F457461

General Info

Members Datasets Scaffolds Average Seq Length
512 283 512 302

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_1358421|Ga0451853_1358421_1171_2154
Length 327
Sequence MRECGLSDIDAQAYRRALTVTSAAMKVSVEPKPLHEPLAGGTPGATVTVEPMVAGHVTWPATMMERPGGRFETLKLLRALLSGNPAATVPCPAFLIRHPSAGAILVDTGLHPSVATDGKENFGGMGNRFGNPSLEPGEDIPSQLRKRGLDPGEIPIVVMTHMHIDHTSAISEFPSSTFIVSEKEWNAAATGPRPLLNGYRRPHYDYAFDYRTVDFDRAGIDSYATFGRCFDLFGDGSLRLAYTPGHSAGHISVIAHLGKRDFVIGGDATYMQAQLDGNAPLAPRPFDEHNYRRSLQELKLFKREYPNAIVTPGHDPEFYAGLDARYE

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
132 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
133 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
137 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
138 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
145 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
153 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
154 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
209 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
267 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
268 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
273 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
277 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
278 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
279 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
280 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
281 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.54
Nodule 0
Rhizoplane 11.33
Rhizosphere 82.23
Stem 0
Stem Tuber 0
Unclassified 3.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000556 3300001977 Bacteria 5618
2 JGI24748J21848_1002016 3300002074 Bacteria 2266
3 JGI24034J26672_10000147 3300002239 Bacteria 10141
4 Ga0070683_100003645 3300005329 Bacteria 12544
5 Ga0070683_100031376 3300005329 Bacteria 4831
6 Ga0070683_100092824 3300005329 Bacteria 2835
7 Ga0070683_100275108 3300005329 Bacteria 1602
8 Ga0070677_10000020 3300005333 Bacteria 48941
9 Ga0070682_100000009 3300005337 Bacteria 291635
10 Ga0070682_100000032 3300005337 Bacteria 155141
11 Ga0070682_100242916 3300005337 Bacteria 1294
12 Ga0068868_100061700 3300005338 Bacteria 2970
13 Ga0068868_100070495 3300005338 Bacteria 2787
14 Ga0070691_10000003 3300005341 Bacteria 86538
15 Ga0070691_10000348 3300005341 Bacteria 16483
16 Ga0070661_100000032 3300005344 Bacteria 112964
17 Ga0070692_10018423 3300005345 Bacteria 3358
18 Ga0070668_100029027 3300005347 Bacteria 4199
19 Ga0070668_100041672 3300005347 Bacteria 3518
20 Ga0070675_100000022 3300005354 Bacteria 146580
21 Ga0070671_100154846 3300005355 Bacteria 1936
22 Ga0070674_100000021 3300005356 Bacteria 87134
23 Ga0070674_100000075 3300005356 Bacteria 45822
24 Ga0070673_100008528 3300005364 Bacteria 6819
25 Ga0070688_100000031 3300005365 Bacteria 65288
26 Ga0070688_100000194 3300005365 Bacteria 32209
27 Ga0070688_100041121 3300005365 Bacteria 2836
28 Ga0070659_100002039 3300005366 Bacteria 14442
29 Ga0070659_100101582 3300005366 Bacteria 2315
30 Ga0070667_100001503 3300005367 Bacteria 20862
31 Ga0070667_100015838 3300005367 Bacteria 6237
32 Ga0070714_100074920 3300005435 Bacteria 2936
33 Ga0070714_100074954 3300005435 Bacteria 2935
34 Ga0070713_100000516 3300005436 Bacteria 24506
35 Ga0070713_100045444 3300005436 Bacteria 3599
36 Ga0070710_10081672 3300005437 Bacteria 1888
37 Ga0070711_100028366 3300005439 Bacteria 3684
38 Ga0070711_100068958 3300005439 Bacteria 2486
39 Ga0070700_100083667 3300005441 Bacteria 2066
40 Ga0070700_100099506 3300005441 Bacteria 1913
41 Ga0070663_100033780 3300005455 Bacteria 3536
42 Ga0070663_100282127 3300005455 Unclassified 1324
43 Ga0070678_100011255 3300005456 Bacteria 5510
44 Ga0070662_100000052 3300005457 Bacteria 61979
45 Ga0070681_10010128 3300005458 Bacteria 9293
46 Ga0070681_10056853 3300005458 Bacteria 3893
47 Ga0068867_100029739 3300005459 Bacteria 3937
48 Ga0070685_10000058 3300005466 Bacteria 64666
49 Ga0070685_10000263 3300005466 Bacteria 33715
50 Ga0070685_10132509 3300005466 Bacteria 1560
51 Ga0070679_100000134 3300005530 Bacteria 59591
52 Ga0070679_100019644 3300005530 Bacteria 6574
53 Ga0070684_100039278 3300005535 Bacteria 4070
54 Ga0070684_100055447 3300005535 Bacteria 3455
55 Ga0070684_100080217 3300005535 Bacteria 2887
56 Ga0070684_100084428 3300005535 Bacteria 2815
57 Ga0070684_100099400 3300005535 Bacteria 2597
58 Ga0070684_100521935 3300005535 Unclassified 1101
59 Ga0068853_100015477 3300005539 Bacteria 6266
60 Ga0070672_100000258 3300005543 Bacteria 30020
61 Ga0070695_100203244 3300005545 Unclassified 1417
62 Ga0070693_100003269 3300005547 Bacteria 7523
63 Ga0070665_100000022 3300005548 Bacteria 379286
64 Ga0070665_100001623 3300005548 Bacteria 25894
65 Ga0070665_100186690 3300005548 Bacteria 2074
66 Ga0070704_100091354 3300005549 Bacteria 2270
67 Ga0068857_100045709 3300005577 Bacteria 3885
68 Ga0068854_100000133 3300005578 Bacteria 51376
69 Ga0068854_100023995 3300005578 Bacteria 4171
70 Ga0068856_100000369 3300005614 Bacteria 49419
71 Ga0068856_100008918 3300005614 Bacteria 9756
72 Ga0070702_100112910 3300005615 Bacteria 1688
73 Ga0068852_100000024 3300005616 Bacteria 120479
74 Ga0068864_100000023 3300005618 Bacteria 257064
75 Ga0068866_10000007 3300005718 Bacteria 121729
76 Ga0068866_10000469 3300005718 Bacteria 18473
77 Ga0068851_10000895 3300005834 Bacteria 12866
78 Ga0068851_10004054 3300005834 Bacteria 6576
79 Ga0068863_100000110 3300005841 Bacteria 86415
80 Ga0068863_100026684 3300005841 Bacteria 5508
81 Ga0068863_100393201 3300005841 Unclassified 1355
82 Ga0068858_100000150 3300005842 Bacteria 73075
83 Ga0068858_100000329 3300005842 Bacteria 50177
84 Ga0068858_100043131 3300005842 Bacteria 4183
85 Ga0068858_100149533 3300005842 Bacteria 2195
86 Ga0068860_100011273 3300005843 Bacteria 8809
87 Ga0068862_100004171 3300005844 Bacteria 12237
88 Ga0081455_10008364 3300005937 Bacteria 10769
89 Ga0081455_10040573 3300005937 Bacteria 4102
90 Ga0081455_10041806 3300005937 Bacteria 4026
91 Ga0081455_10067212 3300005937 Bacteria 2988
92 Ga0081455_10164303 3300005937 Unclassified 1698
93 Ga0081455_10183350 3300005937 Bacteria 1583
94 Ga0081455_10301681 3300005937 Bacteria 1149
95 Ga0081540_1001588 3300005983 Bacteria 19426
96 Ga0081539_10001052 3300005985 Bacteria 50554
97 Ga0081539_10022350 3300005985 Bacteria 4189
98 Ga0075363_100010859 3300006048 Bacteria 4344
99 Ga0075364_10171734 3300006051 Bacteria 1466
100 Ga0070715_10000003 3300006163 Bacteria 345282
101 Ga0070715_10145985 3300006163 Bacteria 1154
102 Ga0070716_100132062 3300006173 Bacteria 1580
103 Ga0070712_100016243 3300006175 Unclassified 4806
104 Ga0075367_10043857 3300006178 Bacteria 2620
105 Ga0097621_100581550 3300006237 Bacteria 1022
106 Ga0075430_100048532 3300006846 Bacteria 3585
107 Ga0075431_100179264 3300006847 Bacteria 2175
108 Ga0075433_10002915 3300006852 Bacteria 13125
109 Ga0075433_10003283 3300006852 Bacteria 12491
110 Ga0068865_100000024 3300006881 Bacteria 94969
111 Ga0105245_10000022 3300009098 Bacteria 181225
112 Ga0105245_10001178 3300009098 Bacteria 23683
113 Ga0105245_10008000 3300009098 Bacteria 9247
114 Ga0105245_10267092 3300009098 Bacteria 1667
115 Ga0105247_10000064 3300009101 Bacteria 123994
116 Ga0105247_10072683 3300009101 Bacteria 2153
117 Ga0105243_10012040 3300009148 Bacteria 6541
118 Ga0105242_10000123 3300009176 Bacteria 56900
119 Ga0105242_10013245 3300009176 Bacteria 6366
120 Ga0105242_10064933 3300009176 Bacteria 3010
121 Ga0105248_10000017 3300009177 Bacteria 298089
122 Ga0105238_10000016 3300009551 Bacteria 236218
123 Ga0105249_10000181 3300009553 Bacteria 73946
124 Ga0105249_10012298 3300009553 Bacteria 7542
125 Ga0105239_10288660 3300010375 Bacteria 1847
126 Ga0105246_10306240 3300011119 Bacteria 1285
127 Ga0157371_10001783 3300013102 Bacteria 21764
128 Ga0157370_10049032 3300013104 Bacteria 4044
129 Ga0157369_10000068 3300013105 Bacteria 144274
130 Ga0157374_10005308 3300013296 Bacteria 10822
131 Ga0157374_10700813 3300013296 Bacteria 1026
132 Ga0157378_10000656 3300013297 Bacteria 32583
133 Ga0157378_10087628 3300013297 Bacteria 2824
134 Ga0157375_10000126 3300013308 Bacteria 75410
135 Ga0163163_10438413 3300014325 Unclassified 1366
136 Ga0157380_10000328 3300014326 Bacteria 28745
137 Ga0157380_10104533 3300014326 Bacteria 2365
138 Ga0157377_10077334 3300014745 Bacteria 1937
139 Ga0157379_10031333 3300014968 Bacteria 4736
140 Ga0157379_10047841 3300014968 Bacteria 3817
141 Ga0157379_10088250 3300014968 Bacteria 2781
142 Ga0157376_10018824 3300014969 Bacteria 5307
143 Ga0157376_10093379 3300014969 Bacteria 2612
144 Ga0163161_10000013 3300017792 Bacteria 258747
145 Ga0163161_10052079 3300017792 Bacteria 2967
146 Ga0207656_10000274 3300025321 Bacteria 17852
147 Ga0207656_10004135 3300025321 Bacteria 5043
148 Ga0207682_10000050 3300025893 Bacteria 49908
149 Ga0207642_10000008 3300025899 Bacteria 132651
150 Ga0207642_10000181 3300025899 Bacteria 18196
151 Ga0207710_10000165 3300025900 Bacteria 69714
152 Ga0207680_10011411 3300025903 Bacteria 4489
153 Ga0207680_10126296 3300025903 Bacteria 1680
154 Ga0207685_10000003 3300025905 Bacteria 344527
155 Ga0207705_10100545 3300025909 Bacteria 2127
156 Ga0207707_10035644 3300025912 Bacteria 4350
157 Ga0207707_10036138 3300025912 Bacteria 4320
158 Ga0207663_10066167 3300025916 Bacteria 2312
159 Ga0207649_10000015 3300025920 Bacteria 245662
160 Ga0207652_10001289 3300025921 Bacteria 22300
161 Ga0207652_10003408 3300025921 Bacteria 13125
162 Ga0207694_10000012 3300025924 Bacteria 411218
163 Ga0207659_10000030 3300025926 Bacteria 124433
164 Ga0207687_10000025 3300025927 Bacteria 175177
165 Ga0207687_10000039 3300025927 Bacteria 114303
166 Ga0207687_10006005 3300025927 Bacteria 8035
167 Ga0207687_10007709 3300025927 Bacteria 7066
168 Ga0207700_10000019 3300025928 Bacteria 183117
169 Ga0207700_10036698 3300025928 Bacteria 3543
170 Ga0207664_10009739 3300025929 Bacteria 6757
171 Ga0207664_10057860 3300025929 Bacteria 3083
172 Ga0207690_10005737 3300025932 Bacteria 7337
173 Ga0207690_10015961 3300025932 Bacteria 4562
174 Ga0207706_10000137 3300025933 Bacteria 79758
175 Ga0207686_10000066 3300025934 Bacteria 95095
176 Ga0207686_10000592 3300025934 Bacteria 22655
177 Ga0207686_10050440 3300025934 Unclassified 2587
178 Ga0207686_10105615 3300025934 Bacteria 1889
179 Ga0207709_10014890 3300025935 Bacteria 4302
180 Ga0207669_10000032 3300025937 Bacteria 82757
181 Ga0207669_10000091 3300025937 Bacteria 45833
182 Ga0207669_10299513 3300025937 Bacteria 1221
183 Ga0207704_10000054 3300025938 Bacteria 79155
184 Ga0207665_10131145 3300025939 Bacteria 1779
185 Ga0207691_10000871 3300025940 Bacteria 30024
186 Ga0207711_10000011 3300025941 Bacteria 518817
187 Ga0207661_10002638 3300025944 Bacteria 12343
188 Ga0207661_10004497 3300025944 Bacteria 9777
189 Ga0207661_10053194 3300025944 Bacteria 3239
190 Ga0207661_10470190 3300025944 Bacteria 1147
191 Ga0207651_10021515 3300025960 Bacteria 3922
192 Ga0207712_10000067 3300025961 Bacteria 130079
193 Ga0207712_10033097 3300025961 Bacteria 3493
194 Ga0207668_10025559 3300025972 Bacteria 3823
195 Ga0207668_10072576 3300025972 Bacteria 2463
196 Ga0207640_10000147 3300025981 Bacteria 51462
197 Ga0207640_10053916 3300025981 Bacteria 2627
198 Ga0207658_10043805 3300025986 Bacteria 3255
199 Ga0207658_10130823 3300025986 Archaea 2016
200 Ga0207677_10043277 3300026023 Bacteria 2992
201 Ga0207677_10066262 3300026023 Bacteria 2524
202 Ga0207703_10000070 3300026035 Bacteria 123480
203 Ga0207703_10000122 3300026035 Bacteria 92656
204 Ga0207678_10019235 3300026067 Bacteria 5998
205 Ga0207708_10061704 3300026075 Bacteria 2862
206 Ga0207702_10000326 3300026078 Bacteria 54674
207 Ga0207702_10000557 3300026078 Bacteria 41471
208 Ga0207702_10012405 3300026078 Bacteria 7097
209 Ga0207702_10232381 3300026078 Unclassified 1724
210 Ga0207641_10000065 3300026088 Bacteria 156066
211 Ga0207641_10019506 3300026088 Bacteria 5566
212 Ga0207648_10043310 3300026089 Bacteria 3952
213 Ga0207676_10000025 3300026095 Bacteria 261714
214 Ga0207674_10069830 3300026116 Bacteria 3532
215 Ga0207675_100581400 3300026118 Unclassified 1121
216 Ga0207683_10020523 3300026121 Bacteria 5652
217 Ga0207683_10072848 3300026121 Bacteria 3038
218 Ga0207698_10000014 3300026142 Bacteria 240703
219 Ga0268266_10000029 3300028379 Bacteria 424015
220 Ga0268266_10000422 3300028379 Bacteria 64158
221 Ga0268266_10000973 3300028379 Bacteria 36388
222 Ga0268266_10111563 3300028379 Bacteria 2423
223 Ga0268265_10005246 3300028380 Bacteria 8866
224 Ga0268264_10007756 3300028381 Bacteria 8936
225 Ga0265337_1000730 3300028556 Bacteria 17276
226 Ga0265326_10000040 3300028558 Bacteria 85624
227 Ga0265322_10000012 3300028654 Bacteria 152373
228 Ga0265338_10000156 3300028800 Bacteria 125065
229 Ga0265324_10000567 3300029957 Bacteria 25333
230 Ga0265328_10008624 3300031239 Bacteria 4193
231 Ga0265320_10000001 3300031240 Bacteria 847191
232 Ga0265329_10007672 3300031242 Bacteria 4152
233 Ga0265339_10021395 3300031249 Bacteria 3764
234 Ga0265331_10031968 3300031250 Bacteria 2611
235 Ga0265327_10000003 3300031251 Bacteria 852750
236 Ga0265316_10023963 3300031344 Bacteria 5125
237 Ga0265314_10000334 3300031711 Bacteria 66204
238 Ga0316576_10012462 3300031727 Bacteria 5616
239 Ga0316574_0009823 3300035398 Bacteria 5378
240 Ga0316574_0213315 3300035398 Unclassified 1238
241 Ga0373937_0033886 3300036401 Bacteria 4643
242 Ga0316584_0002818 3300036712 Bacteria 11147
243 Ga0395900_0229801 3300037418 Bacteria 1866
244 Ga0395898_0129650 3300037466 Bacteria 2416
245 Ga0395905_0278150 3300037471 Bacteria 1560
246 Ga0395901_0482600 3300038443 Bacteria 1264
247 Ga0395901_0687483 3300038443 Unclassified 1022
248 Ga0451833_0445893 3300041491 Bacteria 1439
249 Ga0451847_0609686 3300041503 Bacteria 1240
250 Ga0451849_1233055 3300041505 Bacteria 901
251 Ga0451853_1358421 3300041512 Bacteria 3353
252 Ga0466963_0000257 3300044694 Bacteria 23311
253 Ga0466963_0008184 3300044694 Bacteria 6266
254 Ga0466963_0130248 3300044694 Bacteria 1737
255 Ga0466957_0000193 3300044842 Bacteria 28057
256 Ga0466957_0173007 3300044842 Bacteria 1407
257 Ga0466967_0000849 3300045976 Bacteria 16201
258 Ga0466967_0207368 3300045976 Bacteria 1858
259 Ga0495592_0000424 3300046454 Bacteria 32002
260 Ga0495592_0095525 3300046454 Bacteria 2126
261 Ga0495603_0000083 3300046455 Bacteria 42311
262 Ga0495603_0004890 3300046455 Bacteria 8013
263 Ga0495629_0001145 3300046459 Bacteria 20950
264 Ga0495629_0005665 3300046459 Bacteria 9329
265 Ga0495629_0050304 3300046459 Bacteria 2919
266 Ga0495629_0190161 3300046459 Bacteria 1421
267 Ga0495641_0000010 3300046461 Bacteria 158798
268 Ga0495651_0073968 3300046462 Bacteria 2586
269 Ga0495653_0006069 3300046463 Bacteria 9900
270 Ga0495653_0079686 3300046463 Bacteria 2425
271 Ga0495582_0000006 3300046473 Bacteria 140434
272 Ga0495662_0000178 3300046476 Bacteria 25519
273 Ga0495594_0000001 3300046499 Bacteria 293051
274 Ga0495606_0000283 3300046507 Bacteria 88309
275 Ga0495608_0000042 3300046511 Bacteria 115906
276 Ga0495608_0003416 3300046511 Bacteria 11374
277 Ga0495608_0007777 3300046511 Bacteria 7549
278 Ga0495618_0000037 3300046514 Bacteria 99735
279 Ga0495620_0000731 3300046515 Bacteria 20250
280 Ga0495620_0082089 3300046515 Bacteria 1303
281 Ga0495628_0000265 3300046516 Bacteria 46703
282 Ga0495628_0017094 3300046516 Bacteria 6043
283 Ga0495628_0082001 3300046516 Bacteria 2505
284 Ga0495628_0140673 3300046516 Bacteria 1842
285 Ga0495628_0159635 3300046516 Bacteria 1714
286 Ga0495630_0000148 3300046517 Bacteria 54619
287 Ga0495630_0000586 3300046517 Bacteria 26542
288 Ga0495637_0107457 3300046520 Bacteria 1085
289 Ga0495644_0004691 3300046523 Bacteria 5372
290 Ga0495652_0000009 3300046529 Bacteria 311000
291 Ga0495652_0039820 3300046529 Bacteria 4063
292 Ga0495640_0003678 3300046533 Bacteria 12324
293 Ga0495640_0050712 3300046533 Bacteria 2857
294 Ga0495586_0008020 3300046535 Bacteria 5632
295 Ga0495586_0167990 3300046535 Bacteria 1239
296 Ga0495587_0002629 3300046536 Bacteria 12001
297 Ga0495587_0015546 3300046536 Bacteria 4750
298 Ga0495598_0001441 3300046537 Bacteria 4716
299 Ga0495621_0005233 3300046539 Bacteria 3715
300 Ga0495645_0016069 3300046543 Bacteria 5337
301 Ga0495645_0080076 3300046543 Bacteria 2345
302 Ga0495622_0000069 3300046557 Bacteria 89759
303 Ga0495667_0000109 3300046559 Bacteria 59985
304 Ga0495656_0003522 3300046615 Bacteria 5296
305 Ga0495668_0057343 3300046616 Bacteria 2150
306 Ga0495634_0000021 3300046642 Bacteria 120521
307 Ga0495634_0000951 3300046642 Bacteria 27343
308 Ga0495634_0142664 3300046642 Unclassified 1520
309 Ga0495625_0000109 3300046660 Bacteria 125064
310 Ga0495635_0000006 3300046663 Bacteria 301820
311 Ga0495635_0038592 3300046663 Bacteria 3306
312 Ga0495635_0081100 3300046663 Bacteria 2220
313 Ga0495588_0098562 3300046674 Bacteria 1535
314 Ga0495657_0000040 3300046675 Bacteria 115899
315 Ga0495599_0020110 3300046678 Bacteria 4158
316 Ga0495623_0091266 3300046679 Bacteria 1869
317 Ga0495647_0000002 3300046681 Bacteria 174959
318 Ga0495647_0002786 3300046681 Bacteria 5539
319 Ga0495647_0034003 3300046681 Bacteria 1907
320 Ga0495658_0000027 3300046683 Bacteria 74322
321 Ga0495669_0000132 3300046684 Bacteria 47843
322 Ga0495613_0000190 3300046689 Bacteria 60696
323 Ga0495613_0000324 3300046689 Bacteria 42895
324 Ga0495624_0000005 3300046690 Bacteria 158127
325 Ga0495624_0000031 3300046690 Bacteria 91702
326 Ga0495624_0037983 3300046690 Bacteria 3096
327 Ga0495670_0041667 3300046691 Bacteria 2291
328 Ga0495649_0040054 3300046694 Bacteria 2567
329 Ga0495600_0001252 3300046809 Bacteria 13978
330 Ga0495600_0023088 3300046809 Bacteria 4001
331 Ga0495604_0000636 3300047317 Bacteria 30130
332 Ga0495604_0001593 3300047317 Bacteria 18689
333 Ga0495674_0004050 3300047319 Bacteria 14178
334 Ga0495672_0142528 3300047320 Bacteria 1250
335 Ga0495676_0000209 3300047321 Bacteria 46557
336 Ga0495676_0000624 3300047321 Bacteria 29322
337 Ga0495676_0002889 3300047321 Bacteria 15495
338 Ga0495680_0000094 3300047322 Bacteria 80355
339 Ga0495680_0000332 3300047322 Bacteria 52925
340 Ga0495680_0010267 3300047322 Bacteria 8355
341 Ga0495680_0124091 3300047322 Bacteria 1904
342 Ga0495675_0000051 3300047444 Bacteria 80375
343 Ga0495679_044460 3300047446 Bacteria 1360
344 Ga0495685_042063 3300047447 Bacteria 1560
345 Ga0495686_0008917 3300047472 Bacteria 7291
346 Ga0495593_0058369 3300047673 Bacteria 2024
347 Ga0495602_0000038 3300048088 Bacteria 130758
348 Ga0495602_0002031 3300048088 Bacteria 20359
349 Ga0495602_0133551 3300048088 Bacteria 1975
350 Ga0495602_0221192 3300048088 Bacteria 1429
351 Ga0496100_0000006 3300048903 Bacteria 297429
352 Ga0496100_0000028 3300048903 Bacteria 113912
353 Ga0496101_0000005 3300048904 Bacteria 331455
354 Ga0496101_0000009 3300048904 Bacteria 297429
355 Ga0496102_0000021 3300048905 Bacteria 246920
356 Ga0496102_0031863 3300048905 Bacteria 4732
357 Ga0496102_0120196 3300048905 Bacteria 2453
358 Ga0496103_0000001 3300048906 Bacteria 643471
359 Ga0496103_0023273 3300048906 Bacteria 3735
360 Ga0496103_0027757 3300048906 Bacteria 3433
361 Ga0496103_0056705 3300048906 Bacteria 2432
362 Ga0496104_0000008 3300048907 Bacteria 516976
363 Ga0496104_0000029 3300048907 Bacteria 202968
364 Ga0496104_0108935 3300048907 Bacteria 2655
365 Ga0496105_0000002 3300048908 Bacteria 753215
366 Ga0496105_0000003 3300048908 Bacteria 713251
367 Ga0496105_0000876 3300048908 Bacteria 20602
368 Ga0496105_0020070 3300048908 Bacteria 5395
369 Ga0496105_0048057 3300048908 Bacteria 3522
370 Ga0496106_0000070 3300048909 Bacteria 82770
371 Ga0496106_0000090 3300048909 Bacteria 72270
372 Ga0496106_0000101 3300048909 Bacteria 65644
373 Ga0496107_0000004 3300048910 Bacteria 297680
374 Ga0496107_0000015 3300048910 Bacteria 173644
375 Ga0496107_0035771 3300048910 Bacteria 3561
376 Ga0496107_0173708 3300048910 Bacteria 1599
377 Ga0496108_0000004 3300048911 Bacteria 545055
378 Ga0496108_0000042 3300048911 Bacteria 146397
379 Ga0496108_0000178 3300048911 Bacteria 58913
380 Ga0496108_0005504 3300048911 Bacteria 10245
381 Ga0496108_0038231 3300048911 Bacteria 3998
382 Ga0496109_0000034 3300048912 Bacteria 160397
383 Ga0496109_0000036 3300048912 Bacteria 153972
384 Ga0496109_0000391 3300048912 Bacteria 39830
385 Ga0496109_0001026 3300048912 Bacteria 23100
386 Ga0496109_0010089 3300048912 Bacteria 8060
387 Ga0496109_0252459 3300048912 Bacteria 1661
388 Ga0496109_0353448 3300048912 Bacteria 1388
389 Ga0496109_0637944 3300048912 Unclassified 1002
390 Ga0496110_0000122 3300048913 Bacteria 43513
391 Ga0496110_0007589 3300048913 Bacteria 8668
392 Ga0496110_0025709 3300048913 Bacteria 5034
393 Ga0496110_0059015 3300048913 Bacteria 3380
394 Ga0496111_0000037 3300048914 Bacteria 52978
395 Ga0496111_0080264 3300048914 Unclassified 2380
396 Ga0496111_0224791 3300048914 Bacteria 1394
397 Ga0496112_0000002 3300048915 Bacteria 782039
398 Ga0496112_0010244 3300048915 Bacteria 8499
399 Ga0496113_0000002 3300048916 Bacteria 220193
400 Ga0496113_0018796 3300048916 Bacteria 4820
401 Ga0496113_0030978 3300048916 Bacteria 3877
402 Ga0496113_0164654 3300048916 Bacteria 1754
403 Ga0496114_0000159 3300048917 Bacteria 47728
404 Ga0496114_0005005 3300048917 Bacteria 10338
405 Ga0496114_0131161 3300048917 Bacteria 2164
406 Ga0496114_0272529 3300048917 Bacteria 1491
407 Ga0496115_0000005 3300048918 Bacteria 290756
408 Ga0496115_0000257 3300048918 Bacteria 47123
409 Ga0496116_0000138 3300048919 Bacteria 151606
410 Ga0496118_0001277 3300048921 Bacteria 38534
411 Ga0496118_0035997 3300048921 Bacteria 4010
412 Ga0496118_0149978 3300048921 Bacteria 1461
413 Ga0496119_0003660 3300048922 Bacteria 15783
414 Ga0496119_0021239 3300048922 Bacteria 4699
415 Ga0496119_0024862 3300048922 Bacteria 4199
416 Ga0496119_0164991 3300048922 Bacteria 1174
417 Ga0496120_0002330 3300048923 Bacteria 19539
418 Ga0496121_0006772 3300048924 Bacteria 14054
419 Ga0496121_0095795 3300048924 Bacteria 2305
420 Ga0496125_0028985 3300048928 Bacteria 4985
421 Ga0496125_0074977 3300048928 Bacteria 2620
422 Ga0496126_0007436 3300048929 Bacteria 12015
423 Ga0496126_0045157 3300048929 Bacteria 4052
424 Ga0496126_0182320 3300048929 Bacteria 1783
425 Ga0501031_0003336 3300049568 Bacteria 10303
426 Ga0501032_0009040 3300049569 Bacteria 7239
427 Ga0501033_0005116 3300049570 Bacteria 10430
428 Ga0501034_0003804 3300049571 Bacteria 17018
429 Ga0501034_0022387 3300049571 Bacteria 6439
430 Ga0501034_0051243 3300049571 Bacteria 4162
431 Ga0501034_0119650 3300049571 Bacteria 2620
432 Ga0501034_0204127 3300049571 Bacteria 1933
433 Ga0501036_0073446 3300049572 Bacteria 2891
434 Ga0501037_0009327 3300049573 Bacteria 7200
435 Ga0501038_0014268 3300049574 Bacteria 7239
436 Ga0501039_0045896 3300049575 Bacteria 3376
437 Ga0501039_0089346 3300049575 Bacteria 2401
438 Ga0501040_0017812 3300049576 Bacteria 4715
439 Ga0501042_0024380 3300049578 Bacteria 4242
440 Ga0501042_0044650 3300049578 Bacteria 3158
441 Ga0501042_0056709 3300049578 Bacteria 2795
442 Ga0501043_0001141 3300049579 Bacteria 23356
443 Ga0501043_0217466 3300049579 Bacteria 1479
444 Ga0501046_0009482 3300049580 Bacteria 8413
445 Ga0501047_0003662 3300049581 Bacteria 14481
446 Ga0501047_0077493 3300049581 Bacteria 3197
447 Ga0501047_0153051 3300049581 Bacteria 2181
448 Ga0501047_0249364 3300049581 Bacteria 1624
449 Ga0501048_0009669 3300049582 Bacteria 7234
450 Ga0501067_0034805 3300049583 Bacteria 2796
451 Ga0501068_0032152 3300049584 Bacteria 3119
452 Ga0501068_0033339 3300049584 Bacteria 3067
453 Ga0501068_0061938 3300049584 Bacteria 2274
454 Ga0501069_0002690 3300049585 Bacteria 9072
455 Ga0501069_0024220 3300049585 Bacteria 3310
456 Ga0501069_0323404 3300049585 Bacteria 906
457 Ga0501070_0005806 3300049586 Bacteria 10532
458 Ga0501070_0007976 3300049586 Bacteria 8970
459 Ga0501070_0124388 3300049586 Bacteria 2131
460 Ga0501070_0277885 3300049586 Bacteria 1367
461 Ga0501071_0051249 3300049587 Bacteria 2974
462 Ga0501072_0045489 3300049588 Bacteria 3452
463 Ga0501073_0040030 3300049589 Bacteria 3319
464 Ga0501074_0008960 3300049590 Bacteria 7258
465 Ga0501075_0004446 3300049591 Bacteria 9488
466 Ga0501079_0010469 3300049741 Bacteria 7051
467 Ga0501080_0059103 3300049742 Bacteria 3568
468 Ga0501080_0246741 3300049742 Unclassified 1628
469 Ga0501080_0343279 3300049742 Unclassified 1349
470 Ga0501081_0059098 3300049743 Bacteria 2654
471 Ga0501081_0160128 3300049743 Bacteria 1622
472 Ga0501083_0021607 3300049744 Bacteria 4469
473 Ga0501083_0023580 3300049744 Bacteria 4266
474 Ga0501035_0007460 3300049822 Bacteria 10214
475 Ga0501044_0007015 3300049823 Bacteria 12399
476 Ga0501044_0203844 3300049823 Bacteria 1935
477 Ga0501044_0283305 3300049823 Bacteria 1590
478 Ga0501045_0049109 3300049824 Bacteria 3076
479 nmdc:mga03n38_84416_c1 3300050490 Unclassified 1499
480 nmdc:mga00v17_335511_c1 3300050491 Unclassified 983
481 nmdc:mga00v17_60501_c1 3300050491 Bacteria 2326
482 nmdc:mga0yw44_1878_c1 3300050492 Bacteria 8644
483 nmdc:mga0qj67_59238_c1 3300050509 Bacteria 3036
484 nmdc:mga0a205_15_c1 3300050515 Bacteria 33986
485 nmdc:mga0a205_3790_c1 3300050515 Bacteria 13540
486 Ga0495601_0000019 3300053077 Bacteria 161673
487 Ga0495601_0000059 3300053077 Bacteria 60752
488 Ga0495601_0018526 3300053077 Bacteria 4239
489 Ga0495612_0001133 3300053078 Bacteria 10927
490 Ga0495612_0001929 3300053078 Bacteria 8537
491 Ga0495612_0058792 3300053078 Bacteria 1589
492 Ga0495655_0000008 3300053083 Bacteria 153535
493 Ga0495655_0056444 3300053083 Bacteria 1057
494 Ga0495595_0000009 3300053084 Bacteria 193039
495 Ga0495595_0000213 3300053084 Bacteria 23371
496 Ga0495595_0001807 3300053084 Bacteria 8340
497 Ga0495619_0000001 3300053085 Bacteria 586054
498 Ga0495619_0000057 3300053085 Bacteria 93948
499 Ga0495619_0000069 3300053085 Bacteria 82755
500 Ga0495619_0000347 3300053085 Bacteria 32351
501 Ga0495619_0002458 3300053085 Bacteria 12117
502 Ga0495619_0005611 3300053085 Bacteria 7959
503 Ga0495619_0011363 3300053085 Bacteria 5607
504 Ga0495619_0090877 3300053085 Bacteria 2067
505 Ga0500566_0029398 3300053094 Bacteria 3210
506 Ga0500641_0009782 3300053096 Bacteria 3451
507 Ga0500554_086565 3300053102 Unclassified 1037
508 Ga0500595_044606 3300053119 Bacteria 1404
509 Ga0500614_001627 3300053123 Bacteria 5294
510 Ga0500628_000043 3300053129 Bacteria 45301
511 Ga0501084_0079345 3300054114 Bacteria 2751
512 Ga0501082_0044209 3300060353 Bacteria 3842

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0353448 Ga0496109_0353448_563_1357 264
2 3300049585 Ga0501069_0323404 Ga0501069_0323404_51_845 264
3 3300049586 Ga0501070_0124388 Ga0501070_0124388_51_845 264
4 3300041505 Ga0451849_1233055 Ga0451849_1233055_87_884 265
5 3300049586 Ga0501070_0007976 Ga0501070_0007976_8155_8955 265
6 3300049571 Ga0501034_0051243 Ga0501034_0051243_3163_3987 274
7 3300049571 Ga0501034_0119650 Ga0501034_0119650_105_929 274
8 3300050490 nmdc:mga03n38_84416_c1 nmdc:mga03n38_84416_c1_650_1474 274
9 3300050491 nmdc:mga00v17_60501_c1 nmdc:mga00v17_60501_c1_474_1298 274
10 3300038443 Ga0395901_0687483 Ga0395901_0687483_126_968 275
11 3300046520 Ga0495637_0107457 Ga0495637_0107457_13_843 276
12 3300046678 Ga0495599_0020110 Ga0495599_0020110_2632_3462 276
13 3300048911 Ga0496108_0000178 Ga0496108_0000178_13607_14518 277
14 3300048912 Ga0496109_0001026 Ga0496109_0001026_10489_11400 277
15 3300005355 Ga0070671_100154846 Ga0070671_1001548462 279
16 3300049571 Ga0501034_0003804 Ga0501034_0003804_8985_9824 279
17 3300050491 nmdc:mga00v17_335511_c1 nmdc:mga00v17_335511_c1_66_908 279
18 3300046523 Ga0495644_0004691 Ga0495644_0004691_3746_4657 281
19 3300041503 Ga0451847_0609686 Ga0451847_0609686_39_926 292
20 3300046616 Ga0495668_0057343 Ga0495668_0057343_171_1055 294
21 3300049584 Ga0501068_0061938 Ga0501068_0061938_317_1228 295
22 3300053102 Ga0500554_086565 Ga0500554_086565_113_1015 295
23 3300038443 Ga0395901_0482600 Ga0395901_0482600_131_1027 296
24 3300005937 Ga0081455_10008364 Ga0081455_100083646 297
25 3300005937 Ga0081455_10164303 Ga0081455_101643032 297
26 3300005937 Ga0081455_10183350 Ga0081455_101833502 297
27 3300005937 Ga0081455_10301681 Ga0081455_103016812 297
28 3300005983 Ga0081540_1001588 Ga0081540_100158810 297
29 3300013296 Ga0157374_10005308 Ga0157374_100053084 297
30 3300037418 Ga0395900_0229801 Ga0395900_0229801_319_1254 297
31 3300037466 Ga0395898_0129650 Ga0395898_0129650_708_1619 297
32 3300037471 Ga0395905_0278150 Ga0395905_0278150_25_984 297
33 3300048914 Ga0496111_0080264 Ga0496111_0080264_838_1746 297
34 3300014326 Ga0157380_10000328 Ga0157380_1000032816 298
35 3300046516 Ga0495628_0017094 Ga0495628_0017094_1120_2031 298
36 3300046681 Ga0495647_0000002 Ga0495647_0000002_43387_44298 298
37 3300005937 Ga0081455_10067212 Ga0081455_100672123 299
38 3300048922 Ga0496119_0024862 Ga0496119_0024862_1511_2410 299
39 3300005347 Ga0070668_100029027 Ga0070668_1000290272 301
40 3300005367 Ga0070667_100001503 Ga0070667_1000015033 301
41 3300005548 Ga0070665_100186690 Ga0070665_1001866902 301
42 3300005842 Ga0068858_100149533 Ga0068858_1001495332 301
43 3300005844 Ga0068862_100004171 Ga0068862_1000041717 301
44 3300005937 Ga0081455_10040573 Ga0081455_100405734 301
45 3300006048 Ga0075363_100010859 Ga0075363_1000108592 301
46 3300006051 Ga0075364_10171734 Ga0075364_101717342 301
47 3300006178 Ga0075367_10043857 Ga0075367_100438573 301
48 3300006847 Ga0075431_100179264 Ga0075431_1001792642 301
49 3300009098 Ga0105245_10267092 Ga0105245_102670922 301
50 3300009553 Ga0105249_10012298 Ga0105249_100122983 301
51 3300014968 Ga0157379_10047841 Ga0157379_100478413 301
52 3300025961 Ga0207712_10033097 Ga0207712_100330973 301
53 3300025972 Ga0207668_10025559 Ga0207668_100255593 301
54 3300025986 Ga0207658_10043805 Ga0207658_100438052 301
55 3300028380 Ga0268265_10005246 Ga0268265_1000524610 301
56 3300031727 Ga0316576_10012462 Ga0316576_100124626 301
57 3300035398 Ga0316574_0009823 Ga0316574_0009823_112_1080 301
58 3300035398 Ga0316574_0213315 Ga0316574_0213315_38_943 301
59 3300036712 Ga0316584_0002818 Ga0316584_0002818_6287_7192 301
60 3300045976 Ga0466967_0000849 Ga0466967_0000849_7980_8885 301
61 3300048912 Ga0496109_0637944 Ga0496109_0637944_38_943 301
62 3300049586 Ga0501070_0277885 Ga0501070_0277885_168_1073 301
63 3300050492 nmdc:mga0yw44_1878_c1 nmdc:mga0yw44_1878_c1_1801_2706 301
64 3300053083 Ga0495655_0056444 Ga0495655_0056444_86_991 301
65 3300005329 Ga0070683_100031376 Ga0070683_1000313766 302
66 3300005356 Ga0070674_100000021 Ga0070674_10000002117 302
67 3300005365 Ga0070688_100041121 Ga0070688_1000411212 302
68 3300005366 Ga0070659_100002039 Ga0070659_1000020398 302
69 3300005435 Ga0070714_100074954 Ga0070714_1000749543 302
70 3300005436 Ga0070713_100000516 Ga0070713_10000051615 302
71 3300005436 Ga0070713_100045444 Ga0070713_1000454443 302
72 3300005439 Ga0070711_100068958 Ga0070711_1000689582 302
73 3300005459 Ga0068867_100029739 Ga0068867_1000297392 302
74 3300005466 Ga0070685_10132509 Ga0070685_101325092 302
75 3300005535 Ga0070684_100055447 Ga0070684_1000554472 302
76 3300005577 Ga0068857_100045709 Ga0068857_1000457095 302
77 3300005718 Ga0068866_10000007 Ga0068866_1000000786 302
78 3300005841 Ga0068863_100026684 Ga0068863_1000266843 302
79 3300005842 Ga0068858_100043131 Ga0068858_1000431314 302
80 3300005843 Ga0068860_100011273 Ga0068860_1000112734 302
81 3300005985 Ga0081539_10022350 Ga0081539_100223502 302
82 3300006163 Ga0070715_10000003 Ga0070715_10000003317 302
83 3300006175 Ga0070712_100016243 Ga0070712_1000162436 302
84 3300014969 Ga0157376_10018824 Ga0157376_100188246 302
85 3300025899 Ga0207642_10000008 Ga0207642_1000000894 302
86 3300025905 Ga0207685_10000003 Ga0207685_10000003311 302
87 3300025928 Ga0207700_10000019 Ga0207700_10000019126 302
88 3300025928 Ga0207700_10036698 Ga0207700_100366983 302
89 3300025929 Ga0207664_10057860 Ga0207664_100578603 302
90 3300025932 Ga0207690_10005737 Ga0207690_100057372 302
91 3300025937 Ga0207669_10000032 Ga0207669_1000003217 302
92 3300025944 Ga0207661_10002638 Ga0207661_100026384 302
93 3300026089 Ga0207648_10043310 Ga0207648_100433102 302
94 3300026116 Ga0207674_10069830 Ga0207674_100698304 302
95 3300026121 Ga0207683_10072848 Ga0207683_100728482 302
96 3300028381 Ga0268264_10007756 Ga0268264_100077567 302
97 3300044694 Ga0466963_0008184 Ga0466963_0008184_804_1712 302
98 3300046454 Ga0495592_0095525 Ga0495592_0095525_751_1659 302
99 3300046499 Ga0495594_0000001 Ga0495594_0000001_83754_84662 302
100 3300046515 Ga0495620_0082089 Ga0495620_0082089_129_1037 302
101 3300046529 Ga0495652_0000009 Ga0495652_0000009_182048_182971 302
102 3300046533 Ga0495640_0050712 Ga0495640_0050712_968_1876 302
103 3300046557 Ga0495622_0000069 Ga0495622_0000069_86368_87276 302
104 3300046689 Ga0495613_0000324 Ga0495613_0000324_966_1874 302
105 3300046809 Ga0495600_0001252 Ga0495600_0001252_1557_2465 302
106 3300047317 Ga0495604_0001593 Ga0495604_0001593_7151_8059 302
107 3300047319 Ga0495674_0004050 Ga0495674_0004050_1033_1941 302
108 3300047472 Ga0495686_0008917 Ga0495686_0008917_1433_2341 302
109 3300048088 Ga0495602_0000038 Ga0495602_0000038_74049_74957 302
110 3300048905 Ga0496102_0120196 Ga0496102_0120196_602_1510 302
111 3300048906 Ga0496103_0027757 Ga0496103_0027757_2296_3204 302
112 3300048907 Ga0496104_0108935 Ga0496104_0108935_737_1645 302
113 3300048908 Ga0496105_0020070 Ga0496105_0020070_1239_2147 302
114 3300048913 Ga0496110_0000122 Ga0496110_0000122_11842_12750 302
115 3300048914 Ga0496111_0000037 Ga0496111_0000037_31143_32051 302
116 3300048918 Ga0496115_0000005 Ga0496115_0000005_64516_65436 302
117 3300053084 Ga0495595_0001807 Ga0495595_0001807_2572_3480 302
118 3300001977 JGI24746J21847_1000556 JGI24746J21847_10005563 303
119 3300002074 JGI24748J21848_1002016 JGI24748J21848_10020162 303
120 3300002239 JGI24034J26672_10000147 JGI24034J26672_1000014712 303
121 3300005329 Ga0070683_100003645 Ga0070683_10000364513 303
122 3300005329 Ga0070683_100092824 Ga0070683_1000928242 303
123 3300005329 Ga0070683_100275108 Ga0070683_1002751082 303
124 3300005333 Ga0070677_10000020 Ga0070677_100000205 303
125 3300005337 Ga0070682_100000009 Ga0070682_100000009229 303
126 3300005337 Ga0070682_100000032 Ga0070682_10000003297 303
127 3300005337 Ga0070682_100242916 Ga0070682_1002429162 303
128 3300005338 Ga0068868_100061700 Ga0068868_1000617002 303
129 3300005338 Ga0068868_100070495 Ga0068868_1000704953 303
130 3300005341 Ga0070691_10000003 Ga0070691_1000000344 303
131 3300005341 Ga0070691_10000348 Ga0070691_100003484 303
132 3300005344 Ga0070661_100000032 Ga0070661_10000003234 303
133 3300005345 Ga0070692_10018423 Ga0070692_100184232 303
134 3300005347 Ga0070668_100041672 Ga0070668_1000416723 303
135 3300005354 Ga0070675_100000022 Ga0070675_10000002237 303
136 3300005356 Ga0070674_100000075 Ga0070674_10000007514 303
137 3300005364 Ga0070673_100008528 Ga0070673_1000085284 303
138 3300005365 Ga0070688_100000031 Ga0070688_10000003155 303
139 3300005365 Ga0070688_100000194 Ga0070688_1000001948 303
140 3300005366 Ga0070659_100101582 Ga0070659_1001015822 303
141 3300005367 Ga0070667_100015838 Ga0070667_1000158387 303
142 3300005435 Ga0070714_100074920 Ga0070714_1000749204 303
143 3300005437 Ga0070710_10081672 Ga0070710_100816722 303
144 3300005439 Ga0070711_100028366 Ga0070711_1000283666 303
145 3300005441 Ga0070700_100083667 Ga0070700_1000836672 303
146 3300005441 Ga0070700_100099506 Ga0070700_1000995061 303
147 3300005455 Ga0070663_100033780 Ga0070663_1000337802 303
148 3300005455 Ga0070663_100282127 Ga0070663_1002821272 303
149 3300005456 Ga0070678_100011255 Ga0070678_1000112556 303
150 3300005457 Ga0070662_100000052 Ga0070662_10000005252 303
151 3300005458 Ga0070681_10010128 Ga0070681_100101282 303
152 3300005458 Ga0070681_10056853 Ga0070681_100568532 303
153 3300005466 Ga0070685_10000058 Ga0070685_1000005840 303
154 3300005466 Ga0070685_10000263 Ga0070685_1000026318 303
155 3300005530 Ga0070679_100000134 Ga0070679_10000013469 303
156 3300005530 Ga0070679_100019644 Ga0070679_1000196446 303
157 3300005535 Ga0070684_100039278 Ga0070684_1000392783 303
158 3300005535 Ga0070684_100080217 Ga0070684_1000802172 303
159 3300005535 Ga0070684_100084428 Ga0070684_1000844282 303
160 3300005535 Ga0070684_100099400 Ga0070684_1000994002 303
161 3300005535 Ga0070684_100521935 Ga0070684_1005219351 303
162 3300005539 Ga0068853_100015477 Ga0068853_1000154774 303
163 3300005543 Ga0070672_100000258 Ga0070672_10000025812 303
164 3300005545 Ga0070695_100203244 Ga0070695_1002032442 303
165 3300005547 Ga0070693_100003269 Ga0070693_1000032694 303
166 3300005548 Ga0070665_100000022 Ga0070665_100000022332 303
167 3300005548 Ga0070665_100001623 Ga0070665_10000162312 303
168 3300005549 Ga0070704_100091354 Ga0070704_1000913542 303
169 3300005578 Ga0068854_100000133 Ga0068854_10000013345 303
170 3300005578 Ga0068854_100023995 Ga0068854_1000239955 303
171 3300005614 Ga0068856_100000369 Ga0068856_1000003692 303
172 3300005614 Ga0068856_100008918 Ga0068856_1000089183 303
173 3300005615 Ga0070702_100112910 Ga0070702_1001129102 303
174 3300005616 Ga0068852_100000024 Ga0068852_10000002458 303
175 3300005618 Ga0068864_100000023 Ga0068864_100000023147 303
176 3300005718 Ga0068866_10000469 Ga0068866_1000046916 303
177 3300005834 Ga0068851_10000895 Ga0068851_1000089510 303
178 3300005834 Ga0068851_10004054 Ga0068851_100040542 303
179 3300005841 Ga0068863_100000110 Ga0068863_10000011093 303
180 3300005841 Ga0068863_100393201 Ga0068863_1003932012 303
181 3300005842 Ga0068858_100000150 Ga0068858_10000015085 303
182 3300005842 Ga0068858_100000329 Ga0068858_10000032942 303
183 3300005937 Ga0081455_10041806 Ga0081455_100418062 303
184 3300005985 Ga0081539_10001052 Ga0081539_1000105224 303
185 3300006163 Ga0070715_10145985 Ga0070715_101459851 303
186 3300006173 Ga0070716_100132062 Ga0070716_1001320621 303
187 3300006237 Ga0097621_100581550 Ga0097621_1005815501 303
188 3300006846 Ga0075430_100048532 Ga0075430_1000485322 303
189 3300006852 Ga0075433_10002915 Ga0075433_100029159 303
190 3300006852 Ga0075433_10003283 Ga0075433_1000328313 303
191 3300006881 Ga0068865_100000024 Ga0068865_10000002447 303
192 3300009098 Ga0105245_10000022 Ga0105245_10000022117 303
193 3300009098 Ga0105245_10001178 Ga0105245_1000117825 303
194 3300009098 Ga0105245_10008000 Ga0105245_100080007 303
195 3300009101 Ga0105247_10000064 Ga0105247_1000006454 303
196 3300009101 Ga0105247_10072683 Ga0105247_100726832 303
197 3300009148 Ga0105243_10012040 Ga0105243_100120405 303
198 3300009176 Ga0105242_10000123 Ga0105242_1000012371 303
199 3300009176 Ga0105242_10013245 Ga0105242_100132451 303
200 3300009176 Ga0105242_10064933 Ga0105242_100649331 303
201 3300009177 Ga0105248_10000017 Ga0105248_1000001741 303
202 3300009551 Ga0105238_10000016 Ga0105238_100000169 303
203 3300009553 Ga0105249_10000181 Ga0105249_1000018123 303
204 3300010375 Ga0105239_10288660 Ga0105239_102886602 303
205 3300011119 Ga0105246_10306240 Ga0105246_103062402 303
206 3300013102 Ga0157371_10001783 Ga0157371_100017836 303
207 3300013104 Ga0157370_10049032 Ga0157370_100490323 303
208 3300013105 Ga0157369_10000068 Ga0157369_1000006884 303
209 3300013296 Ga0157374_10700813 Ga0157374_107008131 303
210 3300013297 Ga0157378_10000656 Ga0157378_1000065632 303
211 3300013297 Ga0157378_10087628 Ga0157378_100876282 303
212 3300013308 Ga0157375_10000126 Ga0157375_1000012677 303
213 3300014325 Ga0163163_10438413 Ga0163163_104384132 303
214 3300014326 Ga0157380_10104533 Ga0157380_101045332 303
215 3300014745 Ga0157377_10077334 Ga0157377_100773341 303
216 3300014968 Ga0157379_10031333 Ga0157379_100313332 303
217 3300014968 Ga0157379_10088250 Ga0157379_100882503 303
218 3300014969 Ga0157376_10093379 Ga0157376_100933792 303
219 3300017792 Ga0163161_10000013 Ga0163161_10000013108 303
220 3300017792 Ga0163161_10052079 Ga0163161_100520792 303
221 3300025321 Ga0207656_10000274 Ga0207656_100002746 303
222 3300025321 Ga0207656_10004135 Ga0207656_100041354 303
223 3300025893 Ga0207682_10000050 Ga0207682_1000005043 303
224 3300025899 Ga0207642_10000181 Ga0207642_1000018115 303
225 3300025900 Ga0207710_10000165 Ga0207710_1000016540 303
226 3300025903 Ga0207680_10011411 Ga0207680_100114113 303
227 3300025903 Ga0207680_10126296 Ga0207680_101262962 303
228 3300025909 Ga0207705_10100545 Ga0207705_101005452 303
229 3300025912 Ga0207707_10035644 Ga0207707_100356445 303
230 3300025912 Ga0207707_10036138 Ga0207707_100361384 303
231 3300025916 Ga0207663_10066167 Ga0207663_100661672 303
232 3300025920 Ga0207649_10000015 Ga0207649_100000152 303
233 3300025921 Ga0207652_10001289 Ga0207652_100012893 303
234 3300025921 Ga0207652_10003408 Ga0207652_1000340811 303
235 3300025924 Ga0207694_10000012 Ga0207694_10000012412 303
236 3300025926 Ga0207659_10000030 Ga0207659_1000003099 303
237 3300025927 Ga0207687_10000025 Ga0207687_1000002579 303
238 3300025927 Ga0207687_10000039 Ga0207687_10000039116 303
239 3300025927 Ga0207687_10006005 Ga0207687_100060054 303
240 3300025927 Ga0207687_10007709 Ga0207687_100077093 303
241 3300025929 Ga0207664_10009739 Ga0207664_100097392 303
242 3300025932 Ga0207690_10015961 Ga0207690_100159614 303
243 3300025933 Ga0207706_10000137 Ga0207706_1000013731 303
244 3300025934 Ga0207686_10000066 Ga0207686_1000006635 303
245 3300025934 Ga0207686_10000592 Ga0207686_1000059214 303
246 3300025934 Ga0207686_10050440 Ga0207686_100504401 303
247 3300025934 Ga0207686_10105615 Ga0207686_101056152 303
248 3300025935 Ga0207709_10014890 Ga0207709_100148902 303
249 3300025937 Ga0207669_10000091 Ga0207669_1000009141 303
250 3300025937 Ga0207669_10299513 Ga0207669_102995132 303
251 3300025938 Ga0207704_10000054 Ga0207704_1000005434 303
252 3300025939 Ga0207665_10131145 Ga0207665_101311451 303
253 3300025940 Ga0207691_10000871 Ga0207691_1000087110 303
254 3300025941 Ga0207711_10000011 Ga0207711_1000001188 303
255 3300025944 Ga0207661_10004497 Ga0207661_1000449713 303
256 3300025944 Ga0207661_10053194 Ga0207661_100531945 303
257 3300025944 Ga0207661_10470190 Ga0207661_104701901 303
258 3300025960 Ga0207651_10021515 Ga0207651_100215155 303
259 3300025961 Ga0207712_10000067 Ga0207712_10000067123 303
260 3300025972 Ga0207668_10072576 Ga0207668_100725762 303
261 3300025981 Ga0207640_10000147 Ga0207640_1000014744 303
262 3300025981 Ga0207640_10053916 Ga0207640_100539162 303
263 3300025986 Ga0207658_10130823 Ga0207658_101308232 303
264 3300026023 Ga0207677_10043277 Ga0207677_100432772 303
265 3300026023 Ga0207677_10066262 Ga0207677_100662621 303
266 3300026035 Ga0207703_10000070 Ga0207703_1000007090 303
267 3300026035 Ga0207703_10000122 Ga0207703_1000012229 303
268 3300026067 Ga0207678_10019235 Ga0207678_100192356 303
269 3300026075 Ga0207708_10061704 Ga0207708_100617042 303
270 3300026078 Ga0207702_10000326 Ga0207702_1000032651 303
271 3300026078 Ga0207702_10000557 Ga0207702_1000055742 303
272 3300026078 Ga0207702_10012405 Ga0207702_100124052 303
273 3300026078 Ga0207702_10232381 Ga0207702_102323812 303
274 3300026088 Ga0207641_10000065 Ga0207641_10000065162 303
275 3300026088 Ga0207641_10019506 Ga0207641_100195065 303
276 3300026095 Ga0207676_10000025 Ga0207676_10000025131 303
277 3300026118 Ga0207675_100581400 Ga0207675_1005814002 303
278 3300026121 Ga0207683_10020523 Ga0207683_100205236 303
279 3300026142 Ga0207698_10000014 Ga0207698_10000014114 303
280 3300028379 Ga0268266_10000029 Ga0268266_10000029122 303
281 3300028379 Ga0268266_10000422 Ga0268266_1000042261 303
282 3300028379 Ga0268266_10000973 Ga0268266_100009735 303
283 3300028379 Ga0268266_10111563 Ga0268266_101115633 303
284 3300028556 Ga0265337_1000730 Ga0265337_100073013 303
285 3300028558 Ga0265326_10000040 Ga0265326_1000004090 303
286 3300028654 Ga0265322_10000012 Ga0265322_10000012113 303
287 3300028800 Ga0265338_10000156 Ga0265338_10000156101 303
288 3300029957 Ga0265324_10000567 Ga0265324_1000056720 303
289 3300031239 Ga0265328_10008624 Ga0265328_100086244 303
290 3300031240 Ga0265320_10000001 Ga0265320_10000001811 303
291 3300031242 Ga0265329_10007672 Ga0265329_100076723 303
292 3300031249 Ga0265339_10021395 Ga0265339_100213952 303
293 3300031250 Ga0265331_10031968 Ga0265331_100319683 303
294 3300031251 Ga0265327_10000003 Ga0265327_10000003811 303
295 3300031344 Ga0265316_10023963 Ga0265316_100239636 303
296 3300031711 Ga0265314_10000334 Ga0265314_1000033450 303
297 3300036401 Ga0373937_0033886 Ga0373937_0033886_130_1041 303
298 3300041491 Ga0451833_0445893 Ga0451833_0445893_428_1339 303
299 3300041512 Ga0451853_1358421 Ga0451853_1358421_1171_2154 303
300 3300044694 Ga0466963_0000257 Ga0466963_0000257_18095_19006 303
301 3300044694 Ga0466963_0130248 Ga0466963_0130248_661_1572 303
302 3300044842 Ga0466957_0000193 Ga0466957_0000193_2987_3898 303
303 3300044842 Ga0466957_0173007 Ga0466957_0173007_23_934 303
304 3300045976 Ga0466967_0207368 Ga0466967_0207368_509_1423 303
305 3300046454 Ga0495592_0000424 Ga0495592_0000424_18881_19792 303
306 3300046455 Ga0495603_0000083 Ga0495603_0000083_7963_8874 303
307 3300046455 Ga0495603_0004890 Ga0495603_0004890_3962_4873 303
308 3300046459 Ga0495629_0001145 Ga0495629_0001145_18300_19223 303
309 3300046459 Ga0495629_0005665 Ga0495629_0005665_7820_8743 303
310 3300046459 Ga0495629_0050304 Ga0495629_0050304_1609_2520 303
311 3300046459 Ga0495629_0190161 Ga0495629_0190161_61_972 303
312 3300046461 Ga0495641_0000010 Ga0495641_0000010_45436_46347 303
313 3300046462 Ga0495651_0073968 Ga0495651_0073968_1145_2056 303
314 3300046463 Ga0495653_0006069 Ga0495653_0006069_7768_8679 303
315 3300046463 Ga0495653_0079686 Ga0495653_0079686_153_1076 303
316 3300046473 Ga0495582_0000006 Ga0495582_0000006_85833_86744 303
317 3300046476 Ga0495662_0000178 Ga0495662_0000178_13706_14617 303
318 3300046507 Ga0495606_0000283 Ga0495606_0000283_10069_10980 303
319 3300046511 Ga0495608_0000042 Ga0495608_0000042_22789_23763 303
320 3300046511 Ga0495608_0003416 Ga0495608_0003416_1479_2390 303
321 3300046511 Ga0495608_0007777 Ga0495608_0007777_6022_6933 303
322 3300046514 Ga0495618_0000037 Ga0495618_0000037_80662_81573 303
323 3300046515 Ga0495620_0000731 Ga0495620_0000731_3265_4248 303
324 3300046516 Ga0495628_0000265 Ga0495628_0000265_23094_24005 303
325 3300046516 Ga0495628_0082001 Ga0495628_0082001_968_1879 303
326 3300046516 Ga0495628_0140673 Ga0495628_0140673_323_1306 303
327 3300046516 Ga0495628_0159635 Ga0495628_0159635_633_1544 303
328 3300046517 Ga0495630_0000148 Ga0495630_0000148_3509_4420 303
329 3300046517 Ga0495630_0000586 Ga0495630_0000586_11613_12524 303
330 3300046529 Ga0495652_0039820 Ga0495652_0039820_1876_2787 303
331 3300046533 Ga0495640_0003678 Ga0495640_0003678_8178_9089 303
332 3300046535 Ga0495586_0008020 Ga0495586_0008020_3527_4438 303
333 3300046535 Ga0495586_0167990 Ga0495586_0167990_90_1001 303
334 3300046536 Ga0495587_0002629 Ga0495587_0002629_9913_10824 303
335 3300046536 Ga0495587_0015546 Ga0495587_0015546_2134_3045 303
336 3300046537 Ga0495598_0001441 Ga0495598_0001441_1860_2771 303
337 3300046539 Ga0495621_0005233 Ga0495621_0005233_1923_2834 303
338 3300046543 Ga0495645_0016069 Ga0495645_0016069_1090_2001 303
339 3300046543 Ga0495645_0080076 Ga0495645_0080076_489_1400 303
340 3300046559 Ga0495667_0000109 Ga0495667_0000109_15826_16749 303
341 3300046615 Ga0495656_0003522 Ga0495656_0003522_1200_2111 303
342 3300046642 Ga0495634_0000021 Ga0495634_0000021_51078_51989 303
343 3300046642 Ga0495634_0000951 Ga0495634_0000951_17396_18307 303
344 3300046642 Ga0495634_0142664 Ga0495634_0142664_217_1128 303
345 3300046660 Ga0495625_0000109 Ga0495625_0000109_29830_30741 303
346 3300046663 Ga0495635_0000006 Ga0495635_0000006_24714_25625 303
347 3300046663 Ga0495635_0038592 Ga0495635_0038592_1955_2866 303
348 3300046663 Ga0495635_0081100 Ga0495635_0081100_245_1156 303
349 3300046674 Ga0495588_0098562 Ga0495588_0098562_588_1499 303
350 3300046675 Ga0495657_0000040 Ga0495657_0000040_22789_23763 303
351 3300046679 Ga0495623_0091266 Ga0495623_0091266_504_1415 303
352 3300046681 Ga0495647_0002786 Ga0495647_0002786_917_1828 303
353 3300046681 Ga0495647_0034003 Ga0495647_0034003_512_1423 303
354 3300046683 Ga0495658_0000027 Ga0495658_0000027_53691_54602 303
355 3300046684 Ga0495669_0000132 Ga0495669_0000132_22892_23803 303
356 3300046689 Ga0495613_0000190 Ga0495613_0000190_18779_19690 303
357 3300046690 Ga0495624_0000005 Ga0495624_0000005_44580_45491 303
358 3300046690 Ga0495624_0000031 Ga0495624_0000031_2798_3709 303
359 3300046690 Ga0495624_0037983 Ga0495624_0037983_1279_2190 303
360 3300046691 Ga0495670_0041667 Ga0495670_0041667_914_1825 303
361 3300046694 Ga0495649_0040054 Ga0495649_0040054_731_1642 303
362 3300046809 Ga0495600_0023088 Ga0495600_0023088_1727_2638 303
363 3300047317 Ga0495604_0000636 Ga0495604_0000636_8993_9904 303
364 3300047320 Ga0495672_0142528 Ga0495672_0142528_227_1138 303
365 3300047321 Ga0495676_0000209 Ga0495676_0000209_7914_8825 303
366 3300047321 Ga0495676_0000624 Ga0495676_0000624_13989_14912 303
367 3300047321 Ga0495676_0002889 Ga0495676_0002889_8456_9367 303
368 3300047322 Ga0495680_0000094 Ga0495680_0000094_69711_70622 303
369 3300047322 Ga0495680_0000332 Ga0495680_0000332_51225_52136 303
370 3300047322 Ga0495680_0010267 Ga0495680_0010267_984_1907 303
371 3300047322 Ga0495680_0124091 Ga0495680_0124091_441_1352 303
372 3300047444 Ga0495675_0000051 Ga0495675_0000051_22761_23735 303
373 3300047446 Ga0495679_044460 Ga0495679_044460_408_1319 303
374 3300047447 Ga0495685_042063 Ga0495685_042063_255_1166 303
375 3300047673 Ga0495593_0058369 Ga0495593_0058369_112_1023 303
376 3300048088 Ga0495602_0002031 Ga0495602_0002031_18503_19414 303
377 3300048088 Ga0495602_0133551 Ga0495602_0133551_74_985 303
378 3300048088 Ga0495602_0221192 Ga0495602_0221192_158_1069 303
379 3300048903 Ga0496100_0000006 Ga0496100_0000006_252942_253853 303
380 3300048903 Ga0496100_0000028 Ga0496100_0000028_51213_52136 303
381 3300048904 Ga0496101_0000005 Ga0496101_0000005_201212_202135 303
382 3300048904 Ga0496101_0000009 Ga0496101_0000009_252942_253853 303
383 3300048905 Ga0496102_0000021 Ga0496102_0000021_126384_127307 303
384 3300048905 Ga0496102_0031863 Ga0496102_0031863_3064_3975 303
385 3300048906 Ga0496103_0000001 Ga0496103_0000001_468600_469523 303
386 3300048906 Ga0496103_0023273 Ga0496103_0023273_2568_3479 303
387 3300048906 Ga0496103_0056705 Ga0496103_0056705_1046_1957 303
388 3300048907 Ga0496104_0000008 Ga0496104_0000008_433619_434530 303
389 3300048907 Ga0496104_0000029 Ga0496104_0000029_143576_144487 303
390 3300048908 Ga0496105_0000002 Ga0496105_0000002_143576_144487 303
391 3300048908 Ga0496105_0000003 Ga0496105_0000003_433619_434530 303
392 3300048908 Ga0496105_0000876 Ga0496105_0000876_18034_18957 303
393 3300048908 Ga0496105_0048057 Ga0496105_0048057_1532_2443 303
394 3300048909 Ga0496106_0000070 Ga0496106_0000070_20109_21032 303
395 3300048909 Ga0496106_0000090 Ga0496106_0000090_51390_52301 303
396 3300048909 Ga0496106_0000101 Ga0496106_0000101_22844_23755 303
397 3300048910 Ga0496107_0000004 Ga0496107_0000004_201429_202352 303
398 3300048910 Ga0496107_0000015 Ga0496107_0000015_149170_150081 303
399 3300048910 Ga0496107_0035771 Ga0496107_0035771_474_1385 303
400 3300048910 Ga0496107_0173708 Ga0496107_0173708_267_1178 303
401 3300048911 Ga0496108_0000004 Ga0496108_0000004_133714_134625 303
402 3300048911 Ga0496108_0000042 Ga0496108_0000042_63839_64750 303
403 3300048911 Ga0496108_0005504 Ga0496108_0005504_1718_2629 303
404 3300048911 Ga0496108_0038231 Ga0496108_0038231_1400_2311 303
405 3300048912 Ga0496109_0000034 Ga0496109_0000034_96478_97389 303
406 3300048912 Ga0496109_0000036 Ga0496109_0000036_19349_20260 303
407 3300048912 Ga0496109_0000391 Ga0496109_0000391_5625_6536 303
408 3300048912 Ga0496109_0010089 Ga0496109_0010089_125_1036 303
409 3300048912 Ga0496109_0252459 Ga0496109_0252459_588_1499 303
410 3300048913 Ga0496110_0007589 Ga0496110_0007589_4012_4923 303
411 3300048913 Ga0496110_0025709 Ga0496110_0025709_575_1486 303
412 3300048913 Ga0496110_0059015 Ga0496110_0059015_1441_2364 303
413 3300048914 Ga0496111_0224791 Ga0496111_0224791_464_1375 303
414 3300048915 Ga0496112_0000002 Ga0496112_0000002_153513_154424 303
415 3300048915 Ga0496112_0010244 Ga0496112_0010244_3440_4399 303
416 3300048916 Ga0496113_0000002 Ga0496113_0000002_90275_91234 303
417 3300048916 Ga0496113_0018796 Ga0496113_0018796_2971_3882 303
418 3300048916 Ga0496113_0030978 Ga0496113_0030978_533_1444 303
419 3300048916 Ga0496113_0164654 Ga0496113_0164654_385_1296 303
420 3300048917 Ga0496114_0000159 Ga0496114_0000159_32348_33259 303
421 3300048917 Ga0496114_0005005 Ga0496114_0005005_7027_7938 303
422 3300048917 Ga0496114_0131161 Ga0496114_0131161_1073_1984 303
423 3300048917 Ga0496114_0272529 Ga0496114_0272529_109_1020 303
424 3300048918 Ga0496115_0000257 Ga0496115_0000257_32348_33259 303
425 3300048919 Ga0496116_0000138 Ga0496116_0000138_109459_110370 303
426 3300048921 Ga0496118_0001277 Ga0496118_0001277_6705_7616 303
427 3300048921 Ga0496118_0035997 Ga0496118_0035997_2319_3230 303
428 3300048921 Ga0496118_0149978 Ga0496118_0149978_62_973 303
429 3300048922 Ga0496119_0003660 Ga0496119_0003660_2244_3155 303
430 3300048922 Ga0496119_0021239 Ga0496119_0021239_2331_3242 303
431 3300048922 Ga0496119_0164991 Ga0496119_0164991_168_1091 303
432 3300048923 Ga0496120_0002330 Ga0496120_0002330_12695_13606 303
433 3300048924 Ga0496121_0006772 Ga0496121_0006772_1420_2331 303
434 3300048924 Ga0496121_0095795 Ga0496121_0095795_1317_2228 303
435 3300048928 Ga0496125_0028985 Ga0496125_0028985_972_1883 303
436 3300048928 Ga0496125_0074977 Ga0496125_0074977_1188_2099 303
437 3300048929 Ga0496126_0007436 Ga0496126_0007436_7883_8794 303
438 3300048929 Ga0496126_0045157 Ga0496126_0045157_1670_2581 303
439 3300048929 Ga0496126_0182320 Ga0496126_0182320_523_1434 303
440 3300049568 Ga0501031_0003336 Ga0501031_0003336_5078_5989 303
441 3300049569 Ga0501032_0009040 Ga0501032_0009040_1080_1991 303
442 3300049570 Ga0501033_0005116 Ga0501033_0005116_4250_5161 303
443 3300049571 Ga0501034_0022387 Ga0501034_0022387_4164_5075 303
444 3300049571 Ga0501034_0204127 Ga0501034_0204127_128_1039 303
445 3300049572 Ga0501036_0073446 Ga0501036_0073446_870_1781 303
446 3300049573 Ga0501037_0009327 Ga0501037_0009327_789_1700 303
447 3300049574 Ga0501038_0014268 Ga0501038_0014268_5235_6146 303
448 3300049575 Ga0501039_0045896 Ga0501039_0045896_958_1869 303
449 3300049575 Ga0501039_0089346 Ga0501039_0089346_609_1523 303
450 3300049576 Ga0501040_0017812 Ga0501040_0017812_857_1768 303
451 3300049578 Ga0501042_0024380 Ga0501042_0024380_907_1818 303
452 3300049578 Ga0501042_0044650 Ga0501042_0044650_2001_2912 303
453 3300049578 Ga0501042_0056709 Ga0501042_0056709_1181_2104 303
454 3300049579 Ga0501043_0001141 Ga0501043_0001141_815_1726 303
455 3300049579 Ga0501043_0217466 Ga0501043_0217466_101_1012 303
456 3300049580 Ga0501046_0009482 Ga0501046_0009482_5056_5967 303
457 3300049581 Ga0501047_0003662 Ga0501047_0003662_12266_13177 303
458 3300049581 Ga0501047_0077493 Ga0501047_0077493_1364_2275 303
459 3300049581 Ga0501047_0153051 Ga0501047_0153051_929_1840 303
460 3300049581 Ga0501047_0249364 Ga0501047_0249364_291_1202 303
461 3300049582 Ga0501048_0009669 Ga0501048_0009669_5276_6187 303
462 3300049583 Ga0501067_0034805 Ga0501067_0034805_558_1469 303
463 3300049584 Ga0501068_0032152 Ga0501068_0032152_1619_2530 303
464 3300049584 Ga0501068_0033339 Ga0501068_0033339_1329_2252 303
465 3300049585 Ga0501069_0002690 Ga0501069_0002690_7915_8826 303
466 3300049585 Ga0501069_0024220 Ga0501069_0024220_1369_2280 303
467 3300049586 Ga0501070_0005806 Ga0501070_0005806_4359_5270 303
468 3300049587 Ga0501071_0051249 Ga0501071_0051249_1543_2454 303
469 3300049588 Ga0501072_0045489 Ga0501072_0045489_1688_2602 303
470 3300049589 Ga0501073_0040030 Ga0501073_0040030_1244_2155 303
471 3300049590 Ga0501074_0008960 Ga0501074_0008960_5196_6107 303
472 3300049591 Ga0501075_0004446 Ga0501075_0004446_5451_6362 303
473 3300049741 Ga0501079_0010469 Ga0501079_0010469_5255_6166 303
474 3300049742 Ga0501080_0059103 Ga0501080_0059103_1591_2502 303
475 3300049742 Ga0501080_0246741 Ga0501080_0246741_264_1175 303
476 3300049742 Ga0501080_0343279 Ga0501080_0343279_89_1000 303
477 3300049743 Ga0501081_0059098 Ga0501081_0059098_946_1857 303
478 3300049743 Ga0501081_0160128 Ga0501081_0160128_489_1403 303
479 3300049744 Ga0501083_0021607 Ga0501083_0021607_1053_1964 303
480 3300049744 Ga0501083_0023580 Ga0501083_0023580_1108_2019 303
481 3300049822 Ga0501035_0007460 Ga0501035_0007460_4197_5108 303
482 3300049823 Ga0501044_0007015 Ga0501044_0007015_7111_8022 303
483 3300049823 Ga0501044_0203844 Ga0501044_0203844_918_1829 303
484 3300049823 Ga0501044_0283305 Ga0501044_0283305_156_1067 303
485 3300049824 Ga0501045_0049109 Ga0501045_0049109_1784_2695 303
486 3300050509 nmdc:mga0qj67_59238_c1 nmdc:mga0qj67_59238_c1_704_1615 303
487 3300050515 nmdc:mga0a205_15_c1 nmdc:mga0a205_15_c1_11531_12442 303
488 3300050515 nmdc:mga0a205_3790_c1 nmdc:mga0a205_3790_c1_9692_10603 303
489 3300053077 Ga0495601_0000019 Ga0495601_0000019_132179_133090 303
490 3300053077 Ga0495601_0000059 Ga0495601_0000059_14457_15368 303
491 3300053077 Ga0495601_0018526 Ga0495601_0018526_2763_3686 303
492 3300053078 Ga0495612_0001133 Ga0495612_0001133_1795_2706 303
493 3300053078 Ga0495612_0001929 Ga0495612_0001929_923_1834 303
494 3300053078 Ga0495612_0058792 Ga0495612_0058792_599_1510 303
495 3300053083 Ga0495655_0000008 Ga0495655_0000008_14313_15236 303
496 3300053084 Ga0495595_0000009 Ga0495595_0000009_169277_170251 303
497 3300053084 Ga0495595_0000213 Ga0495595_0000213_11698_12609 303
498 3300053085 Ga0495619_0000001 Ga0495619_0000001_18059_18970 303
499 3300053085 Ga0495619_0000057 Ga0495619_0000057_92136_93110 303
500 3300053085 Ga0495619_0000069 Ga0495619_0000069_11583_12494 303
501 3300053085 Ga0495619_0000347 Ga0495619_0000347_19385_20296 303
502 3300053085 Ga0495619_0002458 Ga0495619_0002458_9257_10168 303
503 3300053085 Ga0495619_0005611 Ga0495619_0005611_5621_6532 303
504 3300053085 Ga0495619_0011363 Ga0495619_0011363_2294_3205 303
505 3300053085 Ga0495619_0090877 Ga0495619_0090877_359_1282 303
506 3300053094 Ga0500566_0029398 Ga0500566_0029398_1069_1992 303
507 3300053096 Ga0500641_0009782 Ga0500641_0009782_1048_1959 303
508 3300053119 Ga0500595_044606 Ga0500595_044606_249_1160 303
509 3300053123 Ga0500614_001627 Ga0500614_001627_3608_4519 303
510 3300053129 Ga0500628_000043 Ga0500628_000043_29861_30784 303
511 3300054114 Ga0501084_0079345 Ga0501084_0079345_611_1522 303
512 3300060353 Ga0501082_0044209 Ga0501082_0044209_2083_2994 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

86

314

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2br6-assembly1.cif.gz_A crystal structure of quorum-quenching n-acyl homoserine lactone lactonase 0.8853 16 299
4j5h-assembly1.cif.gz_A crystal structure of b. thuringiensis aiia mutant f107w with n-decanoyl-l-homoserine bound at the active site 0.8832 22 299
5eht-assembly1.cif.gz_A indirect contributions of mutations underlie optimization of new enzyme function 0.8806 16 299
2btn-assembly1.cif.gz_A crystal structure and catalytic mechanism of the quorum-quenching n- acyl homoserine lactone hydrolase 0.8798 16 299
3dha-assembly1.cif.gz_A an ultral high resolution structure of n-acyl homoserine lactone hydrolase with the product n-hexanoyl-l-homoserine bound at an alternative site 0.8696 17 299
ID Description Score Start End Superfamily
5ehtA01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8793 16 295 3.60.15.10
5ehtA01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8726 16 295 3.60.15.10
af_P9WLD7_51_309_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8487 25 296 3.60.15.10
6n9qD00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.835 21 303 3.60.15.10
6n9qD00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8293 21 303 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A538A8T2-F1-model_v4 N-acyl homoserine lactonase family protein 0.9759 1 303
AF-A0A538A8T2-F1-model_v4 N-acyl homoserine lactonase family protein 0.9727 1 303
AF-A0A6I2Y8S9-F1-model_v4 MBL fold metallo-hydrolase 0.9584 5 298 GO:0016787
AF-A0A5C7Q2I0-F1-model_v4 N-acyl homoserine lactonase family protein 0.9527 63 297
AF-A0A534QS42-F1-model_v4 N-acyl homoserine lactonase family protein 0.9499 34 299

Feature Viewer

pLDDT pTM Quality
95.64 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map