F457345

General Info

Members Datasets Scaffolds Average Seq Length
511 289 511 212

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0078342|Ga0501042_0078342_462_1151
Length 229
Sequence MIVAMSEVVDIERDGVAAARGALERTIAGGGVAVFPADGLYGLACDPLDAAAIARIHEIKGRDEGKPSAVMYFSPLAMRELVEGFGPRTRDAVGALLPGPLTLVVANPQHRYPLACREDPERLGIRLIEGPLAGAMCPLFQTSANRSGEPAAGSFEQIPAQIVDEVDLAIDGGELTGQPSSVLDLTAFDRSGEWWVLREGAVSSAELEQRLADLTSAAQSGPGGSASSR

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
141 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
142 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
143 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
212 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
275 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
280 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
283 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
284 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
285 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
286 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.68
Nodule 0
Rhizoplane 9.98
Rhizosphere 82
Stem 0
Stem Tuber 0
Unclassified 2.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000325 3300001977 Bacteria 6838
2 JGI24751J29686_10010572 3300002459 Bacteria 1902
3 Ga0070683_100007429 3300005329 Bacteria 9261
4 Ga0070683_100021869 3300005329 Bacteria 5709
5 Ga0070683_100120233 3300005329 Bacteria 2481
6 Ga0070677_10000057 3300005333 Bacteria 34822
7 Ga0068869_100271279 3300005334 Bacteria 1361
8 Ga0070666_10235173 3300005335 Bacteria 1295
9 Ga0070680_100059546 3300005336 Bacteria 3125
10 Ga0070682_100000013 3300005337 Bacteria 254641
11 Ga0068868_100000151 3300005338 Bacteria 44963
12 Ga0068868_100289706 3300005338 Bacteria 1388
13 Ga0070660_100001214 3300005339 Bacteria 17496
14 Ga0070687_100268044 3300005343 Bacteria 1069
15 Ga0070661_100098151 3300005344 Bacteria 2176
16 Ga0070668_100131231 3300005347 Bacteria 2011
17 Ga0070668_100205753 3300005347 Bacteria 1617
18 Ga0070675_100011302 3300005354 Bacteria 6987
19 Ga0070674_100000082 3300005356 Bacteria 44418
20 Ga0070674_100025824 3300005356 Bacteria 3828
21 Ga0070673_100017272 3300005364 Bacteria 5125
22 Ga0070688_100109917 3300005365 Bacteria 1832
23 Ga0070688_100171538 3300005365 Bacteria 1498
24 Ga0070659_100188737 3300005366 Bacteria 1693
25 Ga0070667_100323287 3300005367 Bacteria 1392
26 Ga0070714_100067896 3300005435 Bacteria 3076
27 Ga0070701_10057983 3300005438 Bacteria 2031
28 Ga0070711_100003694 3300005439 Bacteria 8959
29 Ga0070711_100130638 3300005439 Bacteria 1870
30 Ga0070705_100398070 3300005440 Unclassified 1019
31 Ga0070700_100009313 3300005441 Bacteria 5382
32 Ga0070700_100110610 3300005441 Bacteria 1826
33 Ga0070663_100011872 3300005455 Bacteria 5490
34 Ga0070663_100019356 3300005455 Bacteria 4484
35 Ga0070663_100033112 3300005455 Bacteria 3568
36 Ga0070678_100144185 3300005456 Bacteria 1910
37 Ga0070678_100493528 3300005456 Bacteria 1079
38 Ga0070662_100000016 3300005457 Bacteria 105820
39 Ga0070662_100004751 3300005457 Bacteria 8601
40 Ga0070681_10037206 3300005458 Bacteria 4885
41 Ga0068867_100005240 3300005459 Bacteria 9151
42 Ga0070685_10060157 3300005466 Bacteria 2220
43 Ga0070679_100001299 3300005530 Bacteria 22062
44 Ga0070679_100034564 3300005530 Bacteria 5010
45 Ga0070684_100007568 3300005535 Bacteria 8458
46 Ga0068853_100009433 3300005539 Bacteria 7863
47 Ga0070672_100055041 3300005543 Bacteria 3116
48 Ga0070672_100295045 3300005543 Bacteria 1373
49 Ga0070686_100005659 3300005544 Bacteria 6922
50 Ga0070693_100044347 3300005547 Bacteria 2516
51 Ga0070693_100059710 3300005547 Bacteria 2211
52 Ga0070665_100000244 3300005548 Bacteria 90284
53 Ga0070664_100432858 3300005564 Bacteria 1206
54 Ga0068857_100093174 3300005577 Bacteria 2698
55 Ga0068854_100014034 3300005578 Bacteria 5273
56 Ga0068854_100111254 3300005578 Bacteria 2066
57 Ga0068856_100002478 3300005614 Bacteria 19005
58 Ga0070702_100021814 3300005615 Bacteria 3377
59 Ga0068859_100694055 3300005617 Bacteria 1109
60 Ga0068864_100000045 3300005618 Bacteria 154739
61 Ga0068866_10000001 3300005718 Bacteria 519680
62 Ga0068866_10000170 3300005718 Bacteria 30223
63 Ga0068861_100156559 3300005719 Unclassified 1875
64 Ga0068851_10004889 3300005834 Bacteria 6070
65 Ga0068870_10376318 3300005840 Bacteria 918
66 Ga0068870_10491298 3300005840 Unclassified 816
67 Ga0068863_100044804 3300005841 Bacteria 4198
68 Ga0068863_100233995 3300005841 Bacteria 1772
69 Ga0068858_100000450 3300005842 Bacteria 43091
70 Ga0068858_100520961 3300005842 Bacteria 1150
71 Ga0068860_100003539 3300005843 Bacteria 16070
72 Ga0068860_100236254 3300005843 Bacteria 1777
73 Ga0068862_100001684 3300005844 Bacteria 20024
74 Ga0068862_100056118 3300005844 Bacteria 3374
75 Ga0081455_10029974 3300005937 Bacteria 4951
76 Ga0081455_10078207 3300005937 Bacteria 2718
77 Ga0081455_10103025 3300005937 Bacteria 2287
78 Ga0081455_10124105 3300005937 Bacteria 2030
79 Ga0081455_10181632 3300005937 Bacteria 1592
80 Ga0081455_10283109 3300005937 Unclassified 1197
81 Ga0081538_10000030 3300005981 Bacteria 124321
82 Ga0081538_10000426 3300005981 Bacteria 47299
83 Ga0081540_1001151 3300005983 Bacteria 23281
84 Ga0081540_1108183 3300005983 Unclassified 1182
85 Ga0081539_10005112 3300005985 Bacteria 13728
86 Ga0081539_10192870 3300005985 Unclassified 947
87 Ga0075365_10000463 3300006038 Bacteria 15223
88 Ga0075365_10000477 3300006038 Bacteria 15128
89 Ga0075365_10398371 3300006038 Bacteria 971
90 Ga0075365_10629353 3300006038 Bacteria 759
91 Ga0075363_100006477 3300006048 Bacteria 5321
92 Ga0075363_100031179 3300006048 Bacteria 2763
93 Ga0075363_100375852 3300006048 Bacteria 832
94 Ga0075364_10016871 3300006051 Bacteria 4550
95 Ga0075364_10049570 3300006051 Bacteria 2739
96 Ga0070715_10000001 3300006163 Bacteria 693690
97 Ga0070715_10220950 3300006163 Bacteria 974
98 Ga0070716_100050897 3300006173 Bacteria 2353
99 Ga0070712_100004037 3300006175 Bacteria 9007
100 Ga0075367_10103137 3300006178 Bacteria 1745
101 Ga0075367_10128059 3300006178 Bacteria 1568
102 Ga0075367_10490911 3300006178 Unclassified 779
103 Ga0075428_101149626 3300006844 Bacteria 819
104 Ga0075430_100063205 3300006846 Bacteria 3110
105 Ga0075431_100098476 3300006847 Bacteria 3019
106 Ga0075433_10000478 3300006852 Bacteria 26067
107 Ga0075434_100519509 3300006871 Bacteria 1211
108 Ga0068865_100004502 3300006881 Bacteria 8408
109 Ga0097620_100693963 3300006931 Bacteria 1109
110 Ga0111539_10350557 3300009094 Unclassified 1718
111 Ga0105245_10000016 3300009098 Bacteria 204372
112 Ga0105245_10000619 3300009098 Bacteria 32213
113 Ga0105245_10008319 3300009098 Bacteria 9067
114 Ga0114129_10484097 3300009147 Bacteria 1618
115 Ga0114129_10811518 3300009147 Bacteria 1193
116 Ga0105243_10026616 3300009148 Bacteria 4428
117 Ga0105243_10084276 3300009148 Bacteria 2603
118 Ga0105242_10017273 3300009176 Bacteria 5619
119 Ga0105242_10881484 3300009176 Unclassified 893
120 Ga0105237_10340962 3300009545 Bacteria 1503
121 Ga0105238_10000201 3300009551 Bacteria 66092
122 Ga0105238_10330107 3300009551 Bacteria 1512
123 Ga0105249_10000068 3300009553 Bacteria 148594
124 Ga0105249_10051297 3300009553 Bacteria 3763
125 Ga0105249_10595970 3300009553 Bacteria 1159
126 Ga0105246_10077622 3300011119 Bacteria 2357
127 Ga0157371_10007587 3300013102 Bacteria 8752
128 Ga0157371_10239545 3300013102 Bacteria 1305
129 Ga0157370_10072556 3300013104 Bacteria 3247
130 Ga0157369_10321734 3300013105 Bacteria 1608
131 Ga0157374_10004501 3300013296 Bacteria 11709
132 Ga0157374_10072421 3300013296 Bacteria 3251
133 Ga0157378_10073726 3300013297 Bacteria 3069
134 Ga0163162_10183718 3300013306 Bacteria 2217
135 Ga0163162_10438342 3300013306 Bacteria 1439
136 Ga0163162_10528924 3300013306 Bacteria 1308
137 Ga0157372_10174632 3300013307 Bacteria 2487
138 Ga0157372_10815975 3300013307 Bacteria 1083
139 Ga0157375_10005569 3300013308 Bacteria 10958
140 Ga0157375_10178127 3300013308 Bacteria 2277
141 Ga0157375_10217481 3300013308 Bacteria 2069
142 Ga0157375_10248214 3300013308 Bacteria 1940
143 Ga0163163_10156591 3300014325 Bacteria 2322
144 Ga0157380_10002780 3300014326 Bacteria 11890
145 Ga0157377_10050907 3300014745 Bacteria 2335
146 Ga0157379_10178958 3300014968 Bacteria 1916
147 Ga0157376_10140926 3300014969 Bacteria 2163
148 Ga0163161_10000032 3300017792 Bacteria 165511
149 Ga0207682_10000129 3300025893 Bacteria 33994
150 Ga0207642_10000006 3300025899 Bacteria 230268
151 Ga0207642_10000007 3300025899 Bacteria 226017
152 Ga0207642_10000100 3300025899 Bacteria 22988
153 Ga0207710_10000158 3300025900 Bacteria 72527
154 Ga0207688_10052156 3300025901 Bacteria 2292
155 Ga0207688_10145866 3300025901 Bacteria 1395
156 Ga0207688_10509347 3300025901 Bacteria 754
157 Ga0207680_10289379 3300025903 Bacteria 1140
158 Ga0207685_10000011 3300025905 Bacteria 213430
159 Ga0207645_10089035 3300025907 Bacteria 1985
160 Ga0207643_10494060 3300025908 Unclassified 782
161 Ga0207707_10011734 3300025912 Bacteria 7625
162 Ga0207693_10007405 3300025915 Bacteria 9028
163 Ga0207663_10040269 3300025916 Bacteria 2839
164 Ga0207663_10047397 3300025916 Bacteria 2653
165 Ga0207657_10022110 3300025919 Bacteria 5968
166 Ga0207652_10002610 3300025921 Bacteria 15138
167 Ga0207652_10022409 3300025921 Bacteria 5225
168 Ga0207694_10000004 3300025924 Bacteria 967075
169 Ga0207659_10013868 3300025926 Bacteria 5180
170 Ga0207687_10000018 3300025927 Bacteria 236159
171 Ga0207687_10000269 3300025927 Bacteria 35470
172 Ga0207687_10028772 3300025927 Bacteria 3734
173 Ga0207664_10176499 3300025929 Bacteria 1832
174 Ga0207690_10578458 3300025932 Bacteria 915
175 Ga0207706_10000068 3300025933 Bacteria 105795
176 Ga0207706_10009597 3300025933 Bacteria 8883
177 Ga0207686_10010918 3300025934 Bacteria 4954
178 Ga0207686_10016655 3300025934 Bacteria 4127
179 Ga0207686_10026894 3300025934 Bacteria 3363
180 Ga0207709_10355678 3300025935 Bacteria 1107
181 Ga0207670_10713994 3300025936 Bacteria 831
182 Ga0207669_10000004 3300025937 Bacteria 196828
183 Ga0207669_10000012 3300025937 Bacteria 138242
184 Ga0207669_10036455 3300025937 Bacteria 2811
185 Ga0207665_10076143 3300025939 Bacteria 2300
186 Ga0207665_10114697 3300025939 Bacteria 1897
187 Ga0207691_10013831 3300025940 Bacteria 7705
188 Ga0207661_10005133 3300025944 Bacteria 9197
189 Ga0207661_10010344 3300025944 Bacteria 6714
190 Ga0207679_10009136 3300025945 Bacteria 6336
191 Ga0207651_10001019 3300025960 Bacteria 12393
192 Ga0207712_10000007 3300025961 Bacteria 539589
193 Ga0207712_10362303 3300025961 Bacteria 1208
194 Ga0207668_10017366 3300025972 Bacteria 4508
195 Ga0207668_10383803 3300025972 Bacteria 1183
196 Ga0207668_10555815 3300025972 Bacteria 995
197 Ga0207640_10035024 3300025981 Bacteria 3138
198 Ga0207640_10056964 3300025981 Bacteria 2569
199 Ga0207677_10000421 3300026023 Bacteria 28837
200 Ga0207677_10059255 3300026023 Bacteria 2640
201 Ga0207703_10000040 3300026035 Bacteria 168191
202 Ga0207703_10000322 3300026035 Bacteria 52048
203 Ga0207703_10145475 3300026035 Bacteria 2061
204 Ga0207639_10061761 3300026041 Bacteria 2895
205 Ga0207639_10286427 3300026041 Unclassified 1451
206 Ga0207678_10000834 3300026067 Bacteria 28248
207 Ga0207678_10033206 3300026067 Bacteria 4497
208 Ga0207678_10072290 3300026067 Bacteria 2956
209 Ga0207708_10037663 3300026075 Bacteria 3684
210 Ga0207708_10440999 3300026075 Bacteria 1083
211 Ga0207702_10000016 3300026078 Bacteria 226633
212 Ga0207702_10872258 3300026078 Bacteria 891
213 Ga0207641_10002276 3300026088 Bacteria 17898
214 Ga0207648_10009455 3300026089 Bacteria 9337
215 Ga0207676_10000016 3300026095 Bacteria 311561
216 Ga0207674_10087360 3300026116 Bacteria 3112
217 Ga0207675_100299756 3300026118 Unclassified 1565
218 Ga0207683_10009270 3300026121 Bacteria 8387
219 Ga0207683_10078156 3300026121 Bacteria 2932
220 Ga0207683_10318787 3300026121 Bacteria 1424
221 Ga0268266_10000020 3300028379 Bacteria 527065
222 Ga0268266_10652182 3300028379 Bacteria 1013
223 Ga0268265_10265716 3300028380 Bacteria 1528
224 Ga0268264_10034313 3300028381 Bacteria 4173
225 Ga0268264_10096060 3300028381 Bacteria 2566
226 Ga0265337_1000002 3300028556 Bacteria 139247
227 Ga0265326_10000007 3300028558 Bacteria 223057
228 Ga0265319_1000025 3300028563 Bacteria 142639
229 Ga0265322_10000001 3300028654 Bacteria 543854
230 Ga0265338_10000486 3300028800 Bacteria 70900
231 Ga0265338_10214343 3300028800 Bacteria 1443
232 Ga0265324_10000309 3300029957 Bacteria 35875
233 Ga0265332_10020233 3300031238 Bacteria 2938
234 Ga0265332_10052251 3300031238 Bacteria 1755
235 Ga0265328_10013764 3300031239 Bacteria 3195
236 Ga0265320_10000002 3300031240 Bacteria 542875
237 Ga0265325_10026623 3300031241 Bacteria 3131
238 Ga0265329_10004480 3300031242 Bacteria 5798
239 Ga0265339_10022532 3300031249 Bacteria 3650
240 Ga0265331_10000774 3300031250 Bacteria 26605
241 Ga0265331_10013995 3300031250 Bacteria 4290
242 Ga0265327_10000011 3300031251 Bacteria 543807
243 Ga0265316_10009446 3300031344 Bacteria 8983
244 Ga0265314_10000058 3300031711 Bacteria 167476
245 Ga0265342_10060091 3300031712 Bacteria 2243
246 Ga0307410_10371143 3300031852 Bacteria 1149
247 Ga0307409_100007635 3300031995 Bacteria 6487
248 Ga0307416_100038101 3300032002 Bacteria 3706
249 Ga0307415_100009738 3300032126 Bacteria 5407
250 Ga0307415_100177867 3300032126 Bacteria 1666
251 Ga0373953_0156993 3300035117 Bacteria 977
252 Ga0373937_0018686 3300036401 Bacteria 6194
253 Ga0373937_1004778 3300036401 Bacteria 783
254 Ga0316584_0034701 3300036712 Bacteria 3740
255 Ga0316584_0164990 3300036712 Bacteria 1645
256 Ga0395900_0089401 3300037418 Bacteria 3166
257 Ga0395900_0309994 3300037418 Bacteria 1562
258 Ga0395898_0022749 3300037466 Bacteria 6344
259 Ga0395898_0531744 3300037466 Unclassified 1117
260 Ga0395898_0545831 3300037466 Bacteria 1101
261 Ga0395905_0860325 3300037471 Bacteria 810
262 Ga0395901_0002589 3300038443 Bacteria 18335
263 Ga0395901_0077381 3300038443 Bacteria 3472
264 Ga0395901_0090816 3300038443 Bacteria 3197
265 Ga0395901_0315520 3300038443 Bacteria 1618
266 Ga0395901_0727788 3300038443 Unclassified 987
267 Ga0451853_0709412 3300041512 Bacteria 4602
268 Ga0451853_1528538 3300041512 Bacteria 1511
269 Ga0439440_0076557 3300042993 Unclassified 879
270 Ga0466963_0000023 3300044694 Bacteria 52546
271 Ga0495592_0000036 3300046454 Bacteria 125461
272 Ga0495603_0000097 3300046455 Bacteria 40321
273 Ga0495603_0002177 3300046455 Bacteria 11524
274 Ga0495629_0395852 3300046459 Bacteria 939
275 Ga0495641_0000003 3300046461 Bacteria 242879
276 Ga0495653_0055906 3300046463 Bacteria 3011
277 Ga0495653_0106010 3300046463 Bacteria 2028
278 Ga0495582_0000029 3300046473 Bacteria 77919
279 Ga0495582_0170588 3300046473 Bacteria 1239
280 Ga0495639_0116175 3300046475 Bacteria 1273
281 Ga0495662_0000030 3300046476 Bacteria 48917
282 Ga0495664_0383413 3300046477 Unclassified 845
283 Ga0495596_0198913 3300046500 Bacteria 779
284 Ga0495608_0000204 3300046511 Bacteria 42513
285 Ga0495608_0069753 3300046511 Bacteria 2295
286 Ga0495618_0000004 3300046514 Bacteria 245690
287 Ga0495620_0001199 3300046515 Bacteria 15860
288 Ga0495620_0028316 3300046515 Bacteria 2608
289 Ga0495628_0000924 3300046516 Bacteria 26910
290 Ga0495628_0003694 3300046516 Bacteria 13645
291 Ga0495628_0045269 3300046516 Bacteria 3500
292 Ga0495628_0162908 3300046516 Bacteria 1694
293 Ga0495628_0650956 3300046516 Bacteria 748
294 Ga0495630_0008823 3300046517 Bacteria 7238
295 Ga0495630_0086434 3300046517 Bacteria 2368
296 Ga0495630_0107309 3300046517 Bacteria 2115
297 Ga0495644_0000535 3300046523 Bacteria 16123
298 Ga0495652_0049862 3300046529 Bacteria 3582
299 Ga0495652_0207823 3300046529 Bacteria 1481
300 Ga0495586_0002147 3300046535 Bacteria 10705
301 Ga0495598_0017950 3300046537 Bacteria 1831
302 Ga0495609_0078949 3300046538 Bacteria 1440
303 Ga0495645_0062020 3300046543 Bacteria 2709
304 Ga0495645_0069625 3300046543 Bacteria 2540
305 Ga0495645_0198402 3300046543 Bacteria 1363
306 Ga0495622_0000014 3300046557 Bacteria 182142
307 Ga0495667_0000032 3300046559 Bacteria 143493
308 Ga0495656_0000617 3300046615 Bacteria 11371
309 Ga0495634_0001201 3300046642 Bacteria 23885
310 Ga0495634_0001774 3300046642 Bacteria 18668
311 Ga0495634_0283298 3300046642 Unclassified 1006
312 Ga0495625_0000122 3300046660 Bacteria 121146
313 Ga0495625_0321982 3300046660 Bacteria 984
314 Ga0495635_0000016 3300046663 Bacteria 214088
315 Ga0495659_0109162 3300046664 Bacteria 1079
316 Ga0495599_0003118 3300046678 Bacteria 9659
317 Ga0495647_0000025 3300046681 Bacteria 65184
318 Ga0495647_0002619 3300046681 Bacteria 5703
319 Ga0495647_0070407 3300046681 Bacteria 1399
320 Ga0495658_0000026 3300046683 Bacteria 77681
321 Ga0495658_0580231 3300046683 Bacteria 718
322 Ga0495669_0000260 3300046684 Bacteria 30549
323 Ga0495669_0048162 3300046684 Bacteria 1906
324 Ga0495613_0000152 3300046689 Bacteria 68384
325 Ga0495613_0260737 3300046689 Bacteria 1208
326 Ga0495624_0000009 3300046690 Bacteria 145026
327 Ga0495624_0007124 3300046690 Bacteria 7868
328 Ga0495670_0002839 3300046691 Bacteria 8563
329 Ga0495649_0004521 3300046694 Bacteria 9080
330 Ga0495600_0001553 3300046809 Bacteria 12768
331 Ga0495600_0069366 3300046809 Unclassified 2304
332 Ga0495600_0410043 3300046809 Bacteria 842
333 Ga0495604_0000019 3300047317 Bacteria 175064
334 Ga0495676_0000676 3300047321 Bacteria 28342
335 Ga0495676_0178244 3300047321 Bacteria 1491
336 Ga0495680_0000061 3300047322 Bacteria 90676
337 Ga0495680_0001562 3300047322 Bacteria 24515
338 Ga0495680_0004057 3300047322 Bacteria 14116
339 Ga0495679_003496 3300047446 Bacteria 7522
340 Ga0495685_006643 3300047447 Bacteria 3797
341 Ga0495593_0088610 3300047673 Bacteria 1595
342 Ga0495602_0005647 3300048088 Bacteria 13115
343 Ga0495602_0057688 3300048088 Bacteria 3404
344 Ga0495602_0090567 3300048088 Bacteria 2540
345 Ga0495614_0044362 3300048089 Bacteria 1907
346 Ga0495614_0060807 3300048089 Bacteria 1623
347 Ga0496100_0000002 3300048903 Bacteria 489057
348 Ga0496100_0039466 3300048903 Bacteria 2999
349 Ga0496100_0572414 3300048903 Bacteria 875
350 Ga0496101_0000001 3300048904 Bacteria 489057
351 Ga0496101_0000361 3300048904 Bacteria 30335
352 Ga0496102_0011652 3300048905 Bacteria 7588
353 Ga0496102_0090162 3300048905 Bacteria 2837
354 Ga0496102_1180343 3300048905 Bacteria 685
355 Ga0496103_0001929 3300048906 Bacteria 13440
356 Ga0496104_0000009 3300048907 Bacteria 488055
357 Ga0496104_0001485 3300048907 Bacteria 20235
358 Ga0496104_0210144 3300048907 Bacteria 1857
359 Ga0496105_0000027 3300048908 Bacteria 148197
360 Ga0496105_0013792 3300048908 Bacteria 6418
361 Ga0496105_0027203 3300048908 Bacteria 4670
362 Ga0496105_0061227 3300048908 Bacteria 3105
363 Ga0496105_0067101 3300048908 Bacteria 2962
364 Ga0496106_0000149 3300048909 Bacteria 51656
365 Ga0496106_0010639 3300048909 Bacteria 6798
366 Ga0496106_0022376 3300048909 Bacteria 4695
367 Ga0496107_0000013 3300048910 Bacteria 178284
368 Ga0496107_0035131 3300048910 Bacteria 3594
369 Ga0496107_0083020 3300048910 Bacteria 2336
370 Ga0496107_0094475 3300048910 Bacteria 2187
371 Ga0496108_0000001 3300048911 Bacteria 919044
372 Ga0496108_0000132 3300048911 Bacteria 73888
373 Ga0496108_0005465 3300048911 Bacteria 10273
374 Ga0496108_0022532 3300048911 Bacteria 5179
375 Ga0496108_0031216 3300048911 Bacteria 4418
376 Ga0496109_0000003 3300048912 Bacteria 420862
377 Ga0496109_0000007 3300048912 Bacteria 247554
378 Ga0496109_0000190 3300048912 Bacteria 61169
379 Ga0496109_0070434 3300048912 Bacteria 3209
380 Ga0496109_0119987 3300048912 Bacteria 2449
381 Ga0496109_0207818 3300048912 Unclassified 1841
382 Ga0496110_0001729 3300048913 Bacteria 16080
383 Ga0496110_0005142 3300048913 Bacteria 10223
384 Ga0496110_0005255 3300048913 Bacteria 10131
385 Ga0496110_0016972 3300048913 Bacteria 6086
386 Ga0496110_0168344 3300048913 Bacteria 1988
387 Ga0496111_0003411 3300048914 Bacteria 9836
388 Ga0496111_0057275 3300048914 Bacteria 2821
389 Ga0496111_0192691 3300048914 Bacteria 1515
390 Ga0496112_0000003 3300048915 Bacteria 660147
391 Ga0496112_0104474 3300048915 Bacteria 2803
392 Ga0496112_0130572 3300048915 Bacteria 2483
393 Ga0496113_0043031 3300048916 Bacteria 3340
394 Ga0496113_0048178 3300048916 Bacteria 3170
395 Ga0496114_0001417 3300048917 Bacteria 18199
396 Ga0496114_0004542 3300048917 Bacteria 10776
397 Ga0496115_0050377 3300048918 Bacteria 3336
398 Ga0496117_0009156 3300048920 Bacteria 9280
399 Ga0496118_0004300 3300048921 Bacteria 17014
400 Ga0496119_0008077 3300048922 Bacteria 9335
401 Ga0496119_0013029 3300048922 Bacteria 6674
402 Ga0496120_0016747 3300048923 Bacteria 4778
403 Ga0496121_0023935 3300048924 Bacteria 5856
404 Ga0496121_0038056 3300048924 Bacteria 4267
405 Ga0496125_0096586 3300048928 Bacteria 2193
406 Ga0496125_0184538 3300048928 Bacteria 1385
407 Ga0496126_0014575 3300048929 Bacteria 7941
408 Ga0501031_0007261 3300049568 Bacteria 7228
409 Ga0501032_0009507 3300049569 Bacteria 7045
410 Ga0501032_0178933 3300049569 Bacteria 1389
411 Ga0501033_0010398 3300049570 Bacteria 7136
412 Ga0501034_0027550 3300049571 Bacteria 5779
413 Ga0501036_0011808 3300049572 Bacteria 7239
414 Ga0501037_0009203 3300049573 Bacteria 7239
415 Ga0501038_0015053 3300049574 Bacteria 7042
416 Ga0501039_0084478 3300049575 Bacteria 2472
417 Ga0501041_0030914 3300049577 Bacteria 3232
418 Ga0501042_0020700 3300049578 Bacteria 4580
419 Ga0501042_0078342 3300049578 Bacteria 2367
420 Ga0501042_0125209 3300049578 Bacteria 1850
421 Ga0501043_0010932 3300049579 Bacteria 7110
422 Ga0501043_0469640 3300049579 Bacteria 943
423 Ga0501046_0004506 3300049580 Bacteria 12624
424 Ga0501046_0143649 3300049580 Bacteria 1804
425 Ga0501047_0015685 3300049581 Bacteria 7219
426 Ga0501047_0031873 3300049581 Bacteria 5086
427 Ga0501047_0070990 3300049581 Bacteria 3352
428 Ga0501048_0010026 3300049582 Bacteria 7089
429 Ga0501048_0070524 3300049582 Bacteria 2468
430 Ga0501048_0391868 3300049582 Bacteria 992
431 Ga0501068_0019590 3300049584 Bacteria 3932
432 Ga0501068_0070538 3300049584 Bacteria 2132
433 Ga0501069_0013651 3300049585 Bacteria 4334
434 Ga0501069_0025019 3300049585 Bacteria 3260
435 Ga0501070_0006027 3300049586 Bacteria 10324
436 Ga0501070_0012402 3300049586 Bacteria 7189
437 Ga0501070_0181010 3300049586 Bacteria 1734
438 Ga0501071_0186507 3300049587 Bacteria 1555
439 Ga0501072_0008803 3300049588 Bacteria 7665
440 Ga0501072_0038561 3300049588 Bacteria 3750
441 Ga0501072_0112714 3300049588 Bacteria 2165
442 Ga0501072_0118636 3300049588 Bacteria 2108
443 Ga0501073_0009895 3300049589 Bacteria 7018
444 Ga0501074_0024645 3300049590 Bacteria 4370
445 Ga0501074_0070873 3300049590 Bacteria 2506
446 Ga0501074_0264979 3300049590 Unclassified 1221
447 Ga0501074_0316432 3300049590 Bacteria 1108
448 Ga0501075_0006937 3300049591 Bacteria 7826
449 Ga0501075_0011190 3300049591 Bacteria 6343
450 Ga0501075_0253922 3300049591 Bacteria 1340
451 Ga0501075_0257651 3300049591 Unclassified 1329
452 Ga0501076_0072499 3300049592 Bacteria 2756
453 Ga0501076_0133602 3300049592 Bacteria 2014
454 Ga0501077_0240534 3300049593 Unclassified 1151
455 Ga0501079_0037582 3300049741 Bacteria 3732
456 Ga0501079_0066546 3300049741 Bacteria 2780
457 Ga0501080_0007467 3300049742 Bacteria 9869
458 Ga0501080_0953843 3300049742 Bacteria 746
459 Ga0501081_0143593 3300049743 Bacteria 1711
460 Ga0501081_0413123 3300049743 Bacteria 1000
461 Ga0501081_0893612 3300049743 Unclassified 670
462 Ga0501083_0008785 3300049744 Bacteria 7131
463 Ga0501083_0037390 3300049744 Bacteria 3307
464 Ga0501083_0231609 3300049744 Unclassified 1203
465 Ga0501083_0280695 3300049744 Bacteria 1083
466 Ga0501035_0004594 3300049822 Bacteria 13088
467 Ga0501035_0498108 3300049822 Bacteria 1003
468 Ga0501044_0009242 3300049823 Bacteria 10765
469 Ga0501044_0019725 3300049823 Bacteria 7204
470 Ga0501045_0040403 3300049824 Bacteria 3395
471 Ga0501045_0058581 3300049824 Bacteria 2821
472 Ga0501045_0216033 3300049824 Bacteria 1428
473 nmdc:mga03n38_162569_c1 3300050490 Unclassified 1131
474 nmdc:mga00v17_106452_c1 3300050491 Bacteria 1775
475 nmdc:mga00v17_22375_c1 3300050491 Bacteria 3647
476 nmdc:mga00v17_66116_c1 3300050491 Bacteria 2232
477 nmdc:mga0yw44_12345_c1 3300050492 Bacteria 4449
478 nmdc:mga0yw44_216078_c1 3300050492 Unclassified 1269
479 nmdc:mga0yw44_398694_c1 3300050492 Unclassified 930
480 nmdc:mga0yw44_66601_c1 3300050492 Bacteria 2223
481 nmdc:mga06z11_130577_c1 3300050494 Bacteria 1410
482 nmdc:mga06z11_216202_c1 3300050494 Unclassified 1118
483 nmdc:mga06z11_237693_c1 3300050494 Bacteria 1069
484 nmdc:mga06z11_396779_c1 3300050494 Unclassified 830
485 nmdc:mga0qj67_101965_c1 3300050509 Bacteria 2314
486 nmdc:mga0qj67_264404_c1 3300050509 Unclassified 1395
487 nmdc:mga06r32_122677_c1 3300050510 Bacteria 2564
488 nmdc:mga08y16_544672_c1 3300050511 Bacteria 1175
489 nmdc:mga0n895_482937_c1 3300050512 Bacteria 1249
490 Ga0495601_0000258 3300053077 Bacteria 28539
491 Ga0495601_0002866 3300053077 Bacteria 9802
492 Ga0495601_0003264 3300053077 Bacteria 9268
493 Ga0495601_0200798 3300053077 Bacteria 1303
494 Ga0495612_0000098 3300053078 Bacteria 37601
495 Ga0495612_0003045 3300053078 Bacteria 6953
496 Ga0495612_0008696 3300053078 Bacteria 4118
497 Ga0495595_0000338 3300053084 Bacteria 18068
498 Ga0495619_0000243 3300053085 Bacteria 39638
499 Ga0495619_0069790 3300053085 Bacteria 2349
500 Ga0500554_007168 3300053102 Bacteria 2549
501 Ga0500595_014231 3300053119 Bacteria 3024
502 Ga0500614_001316 3300053123 Bacteria 5986
503 Ga0500658_0034552 3300053134 Bacteria 1996
504 Ga0500568_0154603 3300053139 Bacteria 848
505 Ga0501084_0057387 3300054114 Bacteria 3258
506 Ga0501084_0373051 3300054114 Bacteria 1206
507 Ga0501082_0024401 3300060353 Bacteria 5213
508 Ga0501082_0032106 3300060353 Bacteria 4530
509 Ga0501082_0166071 3300060353 Bacteria 1918
510 Ga0530510_0202911 3300061734 Bacteria 1473
511 Ga0530510_0263187 3300061734 Unclassified 1286

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0860325 Ga0395905_0860325_30_590 183
2 3300005347 Ga0070668_100131231 Ga0070668_1001312312 186
3 3300025972 Ga0207668_10017366 Ga0207668_100173664 186
4 3300049590 Ga0501074_0316432 Ga0501074_0316432_165_797 186
5 3300049744 Ga0501083_0280695 Ga0501083_0280695_139_771 186
6 3300025907 Ga0207645_10089035 Ga0207645_100890353 187
7 3300005937 Ga0081455_10283109 Ga0081455_102831091 188
8 3300048905 Ga0496102_1180343 Ga0496102_1180343_87_671 188
9 3300049823 Ga0501044_0009242 Ga0501044_0009242_9919_10572 189
10 3300032126 Ga0307415_100009738 Ga0307415_1000097386 191
11 3300046642 Ga0495634_0001774 Ga0495634_0001774_14286_14876 192
12 3300048922 Ga0496119_0008077 Ga0496119_0008077_8639_9292 192
13 3300025901 Ga0207688_10509347 Ga0207688_105093472 194
14 3300049590 Ga0501074_0070873 Ga0501074_0070873_1652_2302 194
15 3300009551 Ga0105238_10330107 Ga0105238_103301072 195
16 3300013105 Ga0157369_10321734 Ga0157369_103217342 195
17 3300049581 Ga0501047_0070990 Ga0501047_0070990_65_694 195
18 3300053119 Ga0500595_014231 Ga0500595_014231_462_1115 195
19 3300005840 Ga0068870_10491298 Ga0068870_104912982 196
20 3300025908 Ga0207643_10494060 Ga0207643_104940602 196
21 3300005543 Ga0070672_100295045 Ga0070672_1002950452 197
22 3300026078 Ga0207702_10872258 Ga0207702_108722581 197
23 3300037418 Ga0395900_0089401 Ga0395900_0089401_1948_2565 198
24 3300038443 Ga0395901_0090816 Ga0395901_0090816_1307_1924 198
25 3300005329 Ga0070683_100021869 Ga0070683_1000218692 199
26 3300005455 Ga0070663_100011872 Ga0070663_1000118722 199
27 3300005530 Ga0070679_100034564 Ga0070679_1000345647 199
28 3300025921 Ga0207652_10022409 Ga0207652_100224097 199
29 3300025944 Ga0207661_10010344 Ga0207661_100103447 199
30 3300026067 Ga0207678_10000834 Ga0207678_1000083423 199
31 3300036712 Ga0316584_0034701 Ga0316584_0034701_2231_2875 199
32 3300046684 Ga0495669_0048162 Ga0495669_0048162_365_991 199
33 3300048903 Ga0496100_0039466 Ga0496100_0039466_1118_1768 199
34 3300048908 Ga0496105_0013792 Ga0496105_0013792_3411_4061 199
35 3300048913 Ga0496110_0168344 Ga0496110_0168344_1229_1879 199
36 3300048922 Ga0496119_0013029 Ga0496119_0013029_2887_3537 199
37 3300048924 Ga0496121_0038056 Ga0496121_0038056_2614_3264 199
38 3300048928 Ga0496125_0096586 Ga0496125_0096586_736_1386 199
39 3300049742 Ga0501080_0953843 Ga0501080_0953843_20_673 199
40 3300053134 Ga0500658_0034552 Ga0500658_0034552_954_1607 199
41 3300050490 nmdc:mga03n38_162569_c1 nmdc:mga03n38_162569_c1_345_1001 201
42 3300014969 Ga0157376_10140926 Ga0157376_101409262 203
43 3300048923 Ga0496120_0016747 Ga0496120_0016747_2244_2897 203
44 3300009553 Ga0105249_10595970 Ga0105249_105959702 204
45 3300050509 nmdc:mga0qj67_264404_c1 nmdc:mga0qj67_264404_c1_50_673 204
46 3300006038 Ga0075365_10398371 Ga0075365_103983712 206
47 3300005356 Ga0070674_100025824 Ga0070674_1000258244 207
48 3300005365 Ga0070688_100109917 Ga0070688_1001099172 207
49 3300005439 Ga0070711_100003694 Ga0070711_1000036943 207
50 3300005456 Ga0070678_100493528 Ga0070678_1004935282 207
51 3300005466 Ga0070685_10060157 Ga0070685_100601572 207
52 3300005544 Ga0070686_100005659 Ga0070686_1000056593 207
53 3300006163 Ga0070715_10220950 Ga0070715_102209502 207
54 3300006173 Ga0070716_100050897 Ga0070716_1000508973 207
55 3300006175 Ga0070712_100004037 Ga0070712_10000403711 207
56 3300009148 Ga0105243_10084276 Ga0105243_100842763 207
57 3300011119 Ga0105246_10077622 Ga0105246_100776223 207
58 3300013306 Ga0163162_10183718 Ga0163162_101837183 207
59 3300013306 Ga0163162_10528924 Ga0163162_105289242 207
60 3300013307 Ga0157372_10815975 Ga0157372_108159752 207
61 3300013308 Ga0157375_10005569 Ga0157375_1000556910 207
62 3300025901 Ga0207688_10052156 Ga0207688_100521563 207
63 3300025915 Ga0207693_10007405 Ga0207693_1000740511 207
64 3300025916 Ga0207663_10040269 Ga0207663_100402692 207
65 3300025927 Ga0207687_10028772 Ga0207687_100287722 207
66 3300025935 Ga0207709_10355678 Ga0207709_103556782 207
67 3300025937 Ga0207669_10036455 Ga0207669_100364553 207
68 3300025939 Ga0207665_10076143 Ga0207665_100761433 207
69 3300026121 Ga0207683_10009270 Ga0207683_100092703 207
70 3300046463 Ga0495653_0055906 Ga0495653_0055906_330_965 207
71 3300046473 Ga0495582_0170588 Ga0495582_0170588_44_670 207
72 3300046557 Ga0495622_0000014 Ga0495622_0000014_20921_21568 207
73 3300046683 Ga0495658_0580231 Ga0495658_0580231_49_675 207
74 3300046689 Ga0495613_0260737 Ga0495613_0260737_398_1021 207
75 3300048089 Ga0495614_0060807 Ga0495614_0060807_501_1127 207
76 3300048903 Ga0496100_0572414 Ga0496100_0572414_238_864 207
77 3300048904 Ga0496101_0000361 Ga0496101_0000361_15104_15730 207
78 3300048905 Ga0496102_0011652 Ga0496102_0011652_6706_7332 207
79 3300048905 Ga0496102_0090162 Ga0496102_0090162_194_826 207
80 3300048906 Ga0496103_0001929 Ga0496103_0001929_8968_9594 207
81 3300048907 Ga0496104_0210144 Ga0496104_0210144_1198_1824 207
82 3300048908 Ga0496105_0067101 Ga0496105_0067101_1940_2566 207
83 3300048909 Ga0496106_0010639 Ga0496106_0010639_1950_2576 207
84 3300048910 Ga0496107_0094475 Ga0496107_0094475_161_787 207
85 3300048911 Ga0496108_0005465 Ga0496108_0005465_5789_6436 207
86 3300048911 Ga0496108_0031216 Ga0496108_0031216_2034_2660 207
87 3300048912 Ga0496109_0070434 Ga0496109_0070434_705_1352 207
88 3300048913 Ga0496110_0005255 Ga0496110_0005255_5439_6065 207
89 3300048914 Ga0496111_0003411 Ga0496111_0003411_3354_3980 207
90 3300048915 Ga0496112_0130572 Ga0496112_0130572_123_749 207
91 3300048916 Ga0496113_0048178 Ga0496113_0048178_2036_2683 207
92 3300048917 Ga0496114_0001417 Ga0496114_0001417_257_883 207
93 3300048920 Ga0496117_0009156 Ga0496117_0009156_6216_6848 207
94 3300048921 Ga0496118_0004300 Ga0496118_0004300_13921_14553 207
95 3300005329 Ga0070683_100120233 Ga0070683_1001202332 208
96 3300005564 Ga0070664_100432858 Ga0070664_1004328582 208
97 3300005618 Ga0068864_100000045 Ga0068864_10000004512 208
98 3300005985 Ga0081539_10192870 Ga0081539_101928702 208
99 3300006038 Ga0075365_10000477 Ga0075365_1000047715 208
100 3300006051 Ga0075364_10016871 Ga0075364_100168714 208
101 3300009147 Ga0114129_10484097 Ga0114129_104840972 208
102 3300009176 Ga0105242_10017273 Ga0105242_100172734 208
103 3300025939 Ga0207665_10114697 Ga0207665_101146972 208
104 3300026095 Ga0207676_10000016 Ga0207676_10000016151 208
105 3300036401 Ga0373937_1004778 Ga0373937_1004778_40_666 208
106 3300037466 Ga0395898_0022749 Ga0395898_0022749_4046_4693 208
107 3300038443 Ga0395901_0002589 Ga0395901_0002589_16165_16812 208
108 3300038443 Ga0395901_0077381 Ga0395901_0077381_1798_2424 208
109 3300046615 Ga0495656_0000617 Ga0495656_0000617_9800_10483 208
110 3300046809 Ga0495600_0069366 Ga0495600_0069366_861_1487 208
111 3300048913 Ga0496110_0001729 Ga0496110_0001729_12216_12842 208
112 3300048915 Ga0496112_0104474 Ga0496112_0104474_2001_2627 208
113 3300049586 Ga0501070_0006027 Ga0501070_0006027_2156_2791 208
114 3300049586 Ga0501070_0181010 Ga0501070_0181010_598_1233 208
115 3300049588 Ga0501072_0112714 Ga0501072_0112714_15_650 208
116 3300049590 Ga0501074_0264979 Ga0501074_0264979_157_792 208
117 3300050491 nmdc:mga00v17_22375_c1 nmdc:mga00v17_22375_c1_2470_3102 208
118 3300050492 nmdc:mga0yw44_12345_c1 nmdc:mga0yw44_12345_c1_3766_4398 208
119 3300050492 nmdc:mga0yw44_398694_c1 nmdc:mga0yw44_398694_c1_203_835 208
120 3300050494 nmdc:mga06z11_216202_c1 nmdc:mga06z11_216202_c1_464_1096 208
121 3300053077 Ga0495601_0200798 Ga0495601_0200798_266_892 208
122 3300053078 Ga0495612_0000098 Ga0495612_0000098_13608_14234 208
123 3300005343 Ga0070687_100268044 Ga0070687_1002680442 209
124 3300005844 Ga0068862_100056118 Ga0068862_1000561184 209
125 3300006038 Ga0075365_10629353 Ga0075365_106293531 209
126 3300006051 Ga0075364_10049570 Ga0075364_100495702 209
127 3300006852 Ga0075433_10000478 Ga0075433_1000047822 209
128 3300006871 Ga0075434_100519509 Ga0075434_1005195092 209
129 3300009094 Ga0111539_10350557 Ga0111539_103505572 209
130 3300013104 Ga0157370_10072556 Ga0157370_100725563 209
131 3300028380 Ga0268265_10265716 Ga0268265_102657162 209
132 3300048907 Ga0496104_0001485 Ga0496104_0001485_12734_13378 209
133 3300048908 Ga0496105_0061227 Ga0496105_0061227_2328_2972 209
134 3300049577 Ga0501041_0030914 Ga0501041_0030914_30_659 209
135 3300049580 Ga0501046_0143649 Ga0501046_0143649_843_1472 209
136 3300049582 Ga0501048_0070524 Ga0501048_0070524_1682_2311 209
137 3300049582 Ga0501048_0391868 Ga0501048_0391868_130_759 209
138 3300049587 Ga0501071_0186507 Ga0501071_0186507_206_835 209
139 3300049588 Ga0501072_0008803 Ga0501072_0008803_5070_5699 209
140 3300049588 Ga0501072_0038561 Ga0501072_0038561_2704_3333 209
141 3300049591 Ga0501075_0011190 Ga0501075_0011190_557_1186 209
142 3300049591 Ga0501075_0257651 Ga0501075_0257651_402_1031 209
143 3300049592 Ga0501076_0072499 Ga0501076_0072499_2085_2714 209
144 3300049741 Ga0501079_0037582 Ga0501079_0037582_474_1103 209
145 3300049743 Ga0501081_0143593 Ga0501081_0143593_280_909 209
146 3300049743 Ga0501081_0413123 Ga0501081_0413123_238_867 209
147 3300049743 Ga0501081_0893612 Ga0501081_0893612_28_657 209
148 3300049744 Ga0501083_0231609 Ga0501083_0231609_139_768 209
149 3300049824 Ga0501045_0040403 Ga0501045_0040403_1313_1942 209
150 3300049824 Ga0501045_0058581 Ga0501045_0058581_1326_1955 209
151 3300050491 nmdc:mga00v17_106452_c1 nmdc:mga00v17_106452_c1_677_1309 209
152 3300050491 nmdc:mga00v17_66116_c1 nmdc:mga00v17_66116_c1_975_1613 209
153 3300050492 nmdc:mga0yw44_216078_c1 nmdc:mga0yw44_216078_c1_500_1141 209
154 3300050511 nmdc:mga08y16_544672_c1 nmdc:mga08y16_544672_c1_454_1101 209
155 3300050512 nmdc:mga0n895_482937_c1 nmdc:mga0n895_482937_c1_322_969 209
156 3300053077 Ga0495601_0002866 Ga0495601_0002866_1308_1952 209
157 3300053085 Ga0495619_0069790 Ga0495619_0069790_455_1093 209
158 3300053102 Ga0500554_007168 Ga0500554_007168_34_669 209
159 3300054114 Ga0501084_0057387 Ga0501084_0057387_908_1537 209
160 3300060353 Ga0501082_0032106 Ga0501082_0032106_1624_2253 209
161 3300060353 Ga0501082_0166071 Ga0501082_0166071_404_1033 209
162 3300061734 Ga0530510_0202911 Ga0530510_0202911_662_1291 209
163 3300061734 Ga0530510_0263187 Ga0530510_0263187_584_1213 209
164 3300001977 JGI24746J21847_1000325 JGI24746J21847_10003255 210
165 3300002459 JGI24751J29686_10010572 JGI24751J29686_100105722 210
166 3300005329 Ga0070683_100007429 Ga0070683_10000742910 210
167 3300005333 Ga0070677_10000057 Ga0070677_1000005719 210
168 3300005334 Ga0068869_100271279 Ga0068869_1002712792 210
169 3300005335 Ga0070666_10235173 Ga0070666_102351732 210
170 3300005336 Ga0070680_100059546 Ga0070680_1000595462 210
171 3300005337 Ga0070682_100000013 Ga0070682_100000013199 210
172 3300005338 Ga0068868_100000151 Ga0068868_10000015118 210
173 3300005338 Ga0068868_100289706 Ga0068868_1002897062 210
174 3300005339 Ga0070660_100001214 Ga0070660_10000121416 210
175 3300005344 Ga0070661_100098151 Ga0070661_1000981511 210
176 3300005347 Ga0070668_100205753 Ga0070668_1002057532 210
177 3300005354 Ga0070675_100011302 Ga0070675_1000113025 210
178 3300005356 Ga0070674_100000082 Ga0070674_10000008214 210
179 3300005364 Ga0070673_100017272 Ga0070673_1000172724 210
180 3300005365 Ga0070688_100171538 Ga0070688_1001715382 210
181 3300005366 Ga0070659_100188737 Ga0070659_1001887371 210
182 3300005367 Ga0070667_100323287 Ga0070667_1003232872 210
183 3300005435 Ga0070714_100067896 Ga0070714_1000678962 210
184 3300005438 Ga0070701_10057983 Ga0070701_100579832 210
185 3300005439 Ga0070711_100130638 Ga0070711_1001306381 210
186 3300005440 Ga0070705_100398070 Ga0070705_1003980702 210
187 3300005441 Ga0070700_100009313 Ga0070700_1000093135 210
188 3300005441 Ga0070700_100110610 Ga0070700_1001106103 210
189 3300005455 Ga0070663_100019356 Ga0070663_1000193564 210
190 3300005455 Ga0070663_100033112 Ga0070663_1000331123 210
191 3300005456 Ga0070678_100144185 Ga0070678_1001441853 210
192 3300005457 Ga0070662_100000016 Ga0070662_10000001635 210
193 3300005457 Ga0070662_100004751 Ga0070662_1000047514 210
194 3300005458 Ga0070681_10037206 Ga0070681_100372064 210
195 3300005459 Ga0068867_100005240 Ga0068867_1000052409 210
196 3300005530 Ga0070679_100001299 Ga0070679_10000129914 210
197 3300005535 Ga0070684_100007568 Ga0070684_1000075683 210
198 3300005539 Ga0068853_100009433 Ga0068853_1000094336 210
199 3300005543 Ga0070672_100055041 Ga0070672_1000550413 210
200 3300005547 Ga0070693_100044347 Ga0070693_1000443472 210
201 3300005547 Ga0070693_100059710 Ga0070693_1000597102 210
202 3300005548 Ga0070665_100000244 Ga0070665_10000024479 210
203 3300005577 Ga0068857_100093174 Ga0068857_1000931743 210
204 3300005578 Ga0068854_100014034 Ga0068854_1000140343 210
205 3300005578 Ga0068854_100111254 Ga0068854_1001112542 210
206 3300005614 Ga0068856_100002478 Ga0068856_1000024785 210
207 3300005615 Ga0070702_100021814 Ga0070702_1000218144 210
208 3300005617 Ga0068859_100694055 Ga0068859_1006940552 210
209 3300005718 Ga0068866_10000001 Ga0068866_10000001198 210
210 3300005718 Ga0068866_10000170 Ga0068866_1000017016 210
211 3300005719 Ga0068861_100156559 Ga0068861_1001565593 210
212 3300005834 Ga0068851_10004889 Ga0068851_100048896 210
213 3300005840 Ga0068870_10376318 Ga0068870_103763182 210
214 3300005841 Ga0068863_100044804 Ga0068863_1000448044 210
215 3300005841 Ga0068863_100233995 Ga0068863_1002339952 210
216 3300005842 Ga0068858_100000450 Ga0068858_10000045037 210
217 3300005842 Ga0068858_100520961 Ga0068858_1005209612 210
218 3300005843 Ga0068860_100003539 Ga0068860_1000035392 210
219 3300005843 Ga0068860_100236254 Ga0068860_1002362541 210
220 3300005844 Ga0068862_100001684 Ga0068862_1000016846 210
221 3300005937 Ga0081455_10029974 Ga0081455_100299744 210
222 3300005937 Ga0081455_10078207 Ga0081455_100782073 210
223 3300005937 Ga0081455_10103025 Ga0081455_101030254 210
224 3300005937 Ga0081455_10124105 Ga0081455_101241053 210
225 3300005937 Ga0081455_10181632 Ga0081455_101816322 210
226 3300005981 Ga0081538_10000030 Ga0081538_1000003098 210
227 3300005981 Ga0081538_10000426 Ga0081538_100004267 210
228 3300005983 Ga0081540_1001151 Ga0081540_100115114 210
229 3300005983 Ga0081540_1108183 Ga0081540_11081832 210
230 3300005985 Ga0081539_10005112 Ga0081539_100051128 210
231 3300006038 Ga0075365_10000463 Ga0075365_1000046317 210
232 3300006048 Ga0075363_100006477 Ga0075363_1000064775 210
233 3300006048 Ga0075363_100031179 Ga0075363_1000311793 210
234 3300006048 Ga0075363_100375852 Ga0075363_1003758521 210
235 3300006163 Ga0070715_10000001 Ga0070715_10000001171 210
236 3300006178 Ga0075367_10103137 Ga0075367_101031373 210
237 3300006178 Ga0075367_10128059 Ga0075367_101280592 210
238 3300006178 Ga0075367_10490911 Ga0075367_104909111 210
239 3300006844 Ga0075428_101149626 Ga0075428_1011496262 210
240 3300006846 Ga0075430_100063205 Ga0075430_1000632054 210
241 3300006847 Ga0075431_100098476 Ga0075431_1000984763 210
242 3300006881 Ga0068865_100004502 Ga0068865_10000450210 210
243 3300006931 Ga0097620_100693963 Ga0097620_1006939632 210
244 3300009098 Ga0105245_10000016 Ga0105245_10000016177 210
245 3300009098 Ga0105245_10000619 Ga0105245_1000061916 210
246 3300009098 Ga0105245_10008319 Ga0105245_100083192 210
247 3300009147 Ga0114129_10811518 Ga0114129_108115182 210
248 3300009148 Ga0105243_10026616 Ga0105243_100266163 210
249 3300009176 Ga0105242_10881484 Ga0105242_108814842 210
250 3300009545 Ga0105237_10340962 Ga0105237_103409622 210
251 3300009551 Ga0105238_10000201 Ga0105238_1000020154 210
252 3300009553 Ga0105249_10000068 Ga0105249_1000006829 210
253 3300009553 Ga0105249_10051297 Ga0105249_100512972 210
254 3300013102 Ga0157371_10007587 Ga0157371_100075878 210
255 3300013102 Ga0157371_10239545 Ga0157371_102395451 210
256 3300013296 Ga0157374_10004501 Ga0157374_100045013 210
257 3300013296 Ga0157374_10072421 Ga0157374_100724213 210
258 3300013297 Ga0157378_10073726 Ga0157378_100737264 210
259 3300013306 Ga0163162_10438342 Ga0163162_104383422 210
260 3300013307 Ga0157372_10174632 Ga0157372_101746322 210
261 3300013308 Ga0157375_10178127 Ga0157375_101781273 210
262 3300013308 Ga0157375_10217481 Ga0157375_102174813 210
263 3300013308 Ga0157375_10248214 Ga0157375_102482142 210
264 3300014325 Ga0163163_10156591 Ga0163163_101565913 210
265 3300014326 Ga0157380_10002780 Ga0157380_100027802 210
266 3300014745 Ga0157377_10050907 Ga0157377_100509072 210
267 3300014968 Ga0157379_10178958 Ga0157379_101789583 210
268 3300017792 Ga0163161_10000032 Ga0163161_1000003286 210
269 3300025893 Ga0207682_10000129 Ga0207682_1000012917 210
270 3300025899 Ga0207642_10000006 Ga0207642_10000006201 210
271 3300025899 Ga0207642_10000007 Ga0207642_1000000735 210
272 3300025899 Ga0207642_10000100 Ga0207642_100001008 210
273 3300025900 Ga0207710_10000158 Ga0207710_1000015863 210
274 3300025901 Ga0207688_10145866 Ga0207688_101458661 210
275 3300025903 Ga0207680_10289379 Ga0207680_102893791 210
276 3300025905 Ga0207685_10000011 Ga0207685_10000011171 210
277 3300025912 Ga0207707_10011734 Ga0207707_100117344 210
278 3300025916 Ga0207663_10047397 Ga0207663_100473972 210
279 3300025919 Ga0207657_10022110 Ga0207657_100221105 210
280 3300025921 Ga0207652_10002610 Ga0207652_1000261014 210
281 3300025924 Ga0207694_10000004 Ga0207694_10000004633 210
282 3300025926 Ga0207659_10013868 Ga0207659_100138685 210
283 3300025927 Ga0207687_10000018 Ga0207687_1000001847 210
284 3300025927 Ga0207687_10000269 Ga0207687_1000026916 210
285 3300025929 Ga0207664_10176499 Ga0207664_101764992 210
286 3300025932 Ga0207690_10578458 Ga0207690_105784581 210
287 3300025933 Ga0207706_10000068 Ga0207706_1000006835 210
288 3300025933 Ga0207706_10009597 Ga0207706_100095974 210
289 3300025934 Ga0207686_10010918 Ga0207686_100109183 210
290 3300025934 Ga0207686_10016655 Ga0207686_100166554 210
291 3300025934 Ga0207686_10026894 Ga0207686_100268942 210
292 3300025936 Ga0207670_10713994 Ga0207670_107139941 210
293 3300025937 Ga0207669_10000004 Ga0207669_1000000473 210
294 3300025937 Ga0207669_10000012 Ga0207669_1000001218 210
295 3300025940 Ga0207691_10013831 Ga0207691_100138313 210
296 3300025944 Ga0207661_10005133 Ga0207661_1000513310 210
297 3300025945 Ga0207679_10009136 Ga0207679_100091365 210
298 3300025960 Ga0207651_10001019 Ga0207651_1000101913 210
299 3300025961 Ga0207712_10000007 Ga0207712_10000007181 210
300 3300025961 Ga0207712_10362303 Ga0207712_103623032 210
301 3300025972 Ga0207668_10383803 Ga0207668_103838031 210
302 3300025972 Ga0207668_10555815 Ga0207668_105558151 210
303 3300025981 Ga0207640_10035024 Ga0207640_100350242 210
304 3300025981 Ga0207640_10056964 Ga0207640_100569642 210
305 3300026023 Ga0207677_10000421 Ga0207677_1000042113 210
306 3300026023 Ga0207677_10059255 Ga0207677_100592553 210
307 3300026035 Ga0207703_10000040 Ga0207703_1000004079 210
308 3300026035 Ga0207703_10000322 Ga0207703_1000032237 210
309 3300026035 Ga0207703_10145475 Ga0207703_101454753 210
310 3300026041 Ga0207639_10061761 Ga0207639_100617612 210
311 3300026041 Ga0207639_10286427 Ga0207639_102864272 210
312 3300026067 Ga0207678_10033206 Ga0207678_100332064 210
313 3300026067 Ga0207678_10072290 Ga0207678_100722903 210
314 3300026075 Ga0207708_10037663 Ga0207708_100376633 210
315 3300026075 Ga0207708_10440999 Ga0207708_104409991 210
316 3300026078 Ga0207702_10000016 Ga0207702_10000016200 210
317 3300026088 Ga0207641_10002276 Ga0207641_100022764 210
318 3300026089 Ga0207648_10009455 Ga0207648_100094559 210
319 3300026116 Ga0207674_10087360 Ga0207674_100873603 210
320 3300026118 Ga0207675_100299756 Ga0207675_1002997562 210
321 3300026121 Ga0207683_10078156 Ga0207683_100781563 210
322 3300026121 Ga0207683_10318787 Ga0207683_103187871 210
323 3300028379 Ga0268266_10000020 Ga0268266_1000002077 210
324 3300028379 Ga0268266_10652182 Ga0268266_106521821 210
325 3300028381 Ga0268264_10034313 Ga0268264_100343131 210
326 3300028381 Ga0268264_10096060 Ga0268264_100960602 210
327 3300028556 Ga0265337_1000002 Ga0265337_100000240 210
328 3300028558 Ga0265326_10000007 Ga0265326_1000000799 210
329 3300028563 Ga0265319_1000025 Ga0265319_1000025112 210
330 3300028654 Ga0265322_10000001 Ga0265322_10000001206 210
331 3300028800 Ga0265338_10000486 Ga0265338_1000048641 210
332 3300028800 Ga0265338_10214343 Ga0265338_102143432 210
333 3300029957 Ga0265324_10000309 Ga0265324_1000030914 210
334 3300031238 Ga0265332_10020233 Ga0265332_100202332 210
335 3300031238 Ga0265332_10052251 Ga0265332_100522512 210
336 3300031239 Ga0265328_10013764 Ga0265328_100137642 210
337 3300031240 Ga0265320_10000002 Ga0265320_10000002205 210
338 3300031241 Ga0265325_10026623 Ga0265325_100266233 210
339 3300031242 Ga0265329_10004480 Ga0265329_100044804 210
340 3300031249 Ga0265339_10022532 Ga0265339_100225324 210
341 3300031250 Ga0265331_10000774 Ga0265331_1000077422 210
342 3300031250 Ga0265331_10013995 Ga0265331_100139953 210
343 3300031251 Ga0265327_10000011 Ga0265327_10000011205 210
344 3300031344 Ga0265316_10009446 Ga0265316_100094469 210
345 3300031711 Ga0265314_10000058 Ga0265314_10000058112 210
346 3300031712 Ga0265342_10060091 Ga0265342_100600912 210
347 3300031852 Ga0307410_10371143 Ga0307410_103711432 210
348 3300031995 Ga0307409_100007635 Ga0307409_1000076352 210
349 3300032002 Ga0307416_100038101 Ga0307416_1000381013 210
350 3300032126 Ga0307415_100177867 Ga0307415_1001778672 210
351 3300035117 Ga0373953_0156993 Ga0373953_0156993_104_736 210
352 3300036401 Ga0373937_0018686 Ga0373937_0018686_1922_2554 210
353 3300036712 Ga0316584_0164990 Ga0316584_0164990_421_1062 210
354 3300037418 Ga0395900_0309994 Ga0395900_0309994_232_873 210
355 3300037466 Ga0395898_0531744 Ga0395898_0531744_276_914 210
356 3300037466 Ga0395898_0545831 Ga0395898_0545831_311_949 210
357 3300038443 Ga0395901_0315520 Ga0395901_0315520_53_691 210
358 3300038443 Ga0395901_0727788 Ga0395901_0727788_96_737 210
359 3300041512 Ga0451853_0709412 Ga0451853_0709412_3087_3719 210
360 3300041512 Ga0451853_1528538 Ga0451853_1528538_191_832 210
361 3300042993 Ga0439440_0076557 Ga0439440_0076557_202_834 210
362 3300044694 Ga0466963_0000023 Ga0466963_0000023_24316_24954 210
363 3300046454 Ga0495592_0000036 Ga0495592_0000036_26644_27276 210
364 3300046455 Ga0495603_0000097 Ga0495603_0000097_28143_28790 210
365 3300046455 Ga0495603_0002177 Ga0495603_0002177_8984_9625 210
366 3300046459 Ga0495629_0395852 Ga0495629_0395852_76_729 210
367 3300046461 Ga0495641_0000003 Ga0495641_0000003_193360_193992 210
368 3300046463 Ga0495653_0106010 Ga0495653_0106010_215_847 210
369 3300046473 Ga0495582_0000029 Ga0495582_0000029_61375_62016 210
370 3300046475 Ga0495639_0116175 Ga0495639_0116175_41_673 210
371 3300046476 Ga0495662_0000030 Ga0495662_0000030_27940_28572 210
372 3300046477 Ga0495664_0383413 Ga0495664_0383413_175_825 210
373 3300046500 Ga0495596_0198913 Ga0495596_0198913_108_746 210
374 3300046511 Ga0495608_0000204 Ga0495608_0000204_22164_22796 210
375 3300046511 Ga0495608_0069753 Ga0495608_0069753_749_1381 210
376 3300046514 Ga0495618_0000004 Ga0495618_0000004_123828_124472 210
377 3300046515 Ga0495620_0001199 Ga0495620_0001199_14825_15457 210
378 3300046515 Ga0495620_0028316 Ga0495620_0028316_1790_2431 210
379 3300046516 Ga0495628_0000924 Ga0495628_0000924_4718_5374 210
380 3300046516 Ga0495628_0003694 Ga0495628_0003694_1260_1892 210
381 3300046516 Ga0495628_0045269 Ga0495628_0045269_62_694 210
382 3300046516 Ga0495628_0162908 Ga0495628_0162908_386_1039 210
383 3300046516 Ga0495628_0650956 Ga0495628_0650956_39_692 210
384 3300046517 Ga0495630_0008823 Ga0495630_0008823_5471_6103 210
385 3300046517 Ga0495630_0086434 Ga0495630_0086434_756_1388 210
386 3300046517 Ga0495630_0107309 Ga0495630_0107309_1341_1976 210
387 3300046523 Ga0495644_0000535 Ga0495644_0000535_10269_10910 210
388 3300046529 Ga0495652_0049862 Ga0495652_0049862_590_1246 210
389 3300046529 Ga0495652_0207823 Ga0495652_0207823_224_856 210
390 3300046535 Ga0495586_0002147 Ga0495586_0002147_1578_2210 210
391 3300046537 Ga0495598_0017950 Ga0495598_0017950_1030_1671 210
392 3300046538 Ga0495609_0078949 Ga0495609_0078949_387_1025 210
393 3300046543 Ga0495645_0062020 Ga0495645_0062020_1764_2414 210
394 3300046543 Ga0495645_0069625 Ga0495645_0069625_1785_2417 210
395 3300046543 Ga0495645_0198402 Ga0495645_0198402_520_1152 210
396 3300046559 Ga0495667_0000032 Ga0495667_0000032_107350_107982 210
397 3300046642 Ga0495634_0001201 Ga0495634_0001201_11893_12546 210
398 3300046642 Ga0495634_0283298 Ga0495634_0283298_46_678 210
399 3300046660 Ga0495625_0000122 Ga0495625_0000122_38103_38744 210
400 3300046660 Ga0495625_0321982 Ga0495625_0321982_146_787 210
401 3300046663 Ga0495635_0000016 Ga0495635_0000016_26608_27240 210
402 3300046664 Ga0495659_0109162 Ga0495659_0109162_160_798 210
403 3300046678 Ga0495599_0003118 Ga0495599_0003118_4878_5510 210
404 3300046681 Ga0495647_0000025 Ga0495647_0000025_16872_17504 210
405 3300046681 Ga0495647_0002619 Ga0495647_0002619_3687_4319 210
406 3300046681 Ga0495647_0070407 Ga0495647_0070407_111_752 210
407 3300046683 Ga0495658_0000026 Ga0495658_0000026_15927_16568 210
408 3300046684 Ga0495669_0000260 Ga0495669_0000260_27334_27966 210
409 3300046689 Ga0495613_0000152 Ga0495613_0000152_33814_34446 210
410 3300046690 Ga0495624_0000009 Ga0495624_0000009_106877_107509 210
411 3300046690 Ga0495624_0007124 Ga0495624_0007124_2386_3018 210
412 3300046691 Ga0495670_0002839 Ga0495670_0002839_1484_2128 210
413 3300046694 Ga0495649_0004521 Ga0495649_0004521_3158_3790 210
414 3300046809 Ga0495600_0001553 Ga0495600_0001553_522_1166 210
415 3300046809 Ga0495600_0410043 Ga0495600_0410043_15_650 210
416 3300047317 Ga0495604_0000019 Ga0495604_0000019_33427_34059 210
417 3300047321 Ga0495676_0000676 Ga0495676_0000676_14623_15255 210
418 3300047321 Ga0495676_0178244 Ga0495676_0178244_182_814 210
419 3300047322 Ga0495680_0000061 Ga0495680_0000061_64434_65066 210
420 3300047322 Ga0495680_0001562 Ga0495680_0001562_9006_9638 210
421 3300047322 Ga0495680_0004057 Ga0495680_0004057_11443_12075 210
422 3300047446 Ga0495679_003496 Ga0495679_003496_6329_6961 210
423 3300047447 Ga0495685_006643 Ga0495685_006643_2875_3507 210
424 3300047673 Ga0495593_0088610 Ga0495593_0088610_923_1579 210
425 3300048088 Ga0495602_0005647 Ga0495602_0005647_3208_3864 210
426 3300048088 Ga0495602_0057688 Ga0495602_0057688_2752_3384 210
427 3300048088 Ga0495602_0090567 Ga0495602_0090567_1338_1988 210
428 3300048089 Ga0495614_0044362 Ga0495614_0044362_553_1212 210
429 3300048903 Ga0496100_0000002 Ga0496100_0000002_174891_175523 210
430 3300048904 Ga0496101_0000001 Ga0496101_0000001_174891_175523 210
431 3300048907 Ga0496104_0000009 Ga0496104_0000009_2909_3541 210
432 3300048908 Ga0496105_0000027 Ga0496105_0000027_144984_145616 210
433 3300048908 Ga0496105_0027203 Ga0496105_0027203_1789_2445 210
434 3300048909 Ga0496106_0000149 Ga0496106_0000149_21840_22472 210
435 3300048909 Ga0496106_0022376 Ga0496106_0022376_2819_3451 210
436 3300048910 Ga0496107_0000013 Ga0496107_0000013_2613_3245 210
437 3300048910 Ga0496107_0035131 Ga0496107_0035131_2674_3324 210
438 3300048910 Ga0496107_0083020 Ga0496107_0083020_256_888 210
439 3300048911 Ga0496108_0000001 Ga0496108_0000001_459217_459849 210
440 3300048911 Ga0496108_0000132 Ga0496108_0000132_55881_56522 210
441 3300048911 Ga0496108_0022532 Ga0496108_0022532_232_882 210
442 3300048912 Ga0496109_0000003 Ga0496109_0000003_133763_134395 210
443 3300048912 Ga0496109_0000007 Ga0496109_0000007_162715_163356 210
444 3300048912 Ga0496109_0000190 Ga0496109_0000190_46311_46976 210
445 3300048912 Ga0496109_0119987 Ga0496109_0119987_94_744 210
446 3300048912 Ga0496109_0207818 Ga0496109_0207818_830_1468 210
447 3300048913 Ga0496110_0005142 Ga0496110_0005142_3758_4390 210
448 3300048913 Ga0496110_0016972 Ga0496110_0016972_4677_5315 210
449 3300048914 Ga0496111_0057275 Ga0496111_0057275_2089_2727 210
450 3300048914 Ga0496111_0192691 Ga0496111_0192691_58_708 210
451 3300048915 Ga0496112_0000003 Ga0496112_0000003_160062_160694 210
452 3300048916 Ga0496113_0043031 Ga0496113_0043031_2080_2712 210
453 3300048917 Ga0496114_0004542 Ga0496114_0004542_9230_9862 210
454 3300048918 Ga0496115_0050377 Ga0496115_0050377_487_1131 210
455 3300048924 Ga0496121_0023935 Ga0496121_0023935_1852_2505 210
456 3300048928 Ga0496125_0184538 Ga0496125_0184538_495_1127 210
457 3300048929 Ga0496126_0014575 Ga0496126_0014575_7161_7811 210
458 3300049568 Ga0501031_0007261 Ga0501031_0007261_2949_3608 210
459 3300049569 Ga0501032_0009507 Ga0501032_0009507_2927_3586 210
460 3300049569 Ga0501032_0178933 Ga0501032_0178933_261_914 210
461 3300049570 Ga0501033_0010398 Ga0501033_0010398_3484_4143 210
462 3300049571 Ga0501034_0027550 Ga0501034_0027550_3487_4146 210
463 3300049572 Ga0501036_0011808 Ga0501036_0011808_3111_3770 210
464 3300049573 Ga0501037_0009203 Ga0501037_0009203_3178_3837 210
465 3300049574 Ga0501038_0015053 Ga0501038_0015053_2918_3577 210
466 3300049575 Ga0501039_0084478 Ga0501039_0084478_602_1261 210
467 3300049578 Ga0501042_0020700 Ga0501042_0020700_334_975 210
468 3300049578 Ga0501042_0078342 Ga0501042_0078342_462_1151 210
469 3300049578 Ga0501042_0125209 Ga0501042_0125209_974_1633 210
470 3300049579 Ga0501043_0010932 Ga0501043_0010932_2993_3652 210
471 3300049579 Ga0501043_0469640 Ga0501043_0469640_272_925 210
472 3300049580 Ga0501046_0004506 Ga0501046_0004506_8909_9568 210
473 3300049581 Ga0501047_0015685 Ga0501047_0015685_3074_3733 210
474 3300049581 Ga0501047_0031873 Ga0501047_0031873_1994_2653 210
475 3300049582 Ga0501048_0010026 Ga0501048_0010026_3462_4121 210
476 3300049584 Ga0501068_0019590 Ga0501068_0019590_1282_1941 210
477 3300049584 Ga0501068_0070538 Ga0501068_0070538_635_1288 210
478 3300049585 Ga0501069_0013651 Ga0501069_0013651_1440_2093 210
479 3300049585 Ga0501069_0025019 Ga0501069_0025019_2366_3025 210
480 3300049586 Ga0501070_0012402 Ga0501070_0012402_3476_4135 210
481 3300049588 Ga0501072_0118636 Ga0501072_0118636_785_1444 210
482 3300049589 Ga0501073_0009895 Ga0501073_0009895_3437_4096 210
483 3300049590 Ga0501074_0024645 Ga0501074_0024645_1396_2055 210
484 3300049591 Ga0501075_0006937 Ga0501075_0006937_5365_6006 210
485 3300049591 Ga0501075_0253922 Ga0501075_0253922_144_800 210
486 3300049592 Ga0501076_0133602 Ga0501076_0133602_722_1378 210
487 3300049593 Ga0501077_0240534 Ga0501077_0240534_432_1070 210
488 3300049741 Ga0501079_0066546 Ga0501079_0066546_1107_1766 210
489 3300049742 Ga0501080_0007467 Ga0501080_0007467_733_1386 210
490 3300049744 Ga0501083_0008785 Ga0501083_0008785_3462_4121 210
491 3300049744 Ga0501083_0037390 Ga0501083_0037390_370_1023 210
492 3300049822 Ga0501035_0004594 Ga0501035_0004594_8943_9602 210
493 3300049822 Ga0501035_0498108 Ga0501035_0498108_39_698 210
494 3300049823 Ga0501044_0019725 Ga0501044_0019725_3067_3726 210
495 3300049824 Ga0501045_0216033 Ga0501045_0216033_388_1044 210
496 3300050492 nmdc:mga0yw44_66601_c1 nmdc:mga0yw44_66601_c1_1132_1791 210
497 3300050494 nmdc:mga06z11_130577_c1 nmdc:mga06z11_130577_c1_671_1330 210
498 3300050494 nmdc:mga06z11_237693_c1 nmdc:mga06z11_237693_c1_187_837 210
499 3300050494 nmdc:mga06z11_396779_c1 nmdc:mga06z11_396779_c1_106_765 210
500 3300050509 nmdc:mga0qj67_101965_c1 nmdc:mga0qj67_101965_c1_999_1640 210
501 3300050510 nmdc:mga06r32_122677_c1 nmdc:mga06r32_122677_c1_86_727 210
502 3300053077 Ga0495601_0000258 Ga0495601_0000258_13517_14149 210
503 3300053077 Ga0495601_0003264 Ga0495601_0003264_583_1239 210
504 3300053078 Ga0495612_0003045 Ga0495612_0003045_2387_3028 210
505 3300053078 Ga0495612_0008696 Ga0495612_0008696_1465_2115 210
506 3300053084 Ga0495595_0000338 Ga0495595_0000338_15723_16355 210
507 3300053085 Ga0495619_0000243 Ga0495619_0000243_4678_5328 210
508 3300053123 Ga0500614_001316 Ga0500614_001316_5259_5891 210
509 3300053139 Ga0500568_0154603 Ga0500568_0154603_46_699 210
510 3300054114 Ga0501084_0373051 Ga0501084_0373051_48_704 210
511 3300060353 Ga0501082_0024401 Ga0501082_0024401_1646_2305 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01300

Sua5_yciO_yrdC

Telomere recombination

25

200

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3aje-assembly1.cif.gz_A crystal structure of s. tokodaii sua5 complexed with l-threonine and amppnp 0.869 2 208
6f89-assembly1.cif.gz_A structure of h234a/y235a p.abyssi sua5 0.8586 1 205
2eqa-assembly1.cif.gz_A crystal structure of the hypothetical sua5 protein from sulfolobus tokodaii 0.8563 2 209
6f87-assembly3.cif.gz_C crystal structure of p. abyssi sua5 complexed with l-threonine and ppi 0.8549 2 207
6f89-assembly2.cif.gz_B structure of h234a/y235a p.abyssi sua5 0.8547 1 206
ID Description Score Start End Superfamily
af_A0A0R4IB24_661_876_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.8771 4 209 3.90.870.10
af_Q60369_7_206_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.8728 13 204 3.90.870.10
af_P9WGC9_2_211_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.8657 2 208 3.90.870.10
af_A0A1D8PQL4_32_243_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.8601 7 209 3.90.870.10
af_F1QWR2_601_815_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.8596 5 209 3.90.870.10
ID Description Score Start End GO Terms
AF-A0A537ZZP7-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.994 1 207 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A537ZZP7-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9752 1 207 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A2W6BC31-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9637 16 207 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A1H6FHM2-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9466 1 207 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A1H6FHM2-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.929 1 207 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779

Feature Viewer

pLDDT pTM Quality
91.93 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map