4257
315 Ga0307406_10033753 3300031901 Bacteria 3134
316 Ga0307406_10062453 3300031901 Bacteria 2410
317 Ga0307406_10207650 3300031901 Bacteria 1447
318 Ga0307406_11072798 3300031901 Bacteria 694
319 Ga0307406_11307391 3300031901 Bacteria 633
320 Ga0307406_11920395 3300031901 Unclassified 528
321 Ga0307407_10004766 3300031903 Bacteria 5804
322 Ga0307407_10011208 3300031903 Bacteria 4256
323 Ga0307407_10037860 3300031903 Bacteria 2668
324 Ga0307407_10191484 3300031903 Bacteria 1363
325 Ga0307407_10591209 3300031903 Bacteria 825
326 Ga0307407_11127970 3300031903 Unclassified 610
327 Ga0307407_11486882 3300031903 Unclassified 535
328 Ga0307412_10008714 3300031911 Bacteria 5803
329 Ga0307412_10075798 3300031911 Bacteria 2308
330 Ga0307412_10498364 3300031911 Unclassified 1013
331 Ga0307412_11159860 3300031911 Bacteria 690
332 Ga0307412_11174108 3300031911 Bacteria 686
333 Ga0307412_11259169 3300031911 Bacteria 664
334 Ga0307409_100009568 3300031995 Bacteria 5965
335 Ga0307409_100152676 3300031995 Bacteria 2007
336 Ga0307409_100740991 3300031995 Unclassified 985
337 Ga0307409_101605776 3300031995 Bacteria 678
338 Ga0307409_101960836 3300031995 Unclassified 615
339 Ga0307416_100008439 3300032002 Bacteria 6650
340 Ga0307416_100026272 3300032002 Bacteria 4287
341 Ga0307416_100055514 3300032002 Bacteria 3190
342 Ga0307416_100056490 3300032002 Bacteria 3168
343 Ga0307416_100086350 3300032002 Bacteria 2674
344 Ga0307416_100159050 3300032002 Bacteria 2085
345 Ga0307416_100282677 3300032002 Bacteria 1637
346 Ga0307416_100324555 3300032002 Bacteria 1544
347 Ga0307416_102697955 3300032002 Unclassified 593
348 Ga0307416_103055536 3300032002 Bacteria 560
349 Ga0307414_10000650 3300032004 Bacteria 17745
350 Ga0307414_10007444 3300032004 Bacteria 6150
351 Ga0307414_10016090 3300032004 Bacteria 4536
352 Ga0307414_10382419 3300032004 Unclassified 1217
353 Ga0307414_10645708 3300032004 Bacteria 953
354 Ga0307414_11431730 3300032004 Bacteria 642
355 Ga0307414_12135418 3300032004 Unclassified 523
356 Ga0307411_10003831 3300032005 Bacteria 7078
357 Ga0307411_10016376 3300032005 Bacteria 4194
358 Ga0307411_10065920 3300032005 Bacteria 2430
359 Ga0307411_10258621 3300032005 Bacteria 1373
360 Ga0307411_11328056 3300032005 Bacteria 656
361 Ga0307415_100000969 3300032126 Bacteria 13175
362 Ga0307415_100013041 3300032126 Bacteria 4835
363 Ga0307415_100027782 3300032126 Bacteria 3589
364 Ga0307415_100039479 3300032126 Bacteria 3120
365 Ga0307415_100310535 3300032126 Bacteria 1310
366 Ga0307415_101807072 3300032126 Bacteria 591
367 Ga0307415_102261909 3300032126 Bacteria 533
368 Ga0373923_0437859 3300035111 Bacteria 633
369 Ga0373954_0029733 3300035118 Bacteria 2518
370 Ga0373957_0222869 3300035120 Bacteria 790
371 Ga0373957_0427157 3300035120 Unclassified 572
372 Ga0373955_0304881 3300035172 Bacteria 961
373 Ga0373924_0333725 3300035410 Bacteria 675
374 Ga0373933_1040204 3300035724 Bacteria 539
375 Ga0373937_0036462 3300036401 Bacteria 4481
376 Ga0373937_0471569 3300036401 Bacteria 1192
377 Ga0373937_0814933 3300036401 Bacteria 881
378 Ga0373937_1500317 3300036401 Viruses 622
379 Ga0373925_1034255 3300037068 Unclassified 676
380 Ga0373925_1132221 3300037068 Bacteria 644
381 Ga0451833_0481655 3300041491 Bacteria 697
382 Ga0450896_006456 3300042133 Bacteria 1609
383 Ga0466966_0001530 3300044684 Bacteria 14826
384 Ga0466966_0049107 3300044684 Bacteria 2688
385 Ga0466961_0057050 3300044693 Bacteria 2487
386 Ga0466963_1199198 3300044694 Bacteria 533
387 Ga0466957_0587942 3300044842 Bacteria 778
388 Ga0466959_0006514 3300045049 Bacteria 8095
389 Ga0466959_0046431 3300045049 Bacteria 3196
390 Ga0466958_0465199 3300045836 Bacteria 819
391 Ga0495592_0103201 3300046454 Bacteria 2029
392 Ga0495592_0130513 3300046454 Bacteria 1758
393 Ga0495603_0018332 3300046455 Bacteria 4234
394 Ga0495629_0139634 3300046459 Bacteria 1686
395 Ga0495629_0152885 3300046459 Bacteria 1604
396 Ga0495641_0153148 3300046461 Bacteria 1031
397 Ga0495651_0237887 3300046462 Bacteria 1250
398 Ga0495651_0857652 3300046462 Bacteria 557
399 Ga0495653_0225387 3300046463 Bacteria 1257
400 Ga0495653_0240328 3300046463 Bacteria 1207
401 Ga0495580_0957694 3300046472 Bacteria 547
402 Ga0495582_0071175 3300046473 Bacteria 1924
403 Ga0495662_0020983 3300046476 Bacteria 3159
404 Ga0495662_0033880 3300046476 Bacteria 2467
405 Ga0495664_0051857 3300046477 Bacteria 2436
406 Ga0495664_0376921 3300046477 Bacteria 853
407 Ga0495594_0050497 3300046499 Bacteria 2287
408 Ga0495608_0032873 3300046511 Bacteria 3507
409 Ga0495608_0059530 3300046511 Bacteria 2516
410 Ga0495618_0196830 3300046514 Bacteria 1276
411 Ga0495628_0084720 3300046516 Bacteria 2459
412 Ga0495628_0106482 3300046516 Bacteria 2159
413 Ga0495630_0068879 3300046517 Bacteria 2661
414 Ga0495630_0334954 3300046517 Unclassified 1157
415 Ga0495644_0303148 3300046523 Bacteria 625
416 Ga0495666_0138609 3300046526 Bacteria 1135
417 Ga0495652_0098996 3300046529 Bacteria 2368
418 Ga0495652_0145999 3300046529 Bacteria 1854
419 Ga0495652_0284071 3300046529 Bacteria 1210
420 Ga0495665_0208520 3300046531 Bacteria 1012
421 Ga0495640_0013380 3300046533 Bacteria 6233
422 Ga0495640_0062714 3300046533 Bacteria 2520
423 Ga0495586_0005406 3300046535 Bacteria 6831
424 Ga0495586_0064233 3300046535 Bacteria 2000
425 Ga0495587_0089635 3300046536 Bacteria 1777
426 Ga0495587_0207003 3300046536 Bacteria 1108
427 Ga0495587_0223331 3300046536 Bacteria 1062
428 Ga0495598_0040667 3300046537 Bacteria 1357
429 Ga0495645_0129383 3300046543 Bacteria 1771
430 Ga0495645_0244577 3300046543 Bacteria 1195
431 Ga0495645_0324072 3300046543 Bacteria 999
432 Ga0495645_0470594 3300046543 Bacteria 790
433 Ga0495667_0054956 3300046559 Bacteria 2618
434 Ga0495634_0040557 3300046642 Bacteria 3165
435 Ga0495634_0087347 3300046642 Bacteria 2029
436 Ga0495635_0050651 3300046663 Bacteria 2862
437 Ga0495635_0114117 3300046663 Bacteria 1844
438 Ga0495659_0068150 3300046664 Bacteria 1328
439 Ga0495659_0170738 3300046664 Bacteria 882
440 Ga0495657_0017987 3300046675 Bacteria 5123
441 Ga0495599_0054188 3300046678 Bacteria 2512
442 Ga0495623_0044936 3300046679 Bacteria 2806
443 Ga0495623_0700613 3300046679 Unclassified 519
444 Ga0495646_0052770 3300046680 Bacteria 2454
445 Ga0495646_0117231 3300046680 Bacteria 1510
446 Ga0495647_0057768 3300046681 Bacteria 1524
447 Ga0495658_0085428 3300046683 Bacteria 1860
448 Ga0495613_0028568 3300046689 Bacteria 4148
449 Ga0495613_0138463 3300046689 Bacteria 1740
450 Ga0495624_0123267 3300046690 Bacteria 1591
451 Ga0495624_0742743 3300046690 Bacteria 581
452 Ga0495600_0076510 3300046809 Bacteria 2186
453 Ga0495600_0175119 3300046809 Bacteria 1383
454 Ga0495581_0455314 3300047315 Bacteria 745
455 Ga0495604_0052663 3300047317 Bacteria 3150
456 Ga0495604_0101954 3300047317 Bacteria 2107
457 Ga0495674_0097012 3300047319 Bacteria 2511
458 Ga0495674_0155279 3300047319 Bacteria 1917
459 Ga0495676_0211304 3300047321 Bacteria 1342
460 Ga0495680_0295895 3300047322 Bacteria 1137
461 Ga0495680_0434812 3300047322 Bacteria 900
462 Ga0495675_0017264 3300047444 Bacteria 4573
463 Ga0495675_0053286 3300047444 Bacteria 2568
464 Ga0495684_0159967 3300047471 Bacteria 1680
465 Ga0495593_0142223 3300047673 Bacteria 1215
466 Ga0495602_0080010 3300048088 Bacteria 2754
467 Ga0495602_0274640 3300048088 Bacteria 1244
468 Ga0496114_0067837 3300048917 Bacteria 2993
469 Ga0496115_0003247 3300048918 Bacteria 11661
470 Ga0501299_005067 3300049522 Bacteria 2006
471 Ga0501031_0199385 3300049568 Bacteria 1306
472 Ga0501033_0937971 3300049570 Bacteria 580
473 Ga0501036_0234384 3300049572 Bacteria 1540
474 Ga0501039_0158788 3300049575 Bacteria 1777
475 Ga0501039_1398706 3300049575 Bacteria 539
476 Ga0501040_0023723 3300049576 Bacteria 4114
477 Ga0501041_0022629 3300049577 Bacteria 3764
478 Ga0501047_0096322 3300049581 Bacteria 2838
479 Ga0501048_0250046 3300049582 Bacteria 1258
480 Ga0501071_0077571 3300049587 Bacteria 2427
481 Ga0501071_0271989 3300049587 Bacteria 1281
482 Ga0501074_0365730 3300049590 Bacteria 1023
483 Ga0501075_0082619 3300049591 Bacteria 2433
484 Ga0501077_0037660 3300049593 Bacteria 3080
485 Ga0501216_117718 3300049660 Bacteria 603
486 Ga0501230_062744 3300049667 Bacteria 754
487 Ga0501247_058350 3300049677 Bacteria 588
488 Ga0501249_117919 3300049679 Bacteria 646
489 Ga0501257_279983 3300049686 Bacteria 502
490 Ga0501221_153534 3300049704 Bacteria 612
491 Ga0501080_0778219 3300049742 Bacteria 840
492 Ga0501081_0100614 3300049743 Bacteria 2043
493 Ga0501266_061758 3300049763 Bacteria 601
494 Ga0501273_042971 3300049770 Bacteria 673
495 Ga0501035_0750373 3300049822 Bacteria 783
496 Ga0501045_0025813 3300049824 Bacteria 4225
497 Ga0501045_0818806 3300049824 Bacteria 685
498 nmdc:mga05p37_97416_c1 3300050507 Bacteria 3623
499 nmdc:mga09592_208487_c1 3300050508 Bacteria 1693
500 nmdc:mga09592_719171_c1 3300050508 Bacteria 849
501 nmdc:mga0qj67_15584_c1 3300050509 Bacteria 5756
502 nmdc:mga0qj67_338175_c1 3300050509 Bacteria 1218
503 nmdc:mga08x19_1089997_c1 3300050514 Bacteria 567
504 Ga0495601_0379113 3300053077 Bacteria 918
505 Ga0495595_0541846 3300053084 Bacteria 594
506 Ga0495619_0373273 3300053085 Bacteria 986
507 Ga0500583_0106399 3300053092 Bacteria 1378
508 Ga0500604_0263345 3300053151 Bacteria 597
509 Ga0501084_1017343 3300054114 Bacteria 696
510 Ga0501084_1614962 3300054114 Bacteria 542
511 Ga0501082_0024323 3300060353 Bacteria 5222
512 Ga0466962_0351102 3300061719 Bacteria 734
513 Ga0530510_0086201 3300061734 Bacteria 2288
514 Ga0070683_100604307
515 JGI25406J46586_10045825
516 JGI26128J50194_1011942
517 Ga0058861_11896993
518 Ga0058862_12668736
519 Ga0065704_10810338
520 Ga0065712_10346147
521 Ga0070658_10039826
522 Ga0070658_10154171
523 Ga0070658_10663491
524 Ga0070676_10350486
525 Ga0070676_10629095
526 Ga0070683_100017261
527 Ga0070683_100145954
528 Ga0070690_100023994
529 Ga0070670_100025380
530 Ga0070670_100953833
531 Ga0070677_10098318
532 Ga0068869_101148962
533 Ga0070666_10179880
534 Ga0070666_11284787
535 Ga0070680_100222634
536 Ga0070680_100711976
537 Ga0070682_100944085
538 Ga0068868_101686894
539 Ga0070660_100051318
540 Ga0070660_100480026
541 Ga0070660_100643804
542 Ga0070660_100681442
543 Ga0070689_100156362
544 Ga0070689_101151872
545 Ga0070689_101269109
546 Ga0070691_10022394
547 Ga0070691_11025538
548 Ga0070687_100522224
549 Ga0070687_100621498
550 Ga0070687_100688067
551 Ga0070661_100001922
552 Ga0070661_100094505
553 Ga0070661_101440968
554 Ga0070669_100061985
555 Ga0070669_100206120
556 Ga0070675_100005173
557 Ga0070671_100076594
558 Ga0070674_100151631
559 Ga0070673_100022620
560 Ga0070673_100231058
561 Ga0070688_100414334
562 Ga0070688_100992063
563 Ga0070659_100505146
564 Ga0070659_101113882
565 Ga0070667_100038074
566 Ga0070667_100456436
567 Ga0070709_10015248
568 Ga0070709_10019843
569 Ga0070709_10218522
570 Ga0070709_10434432
571 Ga0070714_100027317
572 Ga0070714_100099236
573 Ga0070714_100247299
574 Ga0070713_100000157
575 Ga0070713_100108093
576 Ga0070710_10090189
577 Ga0070711_100563044
578 Ga0070700_100053841
579 Ga0070662_100692477
580 Ga0070662_101597170
581 Ga0070681_10157362
582 Ga0068867_100435618
583 Ga0070706_100580628
584 Ga0070707_100022852
585 Ga0070707_100914980
586 Ga0070698_100005143
587 Ga0070698_100142113
588 Ga0070698_100323481
589 Ga0070698_100337455
590 Ga0070699_100024725
591 Ga0070699_100071844
592 Ga0070699_100210662
593 Ga0070699_100890962
594 Ga0070679_100302387
595 Ga0070679_101744996
596 Ga0070679_102046230
597 Ga0070684_100172125
598 Ga0070684_100638899
599 Ga0070684_101007492
600 Ga0070684_101961548
601 Ga0070697_100469164
602 Ga0068853_100702427
603 Ga0068853_100730305
604 Ga0070672_100049540
605 Ga0070672_100143001
606 Ga0070696_100000402
607 Ga0070696_100004370
608 Ga0070693_100187432
609 Ga0070665_100818094
610 Ga0070665_100846258
611 Ga0070704_101218964
612 Ga0068855_100063511
613 Ga0068855_100468956
614 Ga0068855_100486975
615 Ga0068855_102260376
616 Ga0070664_100051312
617 Ga0070664_100120853
618 Ga0070664_100170990
619 Ga0070664_100236259
620 Ga0070664_100627606
621 Ga0068854_100021737
622 Ga0068854_100368765
623 Ga0068854_100666813
624 Ga0068856_100482267
625 Ga0068856_101598037
626 Ga0068852_100238666
627 Ga0068852_101253868
628 Ga0068859_100998691
629 Ga0068864_100385617
630 Ga0068864_100636041
631 Ga0068861_100790087
632 Ga0068870_10152943
633 Ga0068863_100312421
634 Ga0068863_100726882
635 Ga0068858_101019881
636 Ga0081539_10006262
637 Ga0081539_10354020
638 Ga0070717_10019695
639 Ga0070717_10424509
640 Ga0070717_10465863
641 Ga0070716_100749241
642 Ga0070712_100291312
643 Ga0068871_100861425
644 Ga0075428_100226732
645 Ga0075428_100483243
646 Ga0075430_100366585
647 Ga0075429_100221902
648 Ga0075429_100384393
649 Ga0068865_102098436
650 Ga0097620_100998632
651 Ga0105240_10251280
652 Ga0105240_10258655
653 Ga0105240_10316647
654 Ga0111539_12806745
655 Ga0114129_10029107
656 Ga0114129_13022736
657 Ga0105243_10797351
658 Ga0105241_10048649
659 Ga0105242_12366356
660 Ga0105248_10051202
661 Ga0105239_10423222
662 Ga0105239_10773135
663 Ga0105246_12323883
664 Ga0157373_10001735
665 Ga0157373_10528766
666 Ga0157373_10919228
667 Ga0157371_10096469
668 Ga0157370_10482941
669 Ga0157370_10738000
670 Ga0157369_10304357
671 Ga0157369_10540825
672 Ga0157369_10642953
673 Ga0157374_12331149
674 Ga0157378_10128545
675 Ga0163162_10424502
676 Ga0163162_11338377
677 Ga0157372_10041811
678 Ga0157372_10111344
679 Ga0157372_10294901
680 Ga0157372_10592359
681 Ga0157375_10011929
682 Ga0157375_10180492
683 Ga0163163_10367712
684 Ga0157377_10274963
685 Ga0157376_10427190
686 Ga0182007_10118918
687 Ga0197907_10465454
688 Ga0206353_10483970
689 Ga0207682_10141825
690 Ga0207692_10335688
691 Ga0207692_10437816
692 Ga0207688_10592320
693 Ga0207680_10241787
694 Ga0207699_10032477
695 Ga0207699_10110704
696 Ga0207699_10286740
697 Ga0207645_10039339
698 Ga0207645_10260686
699 Ga0207645_10516045
700 Ga0207645_10709525
701 Ga0207643_10269830
702 Ga0207705_10054467
703 Ga0207705_10731327
704 Ga0207705_10875529
705 Ga0207705_10900885
706 Ga0207684_10239888
707 Ga0207654_10046590
708 Ga0207707_10000784
709 Ga0207707_10175482
710 Ga0207695_10002690
711 Ga0207695_10286021
712 Ga0207695_10704753
713 Ga0207693_10377964
714 Ga0207660_10001291
715 Ga0207660_10528292
716 Ga0207660_10575157
717 Ga0207660_10854315
718 Ga0207662_10130819
719 Ga0207662_10152622
720 Ga0207657_10101285
721 Ga0207657_10118466
722 Ga0207649_10002377
723 Ga0207649_10104427
724 Ga0207652_10002905
725 Ga0207652_10162168
726 Ga0207652_10178922
727 Ga0207646_10020496
728 Ga0207646_10141797
729 Ga0207681_10010839
730 Ga0207681_10532960
731 Ga0207650_10073165
732 Ga0207650_10907539
733 Ga0207659_10008049
734 Ga0207700_10001123
735 Ga0207700_10132533
736 Ga0207664_10021082
737 Ga0207664_10225426
738 Ga0207664_10527335
739 Ga0207664_10911402
740 Ga0207644_10163678
741 Ga0207644_10245225
742 Ga0207644_10320270
743 Ga0207690_10037619
744 Ga0207690_10247552
745 Ga0207706_10066708
746 Ga0207706_10199214
747 Ga0207706_10577684
748 Ga0207670_10264827
749 Ga0207670_10453827
750 Ga0207669_10109666
751 Ga0207704_10562076
752 Ga0207704_11783379
753 Ga0207665_10674226
754 Ga0207691_10003543
755 Ga0207691_10636220
756 Ga0207689_10396514
757 Ga0207661_10017202
758 Ga0207661_10156644
759 Ga0207661_10314595
760 Ga0207661_11266680
761 Ga0207679_10099752
762 Ga0207679_10495318
763 Ga0207679_10840923
764 Ga0207667_10057146
765 Ga0207667_10608372
766 Ga0207651_10053787
767 Ga0207651_10480839
768 Ga0207668_10331852
769 Ga0207640_10000324
770 Ga0207640_10001124
771 Ga0207640_10685113
772 Ga0207658_10404450
773 Ga0207658_10618225
774 Ga0207677_11390366
775 Ga0207677_11779375
776 Ga0207639_10110641
777 Ga0207639_10164582
778 Ga0207678_10100206
779 Ga0207678_10205047
780 Ga0207678_10728142
781 Ga0207708_10194377
782 Ga0207702_10432017
783 Ga0207702_10760342
784 Ga0207641_11361081
785 Ga0207648_10944036
786 Ga0207648_12132697
787 Ga0207676_10427052
788 Ga0207675_100363779
789 Ga0207675_102093442
790 Ga0207675_102472257
791 Ga0207683_10340408
792 Ga0207698_10066516
793 Ga0207698_10345115
794 Ga0207698_10577915
795 Ga0207698_12453010
796 Ga0268264_10087060
797 Ga0316182_1239585
798 Ga0307408_100010979
799 Ga0307408_100089965
800 Ga0307408_100097713
801 Ga0307408_100127633
802 Ga0307408_100186978
803 Ga0307408_100619991
804 Ga0307408_101602037
805 Ga0307405_10003061
806 Ga0307405_10059292
807 Ga0307405_10113026
808 Ga0307405_10411570
809 Ga0307405_10469715
810 Ga0307405_10743395
811 Ga0307413_10009739
812 Ga0307413_10011536
813 Ga0307413_10060530
814 Ga0307413_10100171
815 Ga0307413_10528610
816 Ga0307413_10565857
817 Ga0307413_10809529
818 Ga0307410_10013257
819 Ga0307410_10022620
820 Ga0307410_10048579
821 Ga0307410_10147105
822 Ga0307410_10269431
823 Ga0307410_10513648
824 Ga0307410_10552823
825 Ga0307406_10007186
826 Ga0307406_10016304
827 Ga0307406_10016804
828 Ga0307406_10033753
829 Ga0307406_10062453
830 Ga0307406_10207650
831 Ga0307406_11072798
832 Ga0307406_11307391
833 Ga0307406_11920395
834 Ga0307407_10004766
835 Ga0307407_10011208
836 Ga0307407_10037860
837 Ga0307407_10191484
838 Ga0307407_10591209
839 Ga0307407_11127970
840 Ga0307407_11486882
841 Ga0307412_10008714
842 Ga0307412_10075798
843 Ga0307412_10498364
844 Ga0307412_11159860
845 Ga0307412_11174108
846 Ga0307412_11259169
847 Ga0307409_100009568
848 Ga0307409_100152676
849 Ga0307409_100740991
850 Ga0307409_101605776
851 Ga0307409_101960836
852 Ga0307416_100008439
853 Ga0307416_100026272
854 Ga0307416_100055514
855 Ga0307416_100056490
856 Ga0307416_100086350
857 Ga0307416_100159050
858 Ga0307416_100282677
859 Ga0307416_100324555
860 Ga0307416_102697955
861 Ga0307416_103055536
862 Ga0307414_10000650
863 Ga0307414_10007444
864 Ga0307414_10016090
865 Ga0307414_10382419
866 Ga0307414_10645708
867 Ga0307414_11431730
868 Ga0307414_12135418
869 Ga0307411_10003831
870 Ga0307411_10016376
871 Ga0307411_10065920
872 Ga0307411_10258621
873 Ga0307411_11328056
874 Ga0307415_100000969
875 Ga0307415_100013041
876 Ga0307415_100027782
877 Ga0307415_100039479
878 Ga0307415_100310535
879 Ga0307415_101807072
880 Ga0307415_102261909
881 Ga0373923_0437859
882 Ga0373954_0029733
883 Ga0373957_0222869
884 Ga0373957_0427157
885 Ga0373955_0304881
886 Ga0373924_0333725
887 Ga0373933_1040204
888 Ga0373937_0036462
889 Ga0373937_0471569
890 Ga0373937_0814933
891 Ga0373937_1500317
892 Ga0373925_1034255
893 Ga0373925_1132221
894 Ga0451833_0481655
895 Ga0450896_006456
896 Ga0466966_0001530
897 Ga0466966_0049107
898 Ga0466961_0057050
899 Ga0466963_1199198
900 Ga0466957_0587942
901 Ga0466959_0006514
902 Ga0466959_0046431
903 Ga0466958_0465199
904 Ga0495592_0103201
905 Ga0495592_0130513
906 Ga0495603_0018332
907 Ga0495629_0139634
908 Ga0495629_0152885
909 Ga0495641_0153148
910 Ga0495651_0237887
911 Ga0495651_0857652
912 Ga0495653_0225387
913 Ga0495653_0240328
914 Ga0495580_0957694
915 Ga0495582_0071175
916 Ga0495662_0020983
917 Ga0495662_0033880
918 Ga0495664_0051857
919 Ga0495664_0376921
920 Ga0495594_0050497
921 Ga0495608_0032873
922 Ga0495608_0059530
923 Ga0495618_0196830
924 Ga0495628_0084720
925 Ga0495628_0106482
926 Ga0495630_0068879
927 Ga0495630_0334954
928 Ga0495644_0303148
929 Ga0495666_0138609
930 Ga0495652_0098996
931 Ga0495652_0145999
932 Ga0495652_0284071
933 Ga0495665_0208520
934 Ga0495640_0013380
935 Ga0495640_0062714
936 Ga0495586_0005406
937 Ga0495586_0064233
938 Ga0495587_0089635
939 Ga0495587_0207003
940 Ga0495587_0223331
941 Ga0495598_0040667
942 Ga0495645_0129383
943 Ga0495645_0244577
944 Ga0495645_0324072
945 Ga0495645_0470594
946 Ga0495667_0054956
947 Ga0495634_0040557
948 Ga0495634_0087347
949 Ga0495635_0050651
950 Ga0495635_0114117
951 Ga0495659_0068150
952 Ga0495659_0170738
953 Ga0495657_0017987
954 Ga0495599_0054188
955 Ga0495623_0044936
956 Ga0495623_0700613
957 Ga0495646_0052770
958 Ga0495646_0117231
959 Ga0495647_0057768
960 Ga0495658_0085428
961 Ga0495613_0028568
962 Ga0495613_0138463
963 Ga0495624_0123267
964 Ga0495624_0742743
965 Ga0495600_0076510
966 Ga0495600_0175119
967 Ga0495581_0455314
968 Ga0495604_0052663
969 Ga0495604_0101954
970 Ga0495674_0097012
971 Ga0495674_0155279
972 Ga0495676_0211304
973 Ga0495680_0295895
974 Ga0495680_0434812
975 Ga0495675_0017264
976 Ga0495675_0053286
977 Ga0495684_0159967
978 Ga0495593_0142223
979 Ga0495602_0080010
980 Ga0495602_0274640
981 Ga0496114_0067837
982 Ga0496115_0003247
983 Ga0501299_005067
984 Ga0501031_0199385
985 Ga0501033_0937971
986 Ga0501036_0234384
987 Ga0501039_0158788
988 Ga0501039_1398706
989 Ga0501040_0023723
990 Ga0501041_0022629
991 Ga0501047_0096322
992 Ga0501048_0250046
993 Ga0501071_0077571
994 Ga0501071_0271989
995 Ga0501074_0365730
996 Ga0501075_0082619
997 Ga0501077_0037660
998 Ga0501216_117718
999 Ga0501230_062744
1000 Ga0501247_058350
1001 Ga0501249_117919
1002 Ga0501257_279983
1003 Ga0501221_153534
1004 Ga0501080_0778219
1005 Ga0501081_0100614
1006 Ga0501266_061758
1007 Ga0501273_042971
1008 Ga0501035_0750373
1009 Ga0501045_0025813
1010 Ga0501045_0818806
1011 nmdc:mga05p37_97416_c1
1012 nmdc:mga09592_208487_c1
1013 nmdc:mga09592_719171_c1
1014 nmdc:mga0qj67_15584_c1
1015 nmdc:mga0qj67_338175_c1
1016 nmdc:mga08x19_1089997_c1
1017 Ga0495601_0379113
1018 Ga0495595_0541846
1019 Ga0495619_0373273
1020 Ga0500583_0106399
1021 Ga0500604_0263345
1022 Ga0501084_1017343
1023 Ga0501084_1614962
1024 Ga0501082_0024323
1025 Ga0466962_0351102
1026 Ga0530510_0086201

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00327

Ribosomal_L30

Ribosomal protein L30p/L7e

27

77

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fxc-assembly1.cif.gz_AX the cryo-em structure of hibernating 100s ribosome dimer from pathogenic staphylococcus aureus 0.989 25 82
7nhn-assembly1.cif.gz_3 vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9871 27 80
4wf9-assembly1.cif.gz_W the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with telithromycin 0.9826 25 79
5hl7-assembly1.cif.gz_W the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with lefamulin 0.9819 25 79
8fn2-assembly1.cif.gz_b the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9817 24 82
ID Description Score Start End Superfamily
4wfbW00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9835 25 79 3.30.1390.20
5hl7W00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9819 25 79 3.30.1390.20
4tomZ00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9707 26 79 3.30.1390.20
6dddM00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9692 25 79 3.30.1390.20
af_Q54GH8_53_110_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9686 27 82 3.30.1390.20
ID Description Score Start End GO Terms
AF-A0A7C1D7X3-F1-model_v4 50S ribosomal protein L30 0.9986 26 83 GO:0003735
GO:0006412
GO:0022625
AF-A0A7W1PDV2-F1-model_v4 50S ribosomal protein L30 0.9985 24 83 GO:0003735
GO:0006412
GO:0022625
AF-A0A6N8VT08-F1-model_v4 deleted 0.9963 25 82
AF-A0A355UFD7-F1-model_v4 Large ribosomal subunit protein uL30 0.9943 26 82 GO:0003735
GO:0006412
GO:0022625
AF-A0A2S6UHY4-F1-model_v4 Large ribosomal subunit protein uL30 0.9943 25 80 GO:0003735
GO:0006412
GO:0022625

Map