F457461
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 512 | 283 | 512 | 302 |
Family's Representative Sequence
| Representative Sequence | 3300041512|Ga0451853_1358421|Ga0451853_1358421_1171_2154 |
| Length | 327 |
| Sequence | MRECGLSDIDAQAYRRALTVTSAAMKVSVEPKPLHEPLAGGTPGATVTVEPMVAGHVTWPATMMERPGGRFETLKLLRALLSGNPAATVPCPAFLIRHPSAGAILVDTGLHPSVATDGKENFGGMGNRFGNPSLEPGEDIPSQLRKRGLDPGEIPIVVMTHMHIDHTSAISEFPSSTFIVSEKEWNAAATGPRPLLNGYRRPHYDYAFDYRTVDFDRAGIDSYATFGRCFDLFGDGSLRLAYTPGHSAGHISVIAHLGKRDFVIGGDATYMQAQLDGNAPLAPRPFDEHNYRRSLQELKLFKREYPNAIVTPGHDPEFYAGLDARYE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 133 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 134 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 135 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 136 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 137 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 138 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 139 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 142 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 143 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 145 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 146 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 151 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 152 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 153 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 154 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 155 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 156 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 157 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 158 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 159 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 216 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 217 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 218 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 219 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 220 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 221 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 224 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 225 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 228 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 229 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 230 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 231 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 232 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 233 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 234 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 235 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 236 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 267 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 268 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 269 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 277 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 278 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 279 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 280 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 281 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 282 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.54 |
| Nodule | 0 |
| Rhizoplane | 11.33 |
| Rhizosphere | 82.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000556 | 3300001977 | Bacteria | 5618 |
| 2 | JGI24748J21848_1002016 | 3300002074 | Bacteria | 2266 |
| 3 | JGI24034J26672_10000147 | 3300002239 | Bacteria | 10141 |
| 4 | Ga0070683_100003645 | 3300005329 | Bacteria | 12544 |
| 5 | Ga0070683_100031376 | 3300005329 | Bacteria | 4831 |
| 6 | Ga0070683_100092824 | 3300005329 | Bacteria | 2835 |
| 7 | Ga0070683_100275108 | 3300005329 | Bacteria | 1602 |
| 8 | Ga0070677_10000020 | 3300005333 | Bacteria | 48941 |
| 9 | Ga0070682_100000009 | 3300005337 | Bacteria | 291635 |
| 10 | Ga0070682_100000032 | 3300005337 | Bacteria | 155141 |
| 11 | Ga0070682_100242916 | 3300005337 | Bacteria | 1294 |
| 12 | Ga0068868_100061700 | 3300005338 | Bacteria | 2970 |
| 13 | Ga0068868_100070495 | 3300005338 | Bacteria | 2787 |
| 14 | Ga0070691_10000003 | 3300005341 | Bacteria | 86538 |
| 15 | Ga0070691_10000348 | 3300005341 | Bacteria | 16483 |
| 16 | Ga0070661_100000032 | 3300005344 | Bacteria | 112964 |
| 17 | Ga0070692_10018423 | 3300005345 | Bacteria | 3358 |
| 18 | Ga0070668_100029027 | 3300005347 | Bacteria | 4199 |
| 19 | Ga0070668_100041672 | 3300005347 | Bacteria | 3518 |
| 20 | Ga0070675_100000022 | 3300005354 | Bacteria | 146580 |
| 21 | Ga0070671_100154846 | 3300005355 | Bacteria | 1936 |
| 22 | Ga0070674_100000021 | 3300005356 | Bacteria | 87134 |
| 23 | Ga0070674_100000075 | 3300005356 | Bacteria | 45822 |
| 24 | Ga0070673_100008528 | 3300005364 | Bacteria | 6819 |
| 25 | Ga0070688_100000031 | 3300005365 | Bacteria | 65288 |
| 26 | Ga0070688_100000194 | 3300005365 | Bacteria | 32209 |
| 27 | Ga0070688_100041121 | 3300005365 | Bacteria | 2836 |
| 28 | Ga0070659_100002039 | 3300005366 | Bacteria | 14442 |
| 29 | Ga0070659_100101582 | 3300005366 | Bacteria | 2315 |
| 30 | Ga0070667_100001503 | 3300005367 | Bacteria | 20862 |
| 31 | Ga0070667_100015838 | 3300005367 | Bacteria | 6237 |
| 32 | Ga0070714_100074920 | 3300005435 | Bacteria | 2936 |
| 33 | Ga0070714_100074954 | 3300005435 | Bacteria | 2935 |
| 34 | Ga0070713_100000516 | 3300005436 | Bacteria | 24506 |
| 35 | Ga0070713_100045444 | 3300005436 | Bacteria | 3599 |
| 36 | Ga0070710_10081672 | 3300005437 | Bacteria | 1888 |
| 37 | Ga0070711_100028366 | 3300005439 | Bacteria | 3684 |
| 38 | Ga0070711_100068958 | 3300005439 | Bacteria | 2486 |
| 39 | Ga0070700_100083667 | 3300005441 | Bacteria | 2066 |
| 40 | Ga0070700_100099506 | 3300005441 | Bacteria | 1913 |
| 41 | Ga0070663_100033780 | 3300005455 | Bacteria | 3536 |
| 42 | Ga0070663_100282127 | 3300005455 | Unclassified | 1324 |
| 43 | Ga0070678_100011255 | 3300005456 | Bacteria | 5510 |
| 44 | Ga0070662_100000052 | 3300005457 | Bacteria | 61979 |
| 45 | Ga0070681_10010128 | 3300005458 | Bacteria | 9293 |
| 46 | Ga0070681_10056853 | 3300005458 | Bacteria | 3893 |
| 47 | Ga0068867_100029739 | 3300005459 | Bacteria | 3937 |
| 48 | Ga0070685_10000058 | 3300005466 | Bacteria | 64666 |
| 49 | Ga0070685_10000263 | 3300005466 | Bacteria | 33715 |
| 50 | Ga0070685_10132509 | 3300005466 | Bacteria | 1560 |
| 51 | Ga0070679_100000134 | 3300005530 | Bacteria | 59591 |
| 52 | Ga0070679_100019644 | 3300005530 | Bacteria | 6574 |
| 53 | Ga0070684_100039278 | 3300005535 | Bacteria | 4070 |
| 54 | Ga0070684_100055447 | 3300005535 | Bacteria | 3455 |
| 55 | Ga0070684_100080217 | 3300005535 | Bacteria | 2887 |
| 56 | Ga0070684_100084428 | 3300005535 | Bacteria | 2815 |
| 57 | Ga0070684_100099400 | 3300005535 | Bacteria | 2597 |
| 58 | Ga0070684_100521935 | 3300005535 | Unclassified | 1101 |
| 59 | Ga0068853_100015477 | 3300005539 | Bacteria | 6266 |
| 60 | Ga0070672_100000258 | 3300005543 | Bacteria | 30020 |
| 61 | Ga0070695_100203244 | 3300005545 | Unclassified | 1417 |
| 62 | Ga0070693_100003269 | 3300005547 | Bacteria | 7523 |
| 63 | Ga0070665_100000022 | 3300005548 | Bacteria | 379286 |
| 64 | Ga0070665_100001623 | 3300005548 | Bacteria | 25894 |
| 65 | Ga0070665_100186690 | 3300005548 | Bacteria | 2074 |
| 66 | Ga0070704_100091354 | 3300005549 | Bacteria | 2270 |
| 67 | Ga0068857_100045709 | 3300005577 | Bacteria | 3885 |
| 68 | Ga0068854_100000133 | 3300005578 | Bacteria | 51376 |
| 69 | Ga0068854_100023995 | 3300005578 | Bacteria | 4171 |
| 70 | Ga0068856_100000369 | 3300005614 | Bacteria | 49419 |
| 71 | Ga0068856_100008918 | 3300005614 | Bacteria | 9756 |
| 72 | Ga0070702_100112910 | 3300005615 | Bacteria | 1688 |
| 73 | Ga0068852_100000024 | 3300005616 | Bacteria | 120479 |
| 74 | Ga0068864_100000023 | 3300005618 | Bacteria | 257064 |
| 75 | Ga0068866_10000007 | 3300005718 | Bacteria | 121729 |
| 76 | Ga0068866_10000469 | 3300005718 | Bacteria | 18473 |
| 77 | Ga0068851_10000895 | 3300005834 | Bacteria | 12866 |
| 78 | Ga0068851_10004054 | 3300005834 | Bacteria | 6576 |
| 79 | Ga0068863_100000110 | 3300005841 | Bacteria | 86415 |
| 80 | Ga0068863_100026684 | 3300005841 | Bacteria | 5508 |
| 81 | Ga0068863_100393201 | 3300005841 | Unclassified | 1355 |
| 82 | Ga0068858_100000150 | 3300005842 | Bacteria | 73075 |
| 83 | Ga0068858_100000329 | 3300005842 | Bacteria | 50177 |
| 84 | Ga0068858_100043131 | 3300005842 | Bacteria | 4183 |
| 85 | Ga0068858_100149533 | 3300005842 | Bacteria | 2195 |
| 86 | Ga0068860_100011273 | 3300005843 | Bacteria | 8809 |
| 87 | Ga0068862_100004171 | 3300005844 | Bacteria | 12237 |
| 88 | Ga0081455_10008364 | 3300005937 | Bacteria | 10769 |
| 89 | Ga0081455_10040573 | 3300005937 | Bacteria | 4102 |
| 90 | Ga0081455_10041806 | 3300005937 | Bacteria | 4026 |
| 91 | Ga0081455_10067212 | 3300005937 | Bacteria | 2988 |
| 92 | Ga0081455_10164303 | 3300005937 | Unclassified | 1698 |
| 93 | Ga0081455_10183350 | 3300005937 | Bacteria | 1583 |
| 94 | Ga0081455_10301681 | 3300005937 | Bacteria | 1149 |
| 95 | Ga0081540_1001588 | 3300005983 | Bacteria | 19426 |
| 96 | Ga0081539_10001052 | 3300005985 | Bacteria | 50554 |
| 97 | Ga0081539_10022350 | 3300005985 | Bacteria | 4189 |
| 98 | Ga0075363_100010859 | 3300006048 | Bacteria | 4344 |
| 99 | Ga0075364_10171734 | 3300006051 | Bacteria | 1466 |
| 100 | Ga0070715_10000003 | 3300006163 | Bacteria | 345282 |
| 101 | Ga0070715_10145985 | 3300006163 | Bacteria | 1154 |
| 102 | Ga0070716_100132062 | 3300006173 | Bacteria | 1580 |
| 103 | Ga0070712_100016243 | 3300006175 | Unclassified | 4806 |
| 104 | Ga0075367_10043857 | 3300006178 | Bacteria | 2620 |
| 105 | Ga0097621_100581550 | 3300006237 | Bacteria | 1022 |
| 106 | Ga0075430_100048532 | 3300006846 | Bacteria | 3585 |
| 107 | Ga0075431_100179264 | 3300006847 | Bacteria | 2175 |
| 108 | Ga0075433_10002915 | 3300006852 | Bacteria | 13125 |
| 109 | Ga0075433_10003283 | 3300006852 | Bacteria | 12491 |
| 110 | Ga0068865_100000024 | 3300006881 | Bacteria | 94969 |
| 111 | Ga0105245_10000022 | 3300009098 | Bacteria | 181225 |
| 112 | Ga0105245_10001178 | 3300009098 | Bacteria | 23683 |
| 113 | Ga0105245_10008000 | 3300009098 | Bacteria | 9247 |
| 114 | Ga0105245_10267092 | 3300009098 | Bacteria | 1667 |
| 115 | Ga0105247_10000064 | 3300009101 | Bacteria | 123994 |
| 116 | Ga0105247_10072683 | 3300009101 | Bacteria | 2153 |
| 117 | Ga0105243_10012040 | 3300009148 | Bacteria | 6541 |
| 118 | Ga0105242_10000123 | 3300009176 | Bacteria | 56900 |
| 119 | Ga0105242_10013245 | 3300009176 | Bacteria | 6366 |
| 120 | Ga0105242_10064933 | 3300009176 | Bacteria | 3010 |
| 121 | Ga0105248_10000017 | 3300009177 | Bacteria | 298089 |
| 122 | Ga0105238_10000016 | 3300009551 | Bacteria | 236218 |
| 123 | Ga0105249_10000181 | 3300009553 | Bacteria | 73946 |
| 124 | Ga0105249_10012298 | 3300009553 | Bacteria | 7542 |
| 125 | Ga0105239_10288660 | 3300010375 | Bacteria | 1847 |
| 126 | Ga0105246_10306240 | 3300011119 | Bacteria | 1285 |
| 127 | Ga0157371_10001783 | 3300013102 | Bacteria | 21764 |
| 128 | Ga0157370_10049032 | 3300013104 | Bacteria | 4044 |
| 129 | Ga0157369_10000068 | 3300013105 | Bacteria | 144274 |
| 130 | Ga0157374_10005308 | 3300013296 | Bacteria | 10822 |
| 131 | Ga0157374_10700813 | 3300013296 | Bacteria | 1026 |
| 132 | Ga0157378_10000656 | 3300013297 | Bacteria | 32583 |
| 133 | Ga0157378_10087628 | 3300013297 | Bacteria | 2824 |
| 134 | Ga0157375_10000126 | 3300013308 | Bacteria | 75410 |
| 135 | Ga0163163_10438413 | 3300014325 | Unclassified | 1366 |
| 136 | Ga0157380_10000328 | 3300014326 | Bacteria | 28745 |
| 137 | Ga0157380_10104533 | 3300014326 | Bacteria | 2365 |
| 138 | Ga0157377_10077334 | 3300014745 | Bacteria | 1937 |
| 139 | Ga0157379_10031333 | 3300014968 | Bacteria | 4736 |
| 140 | Ga0157379_10047841 | 3300014968 | Bacteria | 3817 |
| 141 | Ga0157379_10088250 | 3300014968 | Bacteria | 2781 |
| 142 | Ga0157376_10018824 | 3300014969 | Bacteria | 5307 |
| 143 | Ga0157376_10093379 | 3300014969 | Bacteria | 2612 |
| 144 | Ga0163161_10000013 | 3300017792 | Bacteria | 258747 |
| 145 | Ga0163161_10052079 | 3300017792 | Bacteria | 2967 |
| 146 | Ga0207656_10000274 | 3300025321 | Bacteria | 17852 |
| 147 | Ga0207656_10004135 | 3300025321 | Bacteria | 5043 |
| 148 | Ga0207682_10000050 | 3300025893 | Bacteria | 49908 |
| 149 | Ga0207642_10000008 | 3300025899 | Bacteria | 132651 |
| 150 | Ga0207642_10000181 | 3300025899 | Bacteria | 18196 |
| 151 | Ga0207710_10000165 | 3300025900 | Bacteria | 69714 |
| 152 | Ga0207680_10011411 | 3300025903 | Bacteria | 4489 |
| 153 | Ga0207680_10126296 | 3300025903 | Bacteria | 1680 |
| 154 | Ga0207685_10000003 | 3300025905 | Bacteria | 344527 |
| 155 | Ga0207705_10100545 | 3300025909 | Bacteria | 2127 |
| 156 | Ga0207707_10035644 | 3300025912 | Bacteria | 4350 |
| 157 | Ga0207707_10036138 | 3300025912 | Bacteria | 4320 |
| 158 | Ga0207663_10066167 | 3300025916 | Bacteria | 2312 |
| 159 | Ga0207649_10000015 | 3300025920 | Bacteria | 245662 |
| 160 | Ga0207652_10001289 | 3300025921 | Bacteria | 22300 |
| 161 | Ga0207652_10003408 | 3300025921 | Bacteria | 13125 |
| 162 | Ga0207694_10000012 | 3300025924 | Bacteria | 411218 |
| 163 | Ga0207659_10000030 | 3300025926 | Bacteria | 124433 |
| 164 | Ga0207687_10000025 | 3300025927 | Bacteria | 175177 |
| 165 | Ga0207687_10000039 | 3300025927 | Bacteria | 114303 |
| 166 | Ga0207687_10006005 | 3300025927 | Bacteria | 8035 |
| 167 | Ga0207687_10007709 | 3300025927 | Bacteria | 7066 |
| 168 | Ga0207700_10000019 | 3300025928 | Bacteria | 183117 |
| 169 | Ga0207700_10036698 | 3300025928 | Bacteria | 3543 |
| 170 | Ga0207664_10009739 | 3300025929 | Bacteria | 6757 |
| 171 | Ga0207664_10057860 | 3300025929 | Bacteria | 3083 |
| 172 | Ga0207690_10005737 | 3300025932 | Bacteria | 7337 |
| 173 | Ga0207690_10015961 | 3300025932 | Bacteria | 4562 |
| 174 | Ga0207706_10000137 | 3300025933 | Bacteria | 79758 |
| 175 | Ga0207686_10000066 | 3300025934 | Bacteria | 95095 |
| 176 | Ga0207686_10000592 | 3300025934 | Bacteria | 22655 |
| 177 | Ga0207686_10050440 | 3300025934 | Unclassified | 2587 |
| 178 | Ga0207686_10105615 | 3300025934 | Bacteria | 1889 |
| 179 | Ga0207709_10014890 | 3300025935 | Bacteria | 4302 |
| 180 | Ga0207669_10000032 | 3300025937 | Bacteria | 82757 |
| 181 | Ga0207669_10000091 | 3300025937 | Bacteria | 45833 |
| 182 | Ga0207669_10299513 | 3300025937 | Bacteria | 1221 |
| 183 | Ga0207704_10000054 | 3300025938 | Bacteria | 79155 |
| 184 | Ga0207665_10131145 | 3300025939 | Bacteria | 1779 |
| 185 | Ga0207691_10000871 | 3300025940 | Bacteria | 30024 |
| 186 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 187 | Ga0207661_10002638 | 3300025944 | Bacteria | 12343 |
| 188 | Ga0207661_10004497 | 3300025944 | Bacteria | 9777 |
| 189 | Ga0207661_10053194 | 3300025944 | Bacteria | 3239 |
| 190 | Ga0207661_10470190 | 3300025944 | Bacteria | 1147 |
| 191 | Ga0207651_10021515 | 3300025960 | Bacteria | 3922 |
| 192 | Ga0207712_10000067 | 3300025961 | Bacteria | 130079 |
| 193 | Ga0207712_10033097 | 3300025961 | Bacteria | 3493 |
| 194 | Ga0207668_10025559 | 3300025972 | Bacteria | 3823 |
| 195 | Ga0207668_10072576 | 3300025972 | Bacteria | 2463 |
| 196 | Ga0207640_10000147 | 3300025981 | Bacteria | 51462 |
| 197 | Ga0207640_10053916 | 3300025981 | Bacteria | 2627 |
| 198 | Ga0207658_10043805 | 3300025986 | Bacteria | 3255 |
| 199 | Ga0207658_10130823 | 3300025986 | Archaea | 2016 |
| 200 | Ga0207677_10043277 | 3300026023 | Bacteria | 2992 |
| 201 | Ga0207677_10066262 | 3300026023 | Bacteria | 2524 |
| 202 | Ga0207703_10000070 | 3300026035 | Bacteria | 123480 |
| 203 | Ga0207703_10000122 | 3300026035 | Bacteria | 92656 |
| 204 | Ga0207678_10019235 | 3300026067 | Bacteria | 5998 |
| 205 | Ga0207708_10061704 | 3300026075 | Bacteria | 2862 |
| 206 | Ga0207702_10000326 | 3300026078 | Bacteria | 54674 |
| 207 | Ga0207702_10000557 | 3300026078 | Bacteria | 41471 |
| 208 | Ga0207702_10012405 | 3300026078 | Bacteria | 7097 |
| 209 | Ga0207702_10232381 | 3300026078 | Unclassified | 1724 |
| 210 | Ga0207641_10000065 | 3300026088 | Bacteria | 156066 |
| 211 | Ga0207641_10019506 | 3300026088 | Bacteria | 5566 |
| 212 | Ga0207648_10043310 | 3300026089 | Bacteria | 3952 |
| 213 | Ga0207676_10000025 | 3300026095 | Bacteria | 261714 |
| 214 | Ga0207674_10069830 | 3300026116 | Bacteria | 3532 |
| 215 | Ga0207675_100581400 | 3300026118 | Unclassified | 1121 |
| 216 | Ga0207683_10020523 | 3300026121 | Bacteria | 5652 |
| 217 | Ga0207683_10072848 | 3300026121 | Bacteria | 3038 |
| 218 | Ga0207698_10000014 | 3300026142 | Bacteria | 240703 |
| 219 | Ga0268266_10000029 | 3300028379 | Bacteria | 424015 |
| 220 | Ga0268266_10000422 | 3300028379 | Bacteria | 64158 |
| 221 | Ga0268266_10000973 | 3300028379 | Bacteria | 36388 |
| 222 | Ga0268266_10111563 | 3300028379 | Bacteria | 2423 |
| 223 | Ga0268265_10005246 | 3300028380 | Bacteria | 8866 |
| 224 | Ga0268264_10007756 | 3300028381 | Bacteria | 8936 |
| 225 | Ga0265337_1000730 | 3300028556 | Bacteria | 17276 |
| 226 | Ga0265326_10000040 | 3300028558 | Bacteria | 85624 |
| 227 | Ga0265322_10000012 | 3300028654 | Bacteria | 152373 |
| 228 | Ga0265338_10000156 | 3300028800 | Bacteria | 125065 |
| 229 | Ga0265324_10000567 | 3300029957 | Bacteria | 25333 |
| 230 | Ga0265328_10008624 | 3300031239 | Bacteria | 4193 |
| 231 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 232 | Ga0265329_10007672 | 3300031242 | Bacteria | 4152 |
| 233 | Ga0265339_10021395 | 3300031249 | Bacteria | 3764 |
| 234 | Ga0265331_10031968 | 3300031250 | Bacteria | 2611 |
| 235 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 236 | Ga0265316_10023963 | 3300031344 | Bacteria | 5125 |
| 237 | Ga0265314_10000334 | 3300031711 | Bacteria | 66204 |
| 238 | Ga0316576_10012462 | 3300031727 | Bacteria | 5616 |
| 239 | Ga0316574_0009823 | 3300035398 | Bacteria | 5378 |
| 240 | Ga0316574_0213315 | 3300035398 | Unclassified | 1238 |
| 241 | Ga0373937_0033886 | 3300036401 | Bacteria | 4643 |
| 242 | Ga0316584_0002818 | 3300036712 | Bacteria | 11147 |
| 243 | Ga0395900_0229801 | 3300037418 | Bacteria | 1866 |
| 244 | Ga0395898_0129650 | 3300037466 | Bacteria | 2416 |
| 245 | Ga0395905_0278150 | 3300037471 | Bacteria | 1560 |
| 246 | Ga0395901_0482600 | 3300038443 | Bacteria | 1264 |
| 247 | Ga0395901_0687483 | 3300038443 | Unclassified | 1022 |
| 248 | Ga0451833_0445893 | 3300041491 | Bacteria | 1439 |
| 249 | Ga0451847_0609686 | 3300041503 | Bacteria | 1240 |
| 250 | Ga0451849_1233055 | 3300041505 | Bacteria | 901 |
| 251 | Ga0451853_1358421 | 3300041512 | Bacteria | 3353 |
| 252 | Ga0466963_0000257 | 3300044694 | Bacteria | 23311 |
| 253 | Ga0466963_0008184 | 3300044694 | Bacteria | 6266 |
| 254 | Ga0466963_0130248 | 3300044694 | Bacteria | 1737 |
| 255 | Ga0466957_0000193 | 3300044842 | Bacteria | 28057 |
| 256 | Ga0466957_0173007 | 3300044842 | Bacteria | 1407 |
| 257 | Ga0466967_0000849 | 3300045976 | Bacteria | 16201 |
| 258 | Ga0466967_0207368 | 3300045976 | Bacteria | 1858 |
| 259 | Ga0495592_0000424 | 3300046454 | Bacteria | 32002 |
| 260 | Ga0495592_0095525 | 3300046454 | Bacteria | 2126 |
| 261 | Ga0495603_0000083 | 3300046455 | Bacteria | 42311 |
| 262 | Ga0495603_0004890 | 3300046455 | Bacteria | 8013 |
| 263 | Ga0495629_0001145 | 3300046459 | Bacteria | 20950 |
| 264 | Ga0495629_0005665 | 3300046459 | Bacteria | 9329 |
| 265 | Ga0495629_0050304 | 3300046459 | Bacteria | 2919 |
| 266 | Ga0495629_0190161 | 3300046459 | Bacteria | 1421 |
| 267 | Ga0495641_0000010 | 3300046461 | Bacteria | 158798 |
| 268 | Ga0495651_0073968 | 3300046462 | Bacteria | 2586 |
| 269 | Ga0495653_0006069 | 3300046463 | Bacteria | 9900 |
| 270 | Ga0495653_0079686 | 3300046463 | Bacteria | 2425 |
| 271 | Ga0495582_0000006 | 3300046473 | Bacteria | 140434 |
| 272 | Ga0495662_0000178 | 3300046476 | Bacteria | 25519 |
| 273 | Ga0495594_0000001 | 3300046499 | Bacteria | 293051 |
| 274 | Ga0495606_0000283 | 3300046507 | Bacteria | 88309 |
| 275 | Ga0495608_0000042 | 3300046511 | Bacteria | 115906 |
| 276 | Ga0495608_0003416 | 3300046511 | Bacteria | 11374 |
| 277 | Ga0495608_0007777 | 3300046511 | Bacteria | 7549 |
| 278 | Ga0495618_0000037 | 3300046514 | Bacteria | 99735 |
| 279 | Ga0495620_0000731 | 3300046515 | Bacteria | 20250 |
| 280 | Ga0495620_0082089 | 3300046515 | Bacteria | 1303 |
| 281 | Ga0495628_0000265 | 3300046516 | Bacteria | 46703 |
| 282 | Ga0495628_0017094 | 3300046516 | Bacteria | 6043 |
| 283 | Ga0495628_0082001 | 3300046516 | Bacteria | 2505 |
| 284 | Ga0495628_0140673 | 3300046516 | Bacteria | 1842 |
| 285 | Ga0495628_0159635 | 3300046516 | Bacteria | 1714 |
| 286 | Ga0495630_0000148 | 3300046517 | Bacteria | 54619 |
| 287 | Ga0495630_0000586 | 3300046517 | Bacteria | 26542 |
| 288 | Ga0495637_0107457 | 3300046520 | Bacteria | 1085 |
| 289 | Ga0495644_0004691 | 3300046523 | Bacteria | 5372 |
| 290 | Ga0495652_0000009 | 3300046529 | Bacteria | 311000 |
| 291 | Ga0495652_0039820 | 3300046529 | Bacteria | 4063 |
| 292 | Ga0495640_0003678 | 3300046533 | Bacteria | 12324 |
| 293 | Ga0495640_0050712 | 3300046533 | Bacteria | 2857 |
| 294 | Ga0495586_0008020 | 3300046535 | Bacteria | 5632 |
| 295 | Ga0495586_0167990 | 3300046535 | Bacteria | 1239 |
| 296 | Ga0495587_0002629 | 3300046536 | Bacteria | 12001 |
| 297 | Ga0495587_0015546 | 3300046536 | Bacteria | 4750 |
| 298 | Ga0495598_0001441 | 3300046537 | Bacteria | 4716 |
| 299 | Ga0495621_0005233 | 3300046539 | Bacteria | 3715 |
| 300 | Ga0495645_0016069 | 3300046543 | Bacteria | 5337 |
| 301 | Ga0495645_0080076 | 3300046543 | Bacteria | 2345 |
| 302 | Ga0495622_0000069 | 3300046557 | Bacteria | 89759 |
| 303 | Ga0495667_0000109 | 3300046559 | Bacteria | 59985 |
| 304 | Ga0495656_0003522 | 3300046615 | Bacteria | 5296 |
| 305 | Ga0495668_0057343 | 3300046616 | Bacteria | 2150 |
| 306 | Ga0495634_0000021 | 3300046642 | Bacteria | 120521 |
| 307 | Ga0495634_0000951 | 3300046642 | Bacteria | 27343 |
| 308 | Ga0495634_0142664 | 3300046642 | Unclassified | 1520 |
| 309 | Ga0495625_0000109 | 3300046660 | Bacteria | 125064 |
| 310 | Ga0495635_0000006 | 3300046663 | Bacteria | 301820 |
| 311 | Ga0495635_0038592 | 3300046663 | Bacteria | 3306 |
| 312 | Ga0495635_0081100 | 3300046663 | Bacteria | 2220 |
| 313 | Ga0495588_0098562 | 3300046674 | Bacteria | 1535 |
| 314 | Ga0495657_0000040 | 3300046675 | Bacteria | 115899 |
| 315 | Ga0495599_0020110 | 3300046678 | Bacteria | 4158 |
| 316 | Ga0495623_0091266 | 3300046679 | Bacteria | 1869 |
| 317 | Ga0495647_0000002 | 3300046681 | Bacteria | 174959 |
| 318 | Ga0495647_0002786 | 3300046681 | Bacteria | 5539 |
| 319 | Ga0495647_0034003 | 3300046681 | Bacteria | 1907 |
| 320 | Ga0495658_0000027 | 3300046683 | Bacteria | 74322 |
| 321 | Ga0495669_0000132 | 3300046684 | Bacteria | 47843 |
| 322 | Ga0495613_0000190 | 3300046689 | Bacteria | 60696 |
| 323 | Ga0495613_0000324 | 3300046689 | Bacteria | 42895 |
| 324 | Ga0495624_0000005 | 3300046690 | Bacteria | 158127 |
| 325 | Ga0495624_0000031 | 3300046690 | Bacteria | 91702 |
| 326 | Ga0495624_0037983 | 3300046690 | Bacteria | 3096 |
| 327 | Ga0495670_0041667 | 3300046691 | Bacteria | 2291 |
| 328 | Ga0495649_0040054 | 3300046694 | Bacteria | 2567 |
| 329 | Ga0495600_0001252 | 3300046809 | Bacteria | 13978 |
| 330 | Ga0495600_0023088 | 3300046809 | Bacteria | 4001 |
| 331 | Ga0495604_0000636 | 3300047317 | Bacteria | 30130 |
| 332 | Ga0495604_0001593 | 3300047317 | Bacteria | 18689 |
| 333 | Ga0495674_0004050 | 3300047319 | Bacteria | 14178 |
| 334 | Ga0495672_0142528 | 3300047320 | Bacteria | 1250 |
| 335 | Ga0495676_0000209 | 3300047321 | Bacteria | 46557 |
| 336 | Ga0495676_0000624 | 3300047321 | Bacteria | 29322 |
| 337 | Ga0495676_0002889 | 3300047321 | Bacteria | 15495 |
| 338 | Ga0495680_0000094 | 3300047322 | Bacteria | 80355 |
| 339 | Ga0495680_0000332 | 3300047322 | Bacteria | 52925 |
| 340 | Ga0495680_0010267 | 3300047322 | Bacteria | 8355 |
| 341 | Ga0495680_0124091 | 3300047322 | Bacteria | 1904 |
| 342 | Ga0495675_0000051 | 3300047444 | Bacteria | 80375 |
| 343 | Ga0495679_044460 | 3300047446 | Bacteria | 1360 |
| 344 | Ga0495685_042063 | 3300047447 | Bacteria | 1560 |
| 345 | Ga0495686_0008917 | 3300047472 | Bacteria | 7291 |
| 346 | Ga0495593_0058369 | 3300047673 | Bacteria | 2024 |
| 347 | Ga0495602_0000038 | 3300048088 | Bacteria | 130758 |
| 348 | Ga0495602_0002031 | 3300048088 | Bacteria | 20359 |
| 349 | Ga0495602_0133551 | 3300048088 | Bacteria | 1975 |
| 350 | Ga0495602_0221192 | 3300048088 | Bacteria | 1429 |
| 351 | Ga0496100_0000006 | 3300048903 | Bacteria | 297429 |
| 352 | Ga0496100_0000028 | 3300048903 | Bacteria | 113912 |
| 353 | Ga0496101_0000005 | 3300048904 | Bacteria | 331455 |
| 354 | Ga0496101_0000009 | 3300048904 | Bacteria | 297429 |
| 355 | Ga0496102_0000021 | 3300048905 | Bacteria | 246920 |
| 356 | Ga0496102_0031863 | 3300048905 | Bacteria | 4732 |
| 357 | Ga0496102_0120196 | 3300048905 | Bacteria | 2453 |
| 358 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 359 | Ga0496103_0023273 | 3300048906 | Bacteria | 3735 |
| 360 | Ga0496103_0027757 | 3300048906 | Bacteria | 3433 |
| 361 | Ga0496103_0056705 | 3300048906 | Bacteria | 2432 |
| 362 | Ga0496104_0000008 | 3300048907 | Bacteria | 516976 |
| 363 | Ga0496104_0000029 | 3300048907 | Bacteria | 202968 |
| 364 | Ga0496104_0108935 | 3300048907 | Bacteria | 2655 |
| 365 | Ga0496105_0000002 | 3300048908 | Bacteria | 753215 |
| 366 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 367 | Ga0496105_0000876 | 3300048908 | Bacteria | 20602 |
| 368 | Ga0496105_0020070 | 3300048908 | Bacteria | 5395 |
| 369 | Ga0496105_0048057 | 3300048908 | Bacteria | 3522 |
| 370 | Ga0496106_0000070 | 3300048909 | Bacteria | 82770 |
| 371 | Ga0496106_0000090 | 3300048909 | Bacteria | 72270 |
| 372 | Ga0496106_0000101 | 3300048909 | Bacteria | 65644 |
| 373 | Ga0496107_0000004 | 3300048910 | Bacteria | 297680 |
| 374 | Ga0496107_0000015 | 3300048910 | Bacteria | 173644 |
| 375 | Ga0496107_0035771 | 3300048910 | Bacteria | 3561 |
| 376 | Ga0496107_0173708 | 3300048910 | Bacteria | 1599 |
| 377 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 378 | Ga0496108_0000042 | 3300048911 | Bacteria | 146397 |
| 379 | Ga0496108_0000178 | 3300048911 | Bacteria | 58913 |
| 380 | Ga0496108_0005504 | 3300048911 | Bacteria | 10245 |
| 381 | Ga0496108_0038231 | 3300048911 | Bacteria | 3998 |
| 382 | Ga0496109_0000034 | 3300048912 | Bacteria | 160397 |
| 383 | Ga0496109_0000036 | 3300048912 | Bacteria | 153972 |
| 384 | Ga0496109_0000391 | 3300048912 | Bacteria | 39830 |
| 385 | Ga0496109_0001026 | 3300048912 | Bacteria | 23100 |
| 386 | Ga0496109_0010089 | 3300048912 | Bacteria | 8060 |
| 387 | Ga0496109_0252459 | 3300048912 | Bacteria | 1661 |
| 388 | Ga0496109_0353448 | 3300048912 | Bacteria | 1388 |
| 389 | Ga0496109_0637944 | 3300048912 | Unclassified | 1002 |
| 390 | Ga0496110_0000122 | 3300048913 | Bacteria | 43513 |
| 391 | Ga0496110_0007589 | 3300048913 | Bacteria | 8668 |
| 392 | Ga0496110_0025709 | 3300048913 | Bacteria | 5034 |
| 393 | Ga0496110_0059015 | 3300048913 | Bacteria | 3380 |
| 394 | Ga0496111_0000037 | 3300048914 | Bacteria | 52978 |
| 395 | Ga0496111_0080264 | 3300048914 | Unclassified | 2380 |
| 396 | Ga0496111_0224791 | 3300048914 | Bacteria | 1394 |
| 397 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 398 | Ga0496112_0010244 | 3300048915 | Bacteria | 8499 |
| 399 | Ga0496113_0000002 | 3300048916 | Bacteria | 220193 |
| 400 | Ga0496113_0018796 | 3300048916 | Bacteria | 4820 |
| 401 | Ga0496113_0030978 | 3300048916 | Bacteria | 3877 |
| 402 | Ga0496113_0164654 | 3300048916 | Bacteria | 1754 |
| 403 | Ga0496114_0000159 | 3300048917 | Bacteria | 47728 |
| 404 | Ga0496114_0005005 | 3300048917 | Bacteria | 10338 |
| 405 | Ga0496114_0131161 | 3300048917 | Bacteria | 2164 |
| 406 | Ga0496114_0272529 | 3300048917 | Bacteria | 1491 |
| 407 | Ga0496115_0000005 | 3300048918 | Bacteria | 290756 |
| 408 | Ga0496115_0000257 | 3300048918 | Bacteria | 47123 |
| 409 | Ga0496116_0000138 | 3300048919 | Bacteria | 151606 |
| 410 | Ga0496118_0001277 | 3300048921 | Bacteria | 38534 |
| 411 | Ga0496118_0035997 | 3300048921 | Bacteria | 4010 |
| 412 | Ga0496118_0149978 | 3300048921 | Bacteria | 1461 |
| 413 | Ga0496119_0003660 | 3300048922 | Bacteria | 15783 |
| 414 | Ga0496119_0021239 | 3300048922 | Bacteria | 4699 |
| 415 | Ga0496119_0024862 | 3300048922 | Bacteria | 4199 |
| 416 | Ga0496119_0164991 | 3300048922 | Bacteria | 1174 |
| 417 | Ga0496120_0002330 | 3300048923 | Bacteria | 19539 |
| 418 | Ga0496121_0006772 | 3300048924 | Bacteria | 14054 |
| 419 | Ga0496121_0095795 | 3300048924 | Bacteria | 2305 |
| 420 | Ga0496125_0028985 | 3300048928 | Bacteria | 4985 |
| 421 | Ga0496125_0074977 | 3300048928 | Bacteria | 2620 |
| 422 | Ga0496126_0007436 | 3300048929 | Bacteria | 12015 |
| 423 | Ga0496126_0045157 | 3300048929 | Bacteria | 4052 |
| 424 | Ga0496126_0182320 | 3300048929 | Bacteria | 1783 |
| 425 | Ga0501031_0003336 | 3300049568 | Bacteria | 10303 |
| 426 | Ga0501032_0009040 | 3300049569 | Bacteria | 7239 |
| 427 | Ga0501033_0005116 | 3300049570 | Bacteria | 10430 |
| 428 | Ga0501034_0003804 | 3300049571 | Bacteria | 17018 |
| 429 | Ga0501034_0022387 | 3300049571 | Bacteria | 6439 |
| 430 | Ga0501034_0051243 | 3300049571 | Bacteria | 4162 |
| 431 | Ga0501034_0119650 | 3300049571 | Bacteria | 2620 |
| 432 | Ga0501034_0204127 | 3300049571 | Bacteria | 1933 |
| 433 | Ga0501036_0073446 | 3300049572 | Bacteria | 2891 |
| 434 | Ga0501037_0009327 | 3300049573 | Bacteria | 7200 |
| 435 | Ga0501038_0014268 | 3300049574 | Bacteria | 7239 |
| 436 | Ga0501039_0045896 | 3300049575 | Bacteria | 3376 |
| 437 | Ga0501039_0089346 | 3300049575 | Bacteria | 2401 |
| 438 | Ga0501040_0017812 | 3300049576 | Bacteria | 4715 |
| 439 | Ga0501042_0024380 | 3300049578 | Bacteria | 4242 |
| 440 | Ga0501042_0044650 | 3300049578 | Bacteria | 3158 |
| 441 | Ga0501042_0056709 | 3300049578 | Bacteria | 2795 |
| 442 | Ga0501043_0001141 | 3300049579 | Bacteria | 23356 |
| 443 | Ga0501043_0217466 | 3300049579 | Bacteria | 1479 |
| 444 | Ga0501046_0009482 | 3300049580 | Bacteria | 8413 |
| 445 | Ga0501047_0003662 | 3300049581 | Bacteria | 14481 |
| 446 | Ga0501047_0077493 | 3300049581 | Bacteria | 3197 |
| 447 | Ga0501047_0153051 | 3300049581 | Bacteria | 2181 |
| 448 | Ga0501047_0249364 | 3300049581 | Bacteria | 1624 |
| 449 | Ga0501048_0009669 | 3300049582 | Bacteria | 7234 |
| 450 | Ga0501067_0034805 | 3300049583 | Bacteria | 2796 |
| 451 | Ga0501068_0032152 | 3300049584 | Bacteria | 3119 |
| 452 | Ga0501068_0033339 | 3300049584 | Bacteria | 3067 |
| 453 | Ga0501068_0061938 | 3300049584 | Bacteria | 2274 |
| 454 | Ga0501069_0002690 | 3300049585 | Bacteria | 9072 |
| 455 | Ga0501069_0024220 | 3300049585 | Bacteria | 3310 |
| 456 | Ga0501069_0323404 | 3300049585 | Bacteria | 906 |
| 457 | Ga0501070_0005806 | 3300049586 | Bacteria | 10532 |
| 458 | Ga0501070_0007976 | 3300049586 | Bacteria | 8970 |
| 459 | Ga0501070_0124388 | 3300049586 | Bacteria | 2131 |
| 460 | Ga0501070_0277885 | 3300049586 | Bacteria | 1367 |
| 461 | Ga0501071_0051249 | 3300049587 | Bacteria | 2974 |
| 462 | Ga0501072_0045489 | 3300049588 | Bacteria | 3452 |
| 463 | Ga0501073_0040030 | 3300049589 | Bacteria | 3319 |
| 464 | Ga0501074_0008960 | 3300049590 | Bacteria | 7258 |
| 465 | Ga0501075_0004446 | 3300049591 | Bacteria | 9488 |
| 466 | Ga0501079_0010469 | 3300049741 | Bacteria | 7051 |
| 467 | Ga0501080_0059103 | 3300049742 | Bacteria | 3568 |
| 468 | Ga0501080_0246741 | 3300049742 | Unclassified | 1628 |
| 469 | Ga0501080_0343279 | 3300049742 | Unclassified | 1349 |
| 470 | Ga0501081_0059098 | 3300049743 | Bacteria | 2654 |
| 471 | Ga0501081_0160128 | 3300049743 | Bacteria | 1622 |
| 472 | Ga0501083_0021607 | 3300049744 | Bacteria | 4469 |
| 473 | Ga0501083_0023580 | 3300049744 | Bacteria | 4266 |
| 474 | Ga0501035_0007460 | 3300049822 | Bacteria | 10214 |
| 475 | Ga0501044_0007015 | 3300049823 | Bacteria | 12399 |
| 476 | Ga0501044_0203844 | 3300049823 | Bacteria | 1935 |
| 477 | Ga0501044_0283305 | 3300049823 | Bacteria | 1590 |
| 478 | Ga0501045_0049109 | 3300049824 | Bacteria | 3076 |
| 479 | nmdc:mga03n38_84416_c1 | 3300050490 | Unclassified | 1499 |
| 480 | nmdc:mga00v17_335511_c1 | 3300050491 | Unclassified | 983 |
| 481 | nmdc:mga00v17_60501_c1 | 3300050491 | Bacteria | 2326 |
| 482 | nmdc:mga0yw44_1878_c1 | 3300050492 | Bacteria | 8644 |
| 483 | nmdc:mga0qj67_59238_c1 | 3300050509 | Bacteria | 3036 |
| 484 | nmdc:mga0a205_15_c1 | 3300050515 | Bacteria | 33986 |
| 485 | nmdc:mga0a205_3790_c1 | 3300050515 | Bacteria | 13540 |
| 486 | Ga0495601_0000019 | 3300053077 | Bacteria | 161673 |
| 487 | Ga0495601_0000059 | 3300053077 | Bacteria | 60752 |
| 488 | Ga0495601_0018526 | 3300053077 | Bacteria | 4239 |
| 489 | Ga0495612_0001133 | 3300053078 | Bacteria | 10927 |
| 490 | Ga0495612_0001929 | 3300053078 | Bacteria | 8537 |
| 491 | Ga0495612_0058792 | 3300053078 | Bacteria | 1589 |
| 492 | Ga0495655_0000008 | 3300053083 | Bacteria | 153535 |
| 493 | Ga0495655_0056444 | 3300053083 | Bacteria | 1057 |
| 494 | Ga0495595_0000009 | 3300053084 | Bacteria | 193039 |
| 495 | Ga0495595_0000213 | 3300053084 | Bacteria | 23371 |
| 496 | Ga0495595_0001807 | 3300053084 | Bacteria | 8340 |
| 497 | Ga0495619_0000001 | 3300053085 | Bacteria | 586054 |
| 498 | Ga0495619_0000057 | 3300053085 | Bacteria | 93948 |
| 499 | Ga0495619_0000069 | 3300053085 | Bacteria | 82755 |
| 500 | Ga0495619_0000347 | 3300053085 | Bacteria | 32351 |
| 501 | Ga0495619_0002458 | 3300053085 | Bacteria | 12117 |
| 502 | Ga0495619_0005611 | 3300053085 | Bacteria | 7959 |
| 503 | Ga0495619_0011363 | 3300053085 | Bacteria | 5607 |
| 504 | Ga0495619_0090877 | 3300053085 | Bacteria | 2067 |
| 505 | Ga0500566_0029398 | 3300053094 | Bacteria | 3210 |
| 506 | Ga0500641_0009782 | 3300053096 | Bacteria | 3451 |
| 507 | Ga0500554_086565 | 3300053102 | Unclassified | 1037 |
| 508 | Ga0500595_044606 | 3300053119 | Bacteria | 1404 |
| 509 | Ga0500614_001627 | 3300053123 | Bacteria | 5294 |
| 510 | Ga0500628_000043 | 3300053129 | Bacteria | 45301 |
| 511 | Ga0501084_0079345 | 3300054114 | Bacteria | 2751 |
| 512 | Ga0501082_0044209 | 3300060353 | Bacteria | 3842 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048912 | Ga0496109_0353448 | Ga0496109_0353448_563_1357 | 264 |
| 2 | 3300049585 | Ga0501069_0323404 | Ga0501069_0323404_51_845 | 264 |
| 3 | 3300049586 | Ga0501070_0124388 | Ga0501070_0124388_51_845 | 264 |
| 4 | 3300041505 | Ga0451849_1233055 | Ga0451849_1233055_87_884 | 265 |
| 5 | 3300049586 | Ga0501070_0007976 | Ga0501070_0007976_8155_8955 | 265 |
| 6 | 3300049571 | Ga0501034_0051243 | Ga0501034_0051243_3163_3987 | 274 |
| 7 | 3300049571 | Ga0501034_0119650 | Ga0501034_0119650_105_929 | 274 |
| 8 | 3300050490 | nmdc:mga03n38_84416_c1 | nmdc:mga03n38_84416_c1_650_1474 | 274 |
| 9 | 3300050491 | nmdc:mga00v17_60501_c1 | nmdc:mga00v17_60501_c1_474_1298 | 274 |
| 10 | 3300038443 | Ga0395901_0687483 | Ga0395901_0687483_126_968 | 275 |
| 11 | 3300046520 | Ga0495637_0107457 | Ga0495637_0107457_13_843 | 276 |
| 12 | 3300046678 | Ga0495599_0020110 | Ga0495599_0020110_2632_3462 | 276 |
| 13 | 3300048911 | Ga0496108_0000178 | Ga0496108_0000178_13607_14518 | 277 |
| 14 | 3300048912 | Ga0496109_0001026 | Ga0496109_0001026_10489_11400 | 277 |
| 15 | 3300005355 | Ga0070671_100154846 | Ga0070671_1001548462 | 279 |
| 16 | 3300049571 | Ga0501034_0003804 | Ga0501034_0003804_8985_9824 | 279 |
| 17 | 3300050491 | nmdc:mga00v17_335511_c1 | nmdc:mga00v17_335511_c1_66_908 | 279 |
| 18 | 3300046523 | Ga0495644_0004691 | Ga0495644_0004691_3746_4657 | 281 |
| 19 | 3300041503 | Ga0451847_0609686 | Ga0451847_0609686_39_926 | 292 |
| 20 | 3300046616 | Ga0495668_0057343 | Ga0495668_0057343_171_1055 | 294 |
| 21 | 3300049584 | Ga0501068_0061938 | Ga0501068_0061938_317_1228 | 295 |
| 22 | 3300053102 | Ga0500554_086565 | Ga0500554_086565_113_1015 | 295 |
| 23 | 3300038443 | Ga0395901_0482600 | Ga0395901_0482600_131_1027 | 296 |
| 24 | 3300005937 | Ga0081455_10008364 | Ga0081455_100083646 | 297 |
| 25 | 3300005937 | Ga0081455_10164303 | Ga0081455_101643032 | 297 |
| 26 | 3300005937 | Ga0081455_10183350 | Ga0081455_101833502 | 297 |
| 27 | 3300005937 | Ga0081455_10301681 | Ga0081455_103016812 | 297 |
| 28 | 3300005983 | Ga0081540_1001588 | Ga0081540_100158810 | 297 |
| 29 | 3300013296 | Ga0157374_10005308 | Ga0157374_100053084 | 297 |
| 30 | 3300037418 | Ga0395900_0229801 | Ga0395900_0229801_319_1254 | 297 |
| 31 | 3300037466 | Ga0395898_0129650 | Ga0395898_0129650_708_1619 | 297 |
| 32 | 3300037471 | Ga0395905_0278150 | Ga0395905_0278150_25_984 | 297 |
| 33 | 3300048914 | Ga0496111_0080264 | Ga0496111_0080264_838_1746 | 297 |
| 34 | 3300014326 | Ga0157380_10000328 | Ga0157380_1000032816 | 298 |
| 35 | 3300046516 | Ga0495628_0017094 | Ga0495628_0017094_1120_2031 | 298 |
| 36 | 3300046681 | Ga0495647_0000002 | Ga0495647_0000002_43387_44298 | 298 |
| 37 | 3300005937 | Ga0081455_10067212 | Ga0081455_100672123 | 299 |
| 38 | 3300048922 | Ga0496119_0024862 | Ga0496119_0024862_1511_2410 | 299 |
| 39 | 3300005347 | Ga0070668_100029027 | Ga0070668_1000290272 | 301 |
| 40 | 3300005367 | Ga0070667_100001503 | Ga0070667_1000015033 | 301 |
| 41 | 3300005548 | Ga0070665_100186690 | Ga0070665_1001866902 | 301 |
| 42 | 3300005842 | Ga0068858_100149533 | Ga0068858_1001495332 | 301 |
| 43 | 3300005844 | Ga0068862_100004171 | Ga0068862_1000041717 | 301 |
| 44 | 3300005937 | Ga0081455_10040573 | Ga0081455_100405734 | 301 |
| 45 | 3300006048 | Ga0075363_100010859 | Ga0075363_1000108592 | 301 |
| 46 | 3300006051 | Ga0075364_10171734 | Ga0075364_101717342 | 301 |
| 47 | 3300006178 | Ga0075367_10043857 | Ga0075367_100438573 | 301 |
| 48 | 3300006847 | Ga0075431_100179264 | Ga0075431_1001792642 | 301 |
| 49 | 3300009098 | Ga0105245_10267092 | Ga0105245_102670922 | 301 |
| 50 | 3300009553 | Ga0105249_10012298 | Ga0105249_100122983 | 301 |
| 51 | 3300014968 | Ga0157379_10047841 | Ga0157379_100478413 | 301 |
| 52 | 3300025961 | Ga0207712_10033097 | Ga0207712_100330973 | 301 |
| 53 | 3300025972 | Ga0207668_10025559 | Ga0207668_100255593 | 301 |
| 54 | 3300025986 | Ga0207658_10043805 | Ga0207658_100438052 | 301 |
| 55 | 3300028380 | Ga0268265_10005246 | Ga0268265_1000524610 | 301 |
| 56 | 3300031727 | Ga0316576_10012462 | Ga0316576_100124626 | 301 |
| 57 | 3300035398 | Ga0316574_0009823 | Ga0316574_0009823_112_1080 | 301 |
| 58 | 3300035398 | Ga0316574_0213315 | Ga0316574_0213315_38_943 | 301 |
| 59 | 3300036712 | Ga0316584_0002818 | Ga0316584_0002818_6287_7192 | 301 |
| 60 | 3300045976 | Ga0466967_0000849 | Ga0466967_0000849_7980_8885 | 301 |
| 61 | 3300048912 | Ga0496109_0637944 | Ga0496109_0637944_38_943 | 301 |
| 62 | 3300049586 | Ga0501070_0277885 | Ga0501070_0277885_168_1073 | 301 |
| 63 | 3300050492 | nmdc:mga0yw44_1878_c1 | nmdc:mga0yw44_1878_c1_1801_2706 | 301 |
| 64 | 3300053083 | Ga0495655_0056444 | Ga0495655_0056444_86_991 | 301 |
| 65 | 3300005329 | Ga0070683_100031376 | Ga0070683_1000313766 | 302 |
| 66 | 3300005356 | Ga0070674_100000021 | Ga0070674_10000002117 | 302 |
| 67 | 3300005365 | Ga0070688_100041121 | Ga0070688_1000411212 | 302 |
| 68 | 3300005366 | Ga0070659_100002039 | Ga0070659_1000020398 | 302 |
| 69 | 3300005435 | Ga0070714_100074954 | Ga0070714_1000749543 | 302 |
| 70 | 3300005436 | Ga0070713_100000516 | Ga0070713_10000051615 | 302 |
| 71 | 3300005436 | Ga0070713_100045444 | Ga0070713_1000454443 | 302 |
| 72 | 3300005439 | Ga0070711_100068958 | Ga0070711_1000689582 | 302 |
| 73 | 3300005459 | Ga0068867_100029739 | Ga0068867_1000297392 | 302 |
| 74 | 3300005466 | Ga0070685_10132509 | Ga0070685_101325092 | 302 |
| 75 | 3300005535 | Ga0070684_100055447 | Ga0070684_1000554472 | 302 |
| 76 | 3300005577 | Ga0068857_100045709 | Ga0068857_1000457095 | 302 |
| 77 | 3300005718 | Ga0068866_10000007 | Ga0068866_1000000786 | 302 |
| 78 | 3300005841 | Ga0068863_100026684 | Ga0068863_1000266843 | 302 |
| 79 | 3300005842 | Ga0068858_100043131 | Ga0068858_1000431314 | 302 |
| 80 | 3300005843 | Ga0068860_100011273 | Ga0068860_1000112734 | 302 |
| 81 | 3300005985 | Ga0081539_10022350 | Ga0081539_100223502 | 302 |
| 82 | 3300006163 | Ga0070715_10000003 | Ga0070715_10000003317 | 302 |
| 83 | 3300006175 | Ga0070712_100016243 | Ga0070712_1000162436 | 302 |
| 84 | 3300014969 | Ga0157376_10018824 | Ga0157376_100188246 | 302 |
| 85 | 3300025899 | Ga0207642_10000008 | Ga0207642_1000000894 | 302 |
| 86 | 3300025905 | Ga0207685_10000003 | Ga0207685_10000003311 | 302 |
| 87 | 3300025928 | Ga0207700_10000019 | Ga0207700_10000019126 | 302 |
| 88 | 3300025928 | Ga0207700_10036698 | Ga0207700_100366983 | 302 |
| 89 | 3300025929 | Ga0207664_10057860 | Ga0207664_100578603 | 302 |
| 90 | 3300025932 | Ga0207690_10005737 | Ga0207690_100057372 | 302 |
| 91 | 3300025937 | Ga0207669_10000032 | Ga0207669_1000003217 | 302 |
| 92 | 3300025944 | Ga0207661_10002638 | Ga0207661_100026384 | 302 |
| 93 | 3300026089 | Ga0207648_10043310 | Ga0207648_100433102 | 302 |
| 94 | 3300026116 | Ga0207674_10069830 | Ga0207674_100698304 | 302 |
| 95 | 3300026121 | Ga0207683_10072848 | Ga0207683_100728482 | 302 |
| 96 | 3300028381 | Ga0268264_10007756 | Ga0268264_100077567 | 302 |
| 97 | 3300044694 | Ga0466963_0008184 | Ga0466963_0008184_804_1712 | 302 |
| 98 | 3300046454 | Ga0495592_0095525 | Ga0495592_0095525_751_1659 | 302 |
| 99 | 3300046499 | Ga0495594_0000001 | Ga0495594_0000001_83754_84662 | 302 |
| 100 | 3300046515 | Ga0495620_0082089 | Ga0495620_0082089_129_1037 | 302 |
| 101 | 3300046529 | Ga0495652_0000009 | Ga0495652_0000009_182048_182971 | 302 |
| 102 | 3300046533 | Ga0495640_0050712 | Ga0495640_0050712_968_1876 | 302 |
| 103 | 3300046557 | Ga0495622_0000069 | Ga0495622_0000069_86368_87276 | 302 |
| 104 | 3300046689 | Ga0495613_0000324 | Ga0495613_0000324_966_1874 | 302 |
| 105 | 3300046809 | Ga0495600_0001252 | Ga0495600_0001252_1557_2465 | 302 |
| 106 | 3300047317 | Ga0495604_0001593 | Ga0495604_0001593_7151_8059 | 302 |
| 107 | 3300047319 | Ga0495674_0004050 | Ga0495674_0004050_1033_1941 | 302 |
| 108 | 3300047472 | Ga0495686_0008917 | Ga0495686_0008917_1433_2341 | 302 |
| 109 | 3300048088 | Ga0495602_0000038 | Ga0495602_0000038_74049_74957 | 302 |
| 110 | 3300048905 | Ga0496102_0120196 | Ga0496102_0120196_602_1510 | 302 |
| 111 | 3300048906 | Ga0496103_0027757 | Ga0496103_0027757_2296_3204 | 302 |
| 112 | 3300048907 | Ga0496104_0108935 | Ga0496104_0108935_737_1645 | 302 |
| 113 | 3300048908 | Ga0496105_0020070 | Ga0496105_0020070_1239_2147 | 302 |
| 114 | 3300048913 | Ga0496110_0000122 | Ga0496110_0000122_11842_12750 | 302 |
| 115 | 3300048914 | Ga0496111_0000037 | Ga0496111_0000037_31143_32051 | 302 |
| 116 | 3300048918 | Ga0496115_0000005 | Ga0496115_0000005_64516_65436 | 302 |
| 117 | 3300053084 | Ga0495595_0001807 | Ga0495595_0001807_2572_3480 | 302 |
| 118 | 3300001977 | JGI24746J21847_1000556 | JGI24746J21847_10005563 | 303 |
| 119 | 3300002074 | JGI24748J21848_1002016 | JGI24748J21848_10020162 | 303 |
| 120 | 3300002239 | JGI24034J26672_10000147 | JGI24034J26672_1000014712 | 303 |
| 121 | 3300005329 | Ga0070683_100003645 | Ga0070683_10000364513 | 303 |
| 122 | 3300005329 | Ga0070683_100092824 | Ga0070683_1000928242 | 303 |
| 123 | 3300005329 | Ga0070683_100275108 | Ga0070683_1002751082 | 303 |
| 124 | 3300005333 | Ga0070677_10000020 | Ga0070677_100000205 | 303 |
| 125 | 3300005337 | Ga0070682_100000009 | Ga0070682_100000009229 | 303 |
| 126 | 3300005337 | Ga0070682_100000032 | Ga0070682_10000003297 | 303 |
| 127 | 3300005337 | Ga0070682_100242916 | Ga0070682_1002429162 | 303 |
| 128 | 3300005338 | Ga0068868_100061700 | Ga0068868_1000617002 | 303 |
| 129 | 3300005338 | Ga0068868_100070495 | Ga0068868_1000704953 | 303 |
| 130 | 3300005341 | Ga0070691_10000003 | Ga0070691_1000000344 | 303 |
| 131 | 3300005341 | Ga0070691_10000348 | Ga0070691_100003484 | 303 |
| 132 | 3300005344 | Ga0070661_100000032 | Ga0070661_10000003234 | 303 |
| 133 | 3300005345 | Ga0070692_10018423 | Ga0070692_100184232 | 303 |
| 134 | 3300005347 | Ga0070668_100041672 | Ga0070668_1000416723 | 303 |
| 135 | 3300005354 | Ga0070675_100000022 | Ga0070675_10000002237 | 303 |
| 136 | 3300005356 | Ga0070674_100000075 | Ga0070674_10000007514 | 303 |
| 137 | 3300005364 | Ga0070673_100008528 | Ga0070673_1000085284 | 303 |
| 138 | 3300005365 | Ga0070688_100000031 | Ga0070688_10000003155 | 303 |
| 139 | 3300005365 | Ga0070688_100000194 | Ga0070688_1000001948 | 303 |
| 140 | 3300005366 | Ga0070659_100101582 | Ga0070659_1001015822 | 303 |
| 141 | 3300005367 | Ga0070667_100015838 | Ga0070667_1000158387 | 303 |
| 142 | 3300005435 | Ga0070714_100074920 | Ga0070714_1000749204 | 303 |
| 143 | 3300005437 | Ga0070710_10081672 | Ga0070710_100816722 | 303 |
| 144 | 3300005439 | Ga0070711_100028366 | Ga0070711_1000283666 | 303 |
| 145 | 3300005441 | Ga0070700_100083667 | Ga0070700_1000836672 | 303 |
| 146 | 3300005441 | Ga0070700_100099506 | Ga0070700_1000995061 | 303 |
| 147 | 3300005455 | Ga0070663_100033780 | Ga0070663_1000337802 | 303 |
| 148 | 3300005455 | Ga0070663_100282127 | Ga0070663_1002821272 | 303 |
| 149 | 3300005456 | Ga0070678_100011255 | Ga0070678_1000112556 | 303 |
| 150 | 3300005457 | Ga0070662_100000052 | Ga0070662_10000005252 | 303 |
| 151 | 3300005458 | Ga0070681_10010128 | Ga0070681_100101282 | 303 |
| 152 | 3300005458 | Ga0070681_10056853 | Ga0070681_100568532 | 303 |
| 153 | 3300005466 | Ga0070685_10000058 | Ga0070685_1000005840 | 303 |
| 154 | 3300005466 | Ga0070685_10000263 | Ga0070685_1000026318 | 303 |
| 155 | 3300005530 | Ga0070679_100000134 | Ga0070679_10000013469 | 303 |
| 156 | 3300005530 | Ga0070679_100019644 | Ga0070679_1000196446 | 303 |
| 157 | 3300005535 | Ga0070684_100039278 | Ga0070684_1000392783 | 303 |
| 158 | 3300005535 | Ga0070684_100080217 | Ga0070684_1000802172 | 303 |
| 159 | 3300005535 | Ga0070684_100084428 | Ga0070684_1000844282 | 303 |
| 160 | 3300005535 | Ga0070684_100099400 | Ga0070684_1000994002 | 303 |
| 161 | 3300005535 | Ga0070684_100521935 | Ga0070684_1005219351 | 303 |
| 162 | 3300005539 | Ga0068853_100015477 | Ga0068853_1000154774 | 303 |
| 163 | 3300005543 | Ga0070672_100000258 | Ga0070672_10000025812 | 303 |
| 164 | 3300005545 | Ga0070695_100203244 | Ga0070695_1002032442 | 303 |
| 165 | 3300005547 | Ga0070693_100003269 | Ga0070693_1000032694 | 303 |
| 166 | 3300005548 | Ga0070665_100000022 | Ga0070665_100000022332 | 303 |
| 167 | 3300005548 | Ga0070665_100001623 | Ga0070665_10000162312 | 303 |
| 168 | 3300005549 | Ga0070704_100091354 | Ga0070704_1000913542 | 303 |
| 169 | 3300005578 | Ga0068854_100000133 | Ga0068854_10000013345 | 303 |
| 170 | 3300005578 | Ga0068854_100023995 | Ga0068854_1000239955 | 303 |
| 171 | 3300005614 | Ga0068856_100000369 | Ga0068856_1000003692 | 303 |
| 172 | 3300005614 | Ga0068856_100008918 | Ga0068856_1000089183 | 303 |
| 173 | 3300005615 | Ga0070702_100112910 | Ga0070702_1001129102 | 303 |
| 174 | 3300005616 | Ga0068852_100000024 | Ga0068852_10000002458 | 303 |
| 175 | 3300005618 | Ga0068864_100000023 | Ga0068864_100000023147 | 303 |
| 176 | 3300005718 | Ga0068866_10000469 | Ga0068866_1000046916 | 303 |
| 177 | 3300005834 | Ga0068851_10000895 | Ga0068851_1000089510 | 303 |
| 178 | 3300005834 | Ga0068851_10004054 | Ga0068851_100040542 | 303 |
| 179 | 3300005841 | Ga0068863_100000110 | Ga0068863_10000011093 | 303 |
| 180 | 3300005841 | Ga0068863_100393201 | Ga0068863_1003932012 | 303 |
| 181 | 3300005842 | Ga0068858_100000150 | Ga0068858_10000015085 | 303 |
| 182 | 3300005842 | Ga0068858_100000329 | Ga0068858_10000032942 | 303 |
| 183 | 3300005937 | Ga0081455_10041806 | Ga0081455_100418062 | 303 |
| 184 | 3300005985 | Ga0081539_10001052 | Ga0081539_1000105224 | 303 |
| 185 | 3300006163 | Ga0070715_10145985 | Ga0070715_101459851 | 303 |
| 186 | 3300006173 | Ga0070716_100132062 | Ga0070716_1001320621 | 303 |
| 187 | 3300006237 | Ga0097621_100581550 | Ga0097621_1005815501 | 303 |
| 188 | 3300006846 | Ga0075430_100048532 | Ga0075430_1000485322 | 303 |
| 189 | 3300006852 | Ga0075433_10002915 | Ga0075433_100029159 | 303 |
| 190 | 3300006852 | Ga0075433_10003283 | Ga0075433_1000328313 | 303 |
| 191 | 3300006881 | Ga0068865_100000024 | Ga0068865_10000002447 | 303 |
| 192 | 3300009098 | Ga0105245_10000022 | Ga0105245_10000022117 | 303 |
| 193 | 3300009098 | Ga0105245_10001178 | Ga0105245_1000117825 | 303 |
| 194 | 3300009098 | Ga0105245_10008000 | Ga0105245_100080007 | 303 |
| 195 | 3300009101 | Ga0105247_10000064 | Ga0105247_1000006454 | 303 |
| 196 | 3300009101 | Ga0105247_10072683 | Ga0105247_100726832 | 303 |
| 197 | 3300009148 | Ga0105243_10012040 | Ga0105243_100120405 | 303 |
| 198 | 3300009176 | Ga0105242_10000123 | Ga0105242_1000012371 | 303 |
| 199 | 3300009176 | Ga0105242_10013245 | Ga0105242_100132451 | 303 |
| 200 | 3300009176 | Ga0105242_10064933 | Ga0105242_100649331 | 303 |
| 201 | 3300009177 | Ga0105248_10000017 | Ga0105248_1000001741 | 303 |
| 202 | 3300009551 | Ga0105238_10000016 | Ga0105238_100000169 | 303 |
| 203 | 3300009553 | Ga0105249_10000181 | Ga0105249_1000018123 | 303 |
| 204 | 3300010375 | Ga0105239_10288660 | Ga0105239_102886602 | 303 |
| 205 | 3300011119 | Ga0105246_10306240 | Ga0105246_103062402 | 303 |
| 206 | 3300013102 | Ga0157371_10001783 | Ga0157371_100017836 | 303 |
| 207 | 3300013104 | Ga0157370_10049032 | Ga0157370_100490323 | 303 |
| 208 | 3300013105 | Ga0157369_10000068 | Ga0157369_1000006884 | 303 |
| 209 | 3300013296 | Ga0157374_10700813 | Ga0157374_107008131 | 303 |
| 210 | 3300013297 | Ga0157378_10000656 | Ga0157378_1000065632 | 303 |
| 211 | 3300013297 | Ga0157378_10087628 | Ga0157378_100876282 | 303 |
| 212 | 3300013308 | Ga0157375_10000126 | Ga0157375_1000012677 | 303 |
| 213 | 3300014325 | Ga0163163_10438413 | Ga0163163_104384132 | 303 |
| 214 | 3300014326 | Ga0157380_10104533 | Ga0157380_101045332 | 303 |
| 215 | 3300014745 | Ga0157377_10077334 | Ga0157377_100773341 | 303 |
| 216 | 3300014968 | Ga0157379_10031333 | Ga0157379_100313332 | 303 |
| 217 | 3300014968 | Ga0157379_10088250 | Ga0157379_100882503 | 303 |
| 218 | 3300014969 | Ga0157376_10093379 | Ga0157376_100933792 | 303 |
| 219 | 3300017792 | Ga0163161_10000013 | Ga0163161_10000013108 | 303 |
| 220 | 3300017792 | Ga0163161_10052079 | Ga0163161_100520792 | 303 |
| 221 | 3300025321 | Ga0207656_10000274 | Ga0207656_100002746 | 303 |
| 222 | 3300025321 | Ga0207656_10004135 | Ga0207656_100041354 | 303 |
| 223 | 3300025893 | Ga0207682_10000050 | Ga0207682_1000005043 | 303 |
| 224 | 3300025899 | Ga0207642_10000181 | Ga0207642_1000018115 | 303 |
| 225 | 3300025900 | Ga0207710_10000165 | Ga0207710_1000016540 | 303 |
| 226 | 3300025903 | Ga0207680_10011411 | Ga0207680_100114113 | 303 |
| 227 | 3300025903 | Ga0207680_10126296 | Ga0207680_101262962 | 303 |
| 228 | 3300025909 | Ga0207705_10100545 | Ga0207705_101005452 | 303 |
| 229 | 3300025912 | Ga0207707_10035644 | Ga0207707_100356445 | 303 |
| 230 | 3300025912 | Ga0207707_10036138 | Ga0207707_100361384 | 303 |
| 231 | 3300025916 | Ga0207663_10066167 | Ga0207663_100661672 | 303 |
| 232 | 3300025920 | Ga0207649_10000015 | Ga0207649_100000152 | 303 |
| 233 | 3300025921 | Ga0207652_10001289 | Ga0207652_100012893 | 303 |
| 234 | 3300025921 | Ga0207652_10003408 | Ga0207652_1000340811 | 303 |
| 235 | 3300025924 | Ga0207694_10000012 | Ga0207694_10000012412 | 303 |
| 236 | 3300025926 | Ga0207659_10000030 | Ga0207659_1000003099 | 303 |
| 237 | 3300025927 | Ga0207687_10000025 | Ga0207687_1000002579 | 303 |
| 238 | 3300025927 | Ga0207687_10000039 | Ga0207687_10000039116 | 303 |
| 239 | 3300025927 | Ga0207687_10006005 | Ga0207687_100060054 | 303 |
| 240 | 3300025927 | Ga0207687_10007709 | Ga0207687_100077093 | 303 |
| 241 | 3300025929 | Ga0207664_10009739 | Ga0207664_100097392 | 303 |
| 242 | 3300025932 | Ga0207690_10015961 | Ga0207690_100159614 | 303 |
| 243 | 3300025933 | Ga0207706_10000137 | Ga0207706_1000013731 | 303 |
| 244 | 3300025934 | Ga0207686_10000066 | Ga0207686_1000006635 | 303 |
| 245 | 3300025934 | Ga0207686_10000592 | Ga0207686_1000059214 | 303 |
| 246 | 3300025934 | Ga0207686_10050440 | Ga0207686_100504401 | 303 |
| 247 | 3300025934 | Ga0207686_10105615 | Ga0207686_101056152 | 303 |
| 248 | 3300025935 | Ga0207709_10014890 | Ga0207709_100148902 | 303 |
| 249 | 3300025937 | Ga0207669_10000091 | Ga0207669_1000009141 | 303 |
| 250 | 3300025937 | Ga0207669_10299513 | Ga0207669_102995132 | 303 |
| 251 | 3300025938 | Ga0207704_10000054 | Ga0207704_1000005434 | 303 |
| 252 | 3300025939 | Ga0207665_10131145 | Ga0207665_101311451 | 303 |
| 253 | 3300025940 | Ga0207691_10000871 | Ga0207691_1000087110 | 303 |
| 254 | 3300025941 | Ga0207711_10000011 | Ga0207711_1000001188 | 303 |
| 255 | 3300025944 | Ga0207661_10004497 | Ga0207661_1000449713 | 303 |
| 256 | 3300025944 | Ga0207661_10053194 | Ga0207661_100531945 | 303 |
| 257 | 3300025944 | Ga0207661_10470190 | Ga0207661_104701901 | 303 |
| 258 | 3300025960 | Ga0207651_10021515 | Ga0207651_100215155 | 303 |
| 259 | 3300025961 | Ga0207712_10000067 | Ga0207712_10000067123 | 303 |
| 260 | 3300025972 | Ga0207668_10072576 | Ga0207668_100725762 | 303 |
| 261 | 3300025981 | Ga0207640_10000147 | Ga0207640_1000014744 | 303 |
| 262 | 3300025981 | Ga0207640_10053916 | Ga0207640_100539162 | 303 |
| 263 | 3300025986 | Ga0207658_10130823 | Ga0207658_101308232 | 303 |
| 264 | 3300026023 | Ga0207677_10043277 | Ga0207677_100432772 | 303 |
| 265 | 3300026023 | Ga0207677_10066262 | Ga0207677_100662621 | 303 |
| 266 | 3300026035 | Ga0207703_10000070 | Ga0207703_1000007090 | 303 |
| 267 | 3300026035 | Ga0207703_10000122 | Ga0207703_1000012229 | 303 |
| 268 | 3300026067 | Ga0207678_10019235 | Ga0207678_100192356 | 303 |
| 269 | 3300026075 | Ga0207708_10061704 | Ga0207708_100617042 | 303 |
| 270 | 3300026078 | Ga0207702_10000326 | Ga0207702_1000032651 | 303 |
| 271 | 3300026078 | Ga0207702_10000557 | Ga0207702_1000055742 | 303 |
| 272 | 3300026078 | Ga0207702_10012405 | Ga0207702_100124052 | 303 |
| 273 | 3300026078 | Ga0207702_10232381 | Ga0207702_102323812 | 303 |
| 274 | 3300026088 | Ga0207641_10000065 | Ga0207641_10000065162 | 303 |
| 275 | 3300026088 | Ga0207641_10019506 | Ga0207641_100195065 | 303 |
| 276 | 3300026095 | Ga0207676_10000025 | Ga0207676_10000025131 | 303 |
| 277 | 3300026118 | Ga0207675_100581400 | Ga0207675_1005814002 | 303 |
| 278 | 3300026121 | Ga0207683_10020523 | Ga0207683_100205236 | 303 |
| 279 | 3300026142 | Ga0207698_10000014 | Ga0207698_10000014114 | 303 |
| 280 | 3300028379 | Ga0268266_10000029 | Ga0268266_10000029122 | 303 |
| 281 | 3300028379 | Ga0268266_10000422 | Ga0268266_1000042261 | 303 |
| 282 | 3300028379 | Ga0268266_10000973 | Ga0268266_100009735 | 303 |
| 283 | 3300028379 | Ga0268266_10111563 | Ga0268266_101115633 | 303 |
| 284 | 3300028556 | Ga0265337_1000730 | Ga0265337_100073013 | 303 |
| 285 | 3300028558 | Ga0265326_10000040 | Ga0265326_1000004090 | 303 |
| 286 | 3300028654 | Ga0265322_10000012 | Ga0265322_10000012113 | 303 |
| 287 | 3300028800 | Ga0265338_10000156 | Ga0265338_10000156101 | 303 |
| 288 | 3300029957 | Ga0265324_10000567 | Ga0265324_1000056720 | 303 |
| 289 | 3300031239 | Ga0265328_10008624 | Ga0265328_100086244 | 303 |
| 290 | 3300031240 | Ga0265320_10000001 | Ga0265320_10000001811 | 303 |
| 291 | 3300031242 | Ga0265329_10007672 | Ga0265329_100076723 | 303 |
| 292 | 3300031249 | Ga0265339_10021395 | Ga0265339_100213952 | 303 |
| 293 | 3300031250 | Ga0265331_10031968 | Ga0265331_100319683 | 303 |
| 294 | 3300031251 | Ga0265327_10000003 | Ga0265327_10000003811 | 303 |
| 295 | 3300031344 | Ga0265316_10023963 | Ga0265316_100239636 | 303 |
| 296 | 3300031711 | Ga0265314_10000334 | Ga0265314_1000033450 | 303 |
| 297 | 3300036401 | Ga0373937_0033886 | Ga0373937_0033886_130_1041 | 303 |
| 298 | 3300041491 | Ga0451833_0445893 | Ga0451833_0445893_428_1339 | 303 |
| 299 | 3300041512 | Ga0451853_1358421 | Ga0451853_1358421_1171_2154 | 303 |
| 300 | 3300044694 | Ga0466963_0000257 | Ga0466963_0000257_18095_19006 | 303 |
| 301 | 3300044694 | Ga0466963_0130248 | Ga0466963_0130248_661_1572 | 303 |
| 302 | 3300044842 | Ga0466957_0000193 | Ga0466957_0000193_2987_3898 | 303 |
| 303 | 3300044842 | Ga0466957_0173007 | Ga0466957_0173007_23_934 | 303 |
| 304 | 3300045976 | Ga0466967_0207368 | Ga0466967_0207368_509_1423 | 303 |
| 305 | 3300046454 | Ga0495592_0000424 | Ga0495592_0000424_18881_19792 | 303 |
| 306 | 3300046455 | Ga0495603_0000083 | Ga0495603_0000083_7963_8874 | 303 |
| 307 | 3300046455 | Ga0495603_0004890 | Ga0495603_0004890_3962_4873 | 303 |
| 308 | 3300046459 | Ga0495629_0001145 | Ga0495629_0001145_18300_19223 | 303 |
| 309 | 3300046459 | Ga0495629_0005665 | Ga0495629_0005665_7820_8743 | 303 |
| 310 | 3300046459 | Ga0495629_0050304 | Ga0495629_0050304_1609_2520 | 303 |
| 311 | 3300046459 | Ga0495629_0190161 | Ga0495629_0190161_61_972 | 303 |
| 312 | 3300046461 | Ga0495641_0000010 | Ga0495641_0000010_45436_46347 | 303 |
| 313 | 3300046462 | Ga0495651_0073968 | Ga0495651_0073968_1145_2056 | 303 |
| 314 | 3300046463 | Ga0495653_0006069 | Ga0495653_0006069_7768_8679 | 303 |
| 315 | 3300046463 | Ga0495653_0079686 | Ga0495653_0079686_153_1076 | 303 |
| 316 | 3300046473 | Ga0495582_0000006 | Ga0495582_0000006_85833_86744 | 303 |
| 317 | 3300046476 | Ga0495662_0000178 | Ga0495662_0000178_13706_14617 | 303 |
| 318 | 3300046507 | Ga0495606_0000283 | Ga0495606_0000283_10069_10980 | 303 |
| 319 | 3300046511 | Ga0495608_0000042 | Ga0495608_0000042_22789_23763 | 303 |
| 320 | 3300046511 | Ga0495608_0003416 | Ga0495608_0003416_1479_2390 | 303 |
| 321 | 3300046511 | Ga0495608_0007777 | Ga0495608_0007777_6022_6933 | 303 |
| 322 | 3300046514 | Ga0495618_0000037 | Ga0495618_0000037_80662_81573 | 303 |
| 323 | 3300046515 | Ga0495620_0000731 | Ga0495620_0000731_3265_4248 | 303 |
| 324 | 3300046516 | Ga0495628_0000265 | Ga0495628_0000265_23094_24005 | 303 |
| 325 | 3300046516 | Ga0495628_0082001 | Ga0495628_0082001_968_1879 | 303 |
| 326 | 3300046516 | Ga0495628_0140673 | Ga0495628_0140673_323_1306 | 303 |
| 327 | 3300046516 | Ga0495628_0159635 | Ga0495628_0159635_633_1544 | 303 |
| 328 | 3300046517 | Ga0495630_0000148 | Ga0495630_0000148_3509_4420 | 303 |
| 329 | 3300046517 | Ga0495630_0000586 | Ga0495630_0000586_11613_12524 | 303 |
| 330 | 3300046529 | Ga0495652_0039820 | Ga0495652_0039820_1876_2787 | 303 |
| 331 | 3300046533 | Ga0495640_0003678 | Ga0495640_0003678_8178_9089 | 303 |
| 332 | 3300046535 | Ga0495586_0008020 | Ga0495586_0008020_3527_4438 | 303 |
| 333 | 3300046535 | Ga0495586_0167990 | Ga0495586_0167990_90_1001 | 303 |
| 334 | 3300046536 | Ga0495587_0002629 | Ga0495587_0002629_9913_10824 | 303 |
| 335 | 3300046536 | Ga0495587_0015546 | Ga0495587_0015546_2134_3045 | 303 |
| 336 | 3300046537 | Ga0495598_0001441 | Ga0495598_0001441_1860_2771 | 303 |
| 337 | 3300046539 | Ga0495621_0005233 | Ga0495621_0005233_1923_2834 | 303 |
| 338 | 3300046543 | Ga0495645_0016069 | Ga0495645_0016069_1090_2001 | 303 |
| 339 | 3300046543 | Ga0495645_0080076 | Ga0495645_0080076_489_1400 | 303 |
| 340 | 3300046559 | Ga0495667_0000109 | Ga0495667_0000109_15826_16749 | 303 |
| 341 | 3300046615 | Ga0495656_0003522 | Ga0495656_0003522_1200_2111 | 303 |
| 342 | 3300046642 | Ga0495634_0000021 | Ga0495634_0000021_51078_51989 | 303 |
| 343 | 3300046642 | Ga0495634_0000951 | Ga0495634_0000951_17396_18307 | 303 |
| 344 | 3300046642 | Ga0495634_0142664 | Ga0495634_0142664_217_1128 | 303 |
| 345 | 3300046660 | Ga0495625_0000109 | Ga0495625_0000109_29830_30741 | 303 |
| 346 | 3300046663 | Ga0495635_0000006 | Ga0495635_0000006_24714_25625 | 303 |
| 347 | 3300046663 | Ga0495635_0038592 | Ga0495635_0038592_1955_2866 | 303 |
| 348 | 3300046663 | Ga0495635_0081100 | Ga0495635_0081100_245_1156 | 303 |
| 349 | 3300046674 | Ga0495588_0098562 | Ga0495588_0098562_588_1499 | 303 |
| 350 | 3300046675 | Ga0495657_0000040 | Ga0495657_0000040_22789_23763 | 303 |
| 351 | 3300046679 | Ga0495623_0091266 | Ga0495623_0091266_504_1415 | 303 |
| 352 | 3300046681 | Ga0495647_0002786 | Ga0495647_0002786_917_1828 | 303 |
| 353 | 3300046681 | Ga0495647_0034003 | Ga0495647_0034003_512_1423 | 303 |
| 354 | 3300046683 | Ga0495658_0000027 | Ga0495658_0000027_53691_54602 | 303 |
| 355 | 3300046684 | Ga0495669_0000132 | Ga0495669_0000132_22892_23803 | 303 |
| 356 | 3300046689 | Ga0495613_0000190 | Ga0495613_0000190_18779_19690 | 303 |
| 357 | 3300046690 | Ga0495624_0000005 | Ga0495624_0000005_44580_45491 | 303 |
| 358 | 3300046690 | Ga0495624_0000031 | Ga0495624_0000031_2798_3709 | 303 |
| 359 | 3300046690 | Ga0495624_0037983 | Ga0495624_0037983_1279_2190 | 303 |
| 360 | 3300046691 | Ga0495670_0041667 | Ga0495670_0041667_914_1825 | 303 |
| 361 | 3300046694 | Ga0495649_0040054 | Ga0495649_0040054_731_1642 | 303 |
| 362 | 3300046809 | Ga0495600_0023088 | Ga0495600_0023088_1727_2638 | 303 |
| 363 | 3300047317 | Ga0495604_0000636 | Ga0495604_0000636_8993_9904 | 303 |
| 364 | 3300047320 | Ga0495672_0142528 | Ga0495672_0142528_227_1138 | 303 |
| 365 | 3300047321 | Ga0495676_0000209 | Ga0495676_0000209_7914_8825 | 303 |
| 366 | 3300047321 | Ga0495676_0000624 | Ga0495676_0000624_13989_14912 | 303 |
| 367 | 3300047321 | Ga0495676_0002889 | Ga0495676_0002889_8456_9367 | 303 |
| 368 | 3300047322 | Ga0495680_0000094 | Ga0495680_0000094_69711_70622 | 303 |
| 369 | 3300047322 | Ga0495680_0000332 | Ga0495680_0000332_51225_52136 | 303 |
| 370 | 3300047322 | Ga0495680_0010267 | Ga0495680_0010267_984_1907 | 303 |
| 371 | 3300047322 | Ga0495680_0124091 | Ga0495680_0124091_441_1352 | 303 |
| 372 | 3300047444 | Ga0495675_0000051 | Ga0495675_0000051_22761_23735 | 303 |
| 373 | 3300047446 | Ga0495679_044460 | Ga0495679_044460_408_1319 | 303 |
| 374 | 3300047447 | Ga0495685_042063 | Ga0495685_042063_255_1166 | 303 |
| 375 | 3300047673 | Ga0495593_0058369 | Ga0495593_0058369_112_1023 | 303 |
| 376 | 3300048088 | Ga0495602_0002031 | Ga0495602_0002031_18503_19414 | 303 |
| 377 | 3300048088 | Ga0495602_0133551 | Ga0495602_0133551_74_985 | 303 |
| 378 | 3300048088 | Ga0495602_0221192 | Ga0495602_0221192_158_1069 | 303 |
| 379 | 3300048903 | Ga0496100_0000006 | Ga0496100_0000006_252942_253853 | 303 |
| 380 | 3300048903 | Ga0496100_0000028 | Ga0496100_0000028_51213_52136 | 303 |
| 381 | 3300048904 | Ga0496101_0000005 | Ga0496101_0000005_201212_202135 | 303 |
| 382 | 3300048904 | Ga0496101_0000009 | Ga0496101_0000009_252942_253853 | 303 |
| 383 | 3300048905 | Ga0496102_0000021 | Ga0496102_0000021_126384_127307 | 303 |
| 384 | 3300048905 | Ga0496102_0031863 | Ga0496102_0031863_3064_3975 | 303 |
| 385 | 3300048906 | Ga0496103_0000001 | Ga0496103_0000001_468600_469523 | 303 |
| 386 | 3300048906 | Ga0496103_0023273 | Ga0496103_0023273_2568_3479 | 303 |
| 387 | 3300048906 | Ga0496103_0056705 | Ga0496103_0056705_1046_1957 | 303 |
| 388 | 3300048907 | Ga0496104_0000008 | Ga0496104_0000008_433619_434530 | 303 |
| 389 | 3300048907 | Ga0496104_0000029 | Ga0496104_0000029_143576_144487 | 303 |
| 390 | 3300048908 | Ga0496105_0000002 | Ga0496105_0000002_143576_144487 | 303 |
| 391 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_433619_434530 | 303 |
| 392 | 3300048908 | Ga0496105_0000876 | Ga0496105_0000876_18034_18957 | 303 |
| 393 | 3300048908 | Ga0496105_0048057 | Ga0496105_0048057_1532_2443 | 303 |
| 394 | 3300048909 | Ga0496106_0000070 | Ga0496106_0000070_20109_21032 | 303 |
| 395 | 3300048909 | Ga0496106_0000090 | Ga0496106_0000090_51390_52301 | 303 |
| 396 | 3300048909 | Ga0496106_0000101 | Ga0496106_0000101_22844_23755 | 303 |
| 397 | 3300048910 | Ga0496107_0000004 | Ga0496107_0000004_201429_202352 | 303 |
| 398 | 3300048910 | Ga0496107_0000015 | Ga0496107_0000015_149170_150081 | 303 |
| 399 | 3300048910 | Ga0496107_0035771 | Ga0496107_0035771_474_1385 | 303 |
| 400 | 3300048910 | Ga0496107_0173708 | Ga0496107_0173708_267_1178 | 303 |
| 401 | 3300048911 | Ga0496108_0000004 | Ga0496108_0000004_133714_134625 | 303 |
| 402 | 3300048911 | Ga0496108_0000042 | Ga0496108_0000042_63839_64750 | 303 |
| 403 | 3300048911 | Ga0496108_0005504 | Ga0496108_0005504_1718_2629 | 303 |
| 404 | 3300048911 | Ga0496108_0038231 | Ga0496108_0038231_1400_2311 | 303 |
| 405 | 3300048912 | Ga0496109_0000034 | Ga0496109_0000034_96478_97389 | 303 |
| 406 | 3300048912 | Ga0496109_0000036 | Ga0496109_0000036_19349_20260 | 303 |
| 407 | 3300048912 | Ga0496109_0000391 | Ga0496109_0000391_5625_6536 | 303 |
| 408 | 3300048912 | Ga0496109_0010089 | Ga0496109_0010089_125_1036 | 303 |
| 409 | 3300048912 | Ga0496109_0252459 | Ga0496109_0252459_588_1499 | 303 |
| 410 | 3300048913 | Ga0496110_0007589 | Ga0496110_0007589_4012_4923 | 303 |
| 411 | 3300048913 | Ga0496110_0025709 | Ga0496110_0025709_575_1486 | 303 |
| 412 | 3300048913 | Ga0496110_0059015 | Ga0496110_0059015_1441_2364 | 303 |
| 413 | 3300048914 | Ga0496111_0224791 | Ga0496111_0224791_464_1375 | 303 |
| 414 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_153513_154424 | 303 |
| 415 | 3300048915 | Ga0496112_0010244 | Ga0496112_0010244_3440_4399 | 303 |
| 416 | 3300048916 | Ga0496113_0000002 | Ga0496113_0000002_90275_91234 | 303 |
| 417 | 3300048916 | Ga0496113_0018796 | Ga0496113_0018796_2971_3882 | 303 |
| 418 | 3300048916 | Ga0496113_0030978 | Ga0496113_0030978_533_1444 | 303 |
| 419 | 3300048916 | Ga0496113_0164654 | Ga0496113_0164654_385_1296 | 303 |
| 420 | 3300048917 | Ga0496114_0000159 | Ga0496114_0000159_32348_33259 | 303 |
| 421 | 3300048917 | Ga0496114_0005005 | Ga0496114_0005005_7027_7938 | 303 |
| 422 | 3300048917 | Ga0496114_0131161 | Ga0496114_0131161_1073_1984 | 303 |
| 423 | 3300048917 | Ga0496114_0272529 | Ga0496114_0272529_109_1020 | 303 |
| 424 | 3300048918 | Ga0496115_0000257 | Ga0496115_0000257_32348_33259 | 303 |
| 425 | 3300048919 | Ga0496116_0000138 | Ga0496116_0000138_109459_110370 | 303 |
| 426 | 3300048921 | Ga0496118_0001277 | Ga0496118_0001277_6705_7616 | 303 |
| 427 | 3300048921 | Ga0496118_0035997 | Ga0496118_0035997_2319_3230 | 303 |
| 428 | 3300048921 | Ga0496118_0149978 | Ga0496118_0149978_62_973 | 303 |
| 429 | 3300048922 | Ga0496119_0003660 | Ga0496119_0003660_2244_3155 | 303 |
| 430 | 3300048922 | Ga0496119_0021239 | Ga0496119_0021239_2331_3242 | 303 |
| 431 | 3300048922 | Ga0496119_0164991 | Ga0496119_0164991_168_1091 | 303 |
| 432 | 3300048923 | Ga0496120_0002330 | Ga0496120_0002330_12695_13606 | 303 |
| 433 | 3300048924 | Ga0496121_0006772 | Ga0496121_0006772_1420_2331 | 303 |
| 434 | 3300048924 | Ga0496121_0095795 | Ga0496121_0095795_1317_2228 | 303 |
| 435 | 3300048928 | Ga0496125_0028985 | Ga0496125_0028985_972_1883 | 303 |
| 436 | 3300048928 | Ga0496125_0074977 | Ga0496125_0074977_1188_2099 | 303 |
| 437 | 3300048929 | Ga0496126_0007436 | Ga0496126_0007436_7883_8794 | 303 |
| 438 | 3300048929 | Ga0496126_0045157 | Ga0496126_0045157_1670_2581 | 303 |
| 439 | 3300048929 | Ga0496126_0182320 | Ga0496126_0182320_523_1434 | 303 |
| 440 | 3300049568 | Ga0501031_0003336 | Ga0501031_0003336_5078_5989 | 303 |
| 441 | 3300049569 | Ga0501032_0009040 | Ga0501032_0009040_1080_1991 | 303 |
| 442 | 3300049570 | Ga0501033_0005116 | Ga0501033_0005116_4250_5161 | 303 |
| 443 | 3300049571 | Ga0501034_0022387 | Ga0501034_0022387_4164_5075 | 303 |
| 444 | 3300049571 | Ga0501034_0204127 | Ga0501034_0204127_128_1039 | 303 |
| 445 | 3300049572 | Ga0501036_0073446 | Ga0501036_0073446_870_1781 | 303 |
| 446 | 3300049573 | Ga0501037_0009327 | Ga0501037_0009327_789_1700 | 303 |
| 447 | 3300049574 | Ga0501038_0014268 | Ga0501038_0014268_5235_6146 | 303 |
| 448 | 3300049575 | Ga0501039_0045896 | Ga0501039_0045896_958_1869 | 303 |
| 449 | 3300049575 | Ga0501039_0089346 | Ga0501039_0089346_609_1523 | 303 |
| 450 | 3300049576 | Ga0501040_0017812 | Ga0501040_0017812_857_1768 | 303 |
| 451 | 3300049578 | Ga0501042_0024380 | Ga0501042_0024380_907_1818 | 303 |
| 452 | 3300049578 | Ga0501042_0044650 | Ga0501042_0044650_2001_2912 | 303 |
| 453 | 3300049578 | Ga0501042_0056709 | Ga0501042_0056709_1181_2104 | 303 |
| 454 | 3300049579 | Ga0501043_0001141 | Ga0501043_0001141_815_1726 | 303 |
| 455 | 3300049579 | Ga0501043_0217466 | Ga0501043_0217466_101_1012 | 303 |
| 456 | 3300049580 | Ga0501046_0009482 | Ga0501046_0009482_5056_5967 | 303 |
| 457 | 3300049581 | Ga0501047_0003662 | Ga0501047_0003662_12266_13177 | 303 |
| 458 | 3300049581 | Ga0501047_0077493 | Ga0501047_0077493_1364_2275 | 303 |
| 459 | 3300049581 | Ga0501047_0153051 | Ga0501047_0153051_929_1840 | 303 |
| 460 | 3300049581 | Ga0501047_0249364 | Ga0501047_0249364_291_1202 | 303 |
| 461 | 3300049582 | Ga0501048_0009669 | Ga0501048_0009669_5276_6187 | 303 |
| 462 | 3300049583 | Ga0501067_0034805 | Ga0501067_0034805_558_1469 | 303 |
| 463 | 3300049584 | Ga0501068_0032152 | Ga0501068_0032152_1619_2530 | 303 |
| 464 | 3300049584 | Ga0501068_0033339 | Ga0501068_0033339_1329_2252 | 303 |
| 465 | 3300049585 | Ga0501069_0002690 | Ga0501069_0002690_7915_8826 | 303 |
| 466 | 3300049585 | Ga0501069_0024220 | Ga0501069_0024220_1369_2280 | 303 |
| 467 | 3300049586 | Ga0501070_0005806 | Ga0501070_0005806_4359_5270 | 303 |
| 468 | 3300049587 | Ga0501071_0051249 | Ga0501071_0051249_1543_2454 | 303 |
| 469 | 3300049588 | Ga0501072_0045489 | Ga0501072_0045489_1688_2602 | 303 |
| 470 | 3300049589 | Ga0501073_0040030 | Ga0501073_0040030_1244_2155 | 303 |
| 471 | 3300049590 | Ga0501074_0008960 | Ga0501074_0008960_5196_6107 | 303 |
| 472 | 3300049591 | Ga0501075_0004446 | Ga0501075_0004446_5451_6362 | 303 |
| 473 | 3300049741 | Ga0501079_0010469 | Ga0501079_0010469_5255_6166 | 303 |
| 474 | 3300049742 | Ga0501080_0059103 | Ga0501080_0059103_1591_2502 | 303 |
| 475 | 3300049742 | Ga0501080_0246741 | Ga0501080_0246741_264_1175 | 303 |
| 476 | 3300049742 | Ga0501080_0343279 | Ga0501080_0343279_89_1000 | 303 |
| 477 | 3300049743 | Ga0501081_0059098 | Ga0501081_0059098_946_1857 | 303 |
| 478 | 3300049743 | Ga0501081_0160128 | Ga0501081_0160128_489_1403 | 303 |
| 479 | 3300049744 | Ga0501083_0021607 | Ga0501083_0021607_1053_1964 | 303 |
| 480 | 3300049744 | Ga0501083_0023580 | Ga0501083_0023580_1108_2019 | 303 |
| 481 | 3300049822 | Ga0501035_0007460 | Ga0501035_0007460_4197_5108 | 303 |
| 482 | 3300049823 | Ga0501044_0007015 | Ga0501044_0007015_7111_8022 | 303 |
| 483 | 3300049823 | Ga0501044_0203844 | Ga0501044_0203844_918_1829 | 303 |
| 484 | 3300049823 | Ga0501044_0283305 | Ga0501044_0283305_156_1067 | 303 |
| 485 | 3300049824 | Ga0501045_0049109 | Ga0501045_0049109_1784_2695 | 303 |
| 486 | 3300050509 | nmdc:mga0qj67_59238_c1 | nmdc:mga0qj67_59238_c1_704_1615 | 303 |
| 487 | 3300050515 | nmdc:mga0a205_15_c1 | nmdc:mga0a205_15_c1_11531_12442 | 303 |
| 488 | 3300050515 | nmdc:mga0a205_3790_c1 | nmdc:mga0a205_3790_c1_9692_10603 | 303 |
| 489 | 3300053077 | Ga0495601_0000019 | Ga0495601_0000019_132179_133090 | 303 |
| 490 | 3300053077 | Ga0495601_0000059 | Ga0495601_0000059_14457_15368 | 303 |
| 491 | 3300053077 | Ga0495601_0018526 | Ga0495601_0018526_2763_3686 | 303 |
| 492 | 3300053078 | Ga0495612_0001133 | Ga0495612_0001133_1795_2706 | 303 |
| 493 | 3300053078 | Ga0495612_0001929 | Ga0495612_0001929_923_1834 | 303 |
| 494 | 3300053078 | Ga0495612_0058792 | Ga0495612_0058792_599_1510 | 303 |
| 495 | 3300053083 | Ga0495655_0000008 | Ga0495655_0000008_14313_15236 | 303 |
| 496 | 3300053084 | Ga0495595_0000009 | Ga0495595_0000009_169277_170251 | 303 |
| 497 | 3300053084 | Ga0495595_0000213 | Ga0495595_0000213_11698_12609 | 303 |
| 498 | 3300053085 | Ga0495619_0000001 | Ga0495619_0000001_18059_18970 | 303 |
| 499 | 3300053085 | Ga0495619_0000057 | Ga0495619_0000057_92136_93110 | 303 |
| 500 | 3300053085 | Ga0495619_0000069 | Ga0495619_0000069_11583_12494 | 303 |
| 501 | 3300053085 | Ga0495619_0000347 | Ga0495619_0000347_19385_20296 | 303 |
| 502 | 3300053085 | Ga0495619_0002458 | Ga0495619_0002458_9257_10168 | 303 |
| 503 | 3300053085 | Ga0495619_0005611 | Ga0495619_0005611_5621_6532 | 303 |
| 504 | 3300053085 | Ga0495619_0011363 | Ga0495619_0011363_2294_3205 | 303 |
| 505 | 3300053085 | Ga0495619_0090877 | Ga0495619_0090877_359_1282 | 303 |
| 506 | 3300053094 | Ga0500566_0029398 | Ga0500566_0029398_1069_1992 | 303 |
| 507 | 3300053096 | Ga0500641_0009782 | Ga0500641_0009782_1048_1959 | 303 |
| 508 | 3300053119 | Ga0500595_044606 | Ga0500595_044606_249_1160 | 303 |
| 509 | 3300053123 | Ga0500614_001627 | Ga0500614_001627_3608_4519 | 303 |
| 510 | 3300053129 | Ga0500628_000043 | Ga0500628_000043_29861_30784 | 303 |
| 511 | 3300054114 | Ga0501084_0079345 | Ga0501084_0079345_611_1522 | 303 |
| 512 | 3300060353 | Ga0501082_0044209 | Ga0501082_0044209_2083_2994 | 303 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2br6-assembly1.cif.gz_A | crystal structure of quorum-quenching n-acyl homoserine lactone lactonase | 0.8853 | 16 | 299 |
| 4j5h-assembly1.cif.gz_A | crystal structure of b. thuringiensis aiia mutant f107w with n-decanoyl-l-homoserine bound at the active site | 0.8832 | 22 | 299 |
| 5eht-assembly1.cif.gz_A | indirect contributions of mutations underlie optimization of new enzyme function | 0.8806 | 16 | 299 |
| 2btn-assembly1.cif.gz_A | crystal structure and catalytic mechanism of the quorum-quenching n- acyl homoserine lactone hydrolase | 0.8798 | 16 | 299 |
| 3dha-assembly1.cif.gz_A | an ultral high resolution structure of n-acyl homoserine lactone hydrolase with the product n-hexanoyl-l-homoserine bound at an alternative site | 0.8696 | 17 | 299 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ehtA01 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8793 | 16 | 295 | 3.60.15.10 |
| 5ehtA01 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8726 | 16 | 295 | 3.60.15.10 |
| af_P9WLD7_51_309_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8487 | 25 | 296 | 3.60.15.10 |
| 6n9qD00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.835 | 21 | 303 | 3.60.15.10 |
| 6n9qD00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8293 | 21 | 303 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538A8T2-F1-model_v4 | N-acyl homoserine lactonase family protein | 0.9759 | 1 | 303 |
|
| AF-A0A538A8T2-F1-model_v4 | N-acyl homoserine lactonase family protein | 0.9727 | 1 | 303 |
|
| AF-A0A6I2Y8S9-F1-model_v4 | MBL fold metallo-hydrolase | 0.9584 | 5 | 298 |
GO:0016787
|
| AF-A0A5C7Q2I0-F1-model_v4 | N-acyl homoserine lactonase family protein | 0.9527 | 63 | 297 |
|
| AF-A0A534QS42-F1-model_v4 | N-acyl homoserine lactonase family protein | 0.9499 | 34 | 299 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar