F457345
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 511 | 289 | 511 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300049578|Ga0501042_0078342|Ga0501042_0078342_462_1151 |
| Length | 229 |
| Sequence | MIVAMSEVVDIERDGVAAARGALERTIAGGGVAVFPADGLYGLACDPLDAAAIARIHEIKGRDEGKPSAVMYFSPLAMRELVEGFGPRTRDAVGALLPGPLTLVVANPQHRYPLACREDPERLGIRLIEGPLAGAMCPLFQTSANRSGEPAAGSFEQIPAQIVDEVDLAIDGGELTGQPSSVLDLTAFDRSGEWWVLREGAVSSAELEQRLADLTSAAQSGPGGSASSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 141 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 142 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 143 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 144 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 148 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 150 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 154 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 161 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 166 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 167 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 168 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 169 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 170 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 171 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 220 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 221 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 222 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 223 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 224 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 227 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 228 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 229 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 230 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 231 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 232 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 233 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 234 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 235 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 236 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 237 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 238 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 239 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 271 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 272 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 273 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 274 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 283 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 284 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 285 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 286 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 287 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.68 |
| Nodule | 0 |
| Rhizoplane | 9.98 |
| Rhizosphere | 82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000325 | 3300001977 | Bacteria | 6838 |
| 2 | JGI24751J29686_10010572 | 3300002459 | Bacteria | 1902 |
| 3 | Ga0070683_100007429 | 3300005329 | Bacteria | 9261 |
| 4 | Ga0070683_100021869 | 3300005329 | Bacteria | 5709 |
| 5 | Ga0070683_100120233 | 3300005329 | Bacteria | 2481 |
| 6 | Ga0070677_10000057 | 3300005333 | Bacteria | 34822 |
| 7 | Ga0068869_100271279 | 3300005334 | Bacteria | 1361 |
| 8 | Ga0070666_10235173 | 3300005335 | Bacteria | 1295 |
| 9 | Ga0070680_100059546 | 3300005336 | Bacteria | 3125 |
| 10 | Ga0070682_100000013 | 3300005337 | Bacteria | 254641 |
| 11 | Ga0068868_100000151 | 3300005338 | Bacteria | 44963 |
| 12 | Ga0068868_100289706 | 3300005338 | Bacteria | 1388 |
| 13 | Ga0070660_100001214 | 3300005339 | Bacteria | 17496 |
| 14 | Ga0070687_100268044 | 3300005343 | Bacteria | 1069 |
| 15 | Ga0070661_100098151 | 3300005344 | Bacteria | 2176 |
| 16 | Ga0070668_100131231 | 3300005347 | Bacteria | 2011 |
| 17 | Ga0070668_100205753 | 3300005347 | Bacteria | 1617 |
| 18 | Ga0070675_100011302 | 3300005354 | Bacteria | 6987 |
| 19 | Ga0070674_100000082 | 3300005356 | Bacteria | 44418 |
| 20 | Ga0070674_100025824 | 3300005356 | Bacteria | 3828 |
| 21 | Ga0070673_100017272 | 3300005364 | Bacteria | 5125 |
| 22 | Ga0070688_100109917 | 3300005365 | Bacteria | 1832 |
| 23 | Ga0070688_100171538 | 3300005365 | Bacteria | 1498 |
| 24 | Ga0070659_100188737 | 3300005366 | Bacteria | 1693 |
| 25 | Ga0070667_100323287 | 3300005367 | Bacteria | 1392 |
| 26 | Ga0070714_100067896 | 3300005435 | Bacteria | 3076 |
| 27 | Ga0070701_10057983 | 3300005438 | Bacteria | 2031 |
| 28 | Ga0070711_100003694 | 3300005439 | Bacteria | 8959 |
| 29 | Ga0070711_100130638 | 3300005439 | Bacteria | 1870 |
| 30 | Ga0070705_100398070 | 3300005440 | Unclassified | 1019 |
| 31 | Ga0070700_100009313 | 3300005441 | Bacteria | 5382 |
| 32 | Ga0070700_100110610 | 3300005441 | Bacteria | 1826 |
| 33 | Ga0070663_100011872 | 3300005455 | Bacteria | 5490 |
| 34 | Ga0070663_100019356 | 3300005455 | Bacteria | 4484 |
| 35 | Ga0070663_100033112 | 3300005455 | Bacteria | 3568 |
| 36 | Ga0070678_100144185 | 3300005456 | Bacteria | 1910 |
| 37 | Ga0070678_100493528 | 3300005456 | Bacteria | 1079 |
| 38 | Ga0070662_100000016 | 3300005457 | Bacteria | 105820 |
| 39 | Ga0070662_100004751 | 3300005457 | Bacteria | 8601 |
| 40 | Ga0070681_10037206 | 3300005458 | Bacteria | 4885 |
| 41 | Ga0068867_100005240 | 3300005459 | Bacteria | 9151 |
| 42 | Ga0070685_10060157 | 3300005466 | Bacteria | 2220 |
| 43 | Ga0070679_100001299 | 3300005530 | Bacteria | 22062 |
| 44 | Ga0070679_100034564 | 3300005530 | Bacteria | 5010 |
| 45 | Ga0070684_100007568 | 3300005535 | Bacteria | 8458 |
| 46 | Ga0068853_100009433 | 3300005539 | Bacteria | 7863 |
| 47 | Ga0070672_100055041 | 3300005543 | Bacteria | 3116 |
| 48 | Ga0070672_100295045 | 3300005543 | Bacteria | 1373 |
| 49 | Ga0070686_100005659 | 3300005544 | Bacteria | 6922 |
| 50 | Ga0070693_100044347 | 3300005547 | Bacteria | 2516 |
| 51 | Ga0070693_100059710 | 3300005547 | Bacteria | 2211 |
| 52 | Ga0070665_100000244 | 3300005548 | Bacteria | 90284 |
| 53 | Ga0070664_100432858 | 3300005564 | Bacteria | 1206 |
| 54 | Ga0068857_100093174 | 3300005577 | Bacteria | 2698 |
| 55 | Ga0068854_100014034 | 3300005578 | Bacteria | 5273 |
| 56 | Ga0068854_100111254 | 3300005578 | Bacteria | 2066 |
| 57 | Ga0068856_100002478 | 3300005614 | Bacteria | 19005 |
| 58 | Ga0070702_100021814 | 3300005615 | Bacteria | 3377 |
| 59 | Ga0068859_100694055 | 3300005617 | Bacteria | 1109 |
| 60 | Ga0068864_100000045 | 3300005618 | Bacteria | 154739 |
| 61 | Ga0068866_10000001 | 3300005718 | Bacteria | 519680 |
| 62 | Ga0068866_10000170 | 3300005718 | Bacteria | 30223 |
| 63 | Ga0068861_100156559 | 3300005719 | Unclassified | 1875 |
| 64 | Ga0068851_10004889 | 3300005834 | Bacteria | 6070 |
| 65 | Ga0068870_10376318 | 3300005840 | Bacteria | 918 |
| 66 | Ga0068870_10491298 | 3300005840 | Unclassified | 816 |
| 67 | Ga0068863_100044804 | 3300005841 | Bacteria | 4198 |
| 68 | Ga0068863_100233995 | 3300005841 | Bacteria | 1772 |
| 69 | Ga0068858_100000450 | 3300005842 | Bacteria | 43091 |
| 70 | Ga0068858_100520961 | 3300005842 | Bacteria | 1150 |
| 71 | Ga0068860_100003539 | 3300005843 | Bacteria | 16070 |
| 72 | Ga0068860_100236254 | 3300005843 | Bacteria | 1777 |
| 73 | Ga0068862_100001684 | 3300005844 | Bacteria | 20024 |
| 74 | Ga0068862_100056118 | 3300005844 | Bacteria | 3374 |
| 75 | Ga0081455_10029974 | 3300005937 | Bacteria | 4951 |
| 76 | Ga0081455_10078207 | 3300005937 | Bacteria | 2718 |
| 77 | Ga0081455_10103025 | 3300005937 | Bacteria | 2287 |
| 78 | Ga0081455_10124105 | 3300005937 | Bacteria | 2030 |
| 79 | Ga0081455_10181632 | 3300005937 | Bacteria | 1592 |
| 80 | Ga0081455_10283109 | 3300005937 | Unclassified | 1197 |
| 81 | Ga0081538_10000030 | 3300005981 | Bacteria | 124321 |
| 82 | Ga0081538_10000426 | 3300005981 | Bacteria | 47299 |
| 83 | Ga0081540_1001151 | 3300005983 | Bacteria | 23281 |
| 84 | Ga0081540_1108183 | 3300005983 | Unclassified | 1182 |
| 85 | Ga0081539_10005112 | 3300005985 | Bacteria | 13728 |
| 86 | Ga0081539_10192870 | 3300005985 | Unclassified | 947 |
| 87 | Ga0075365_10000463 | 3300006038 | Bacteria | 15223 |
| 88 | Ga0075365_10000477 | 3300006038 | Bacteria | 15128 |
| 89 | Ga0075365_10398371 | 3300006038 | Bacteria | 971 |
| 90 | Ga0075365_10629353 | 3300006038 | Bacteria | 759 |
| 91 | Ga0075363_100006477 | 3300006048 | Bacteria | 5321 |
| 92 | Ga0075363_100031179 | 3300006048 | Bacteria | 2763 |
| 93 | Ga0075363_100375852 | 3300006048 | Bacteria | 832 |
| 94 | Ga0075364_10016871 | 3300006051 | Bacteria | 4550 |
| 95 | Ga0075364_10049570 | 3300006051 | Bacteria | 2739 |
| 96 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 97 | Ga0070715_10220950 | 3300006163 | Bacteria | 974 |
| 98 | Ga0070716_100050897 | 3300006173 | Bacteria | 2353 |
| 99 | Ga0070712_100004037 | 3300006175 | Bacteria | 9007 |
| 100 | Ga0075367_10103137 | 3300006178 | Bacteria | 1745 |
| 101 | Ga0075367_10128059 | 3300006178 | Bacteria | 1568 |
| 102 | Ga0075367_10490911 | 3300006178 | Unclassified | 779 |
| 103 | Ga0075428_101149626 | 3300006844 | Bacteria | 819 |
| 104 | Ga0075430_100063205 | 3300006846 | Bacteria | 3110 |
| 105 | Ga0075431_100098476 | 3300006847 | Bacteria | 3019 |
| 106 | Ga0075433_10000478 | 3300006852 | Bacteria | 26067 |
| 107 | Ga0075434_100519509 | 3300006871 | Bacteria | 1211 |
| 108 | Ga0068865_100004502 | 3300006881 | Bacteria | 8408 |
| 109 | Ga0097620_100693963 | 3300006931 | Bacteria | 1109 |
| 110 | Ga0111539_10350557 | 3300009094 | Unclassified | 1718 |
| 111 | Ga0105245_10000016 | 3300009098 | Bacteria | 204372 |
| 112 | Ga0105245_10000619 | 3300009098 | Bacteria | 32213 |
| 113 | Ga0105245_10008319 | 3300009098 | Bacteria | 9067 |
| 114 | Ga0114129_10484097 | 3300009147 | Bacteria | 1618 |
| 115 | Ga0114129_10811518 | 3300009147 | Bacteria | 1193 |
| 116 | Ga0105243_10026616 | 3300009148 | Bacteria | 4428 |
| 117 | Ga0105243_10084276 | 3300009148 | Bacteria | 2603 |
| 118 | Ga0105242_10017273 | 3300009176 | Bacteria | 5619 |
| 119 | Ga0105242_10881484 | 3300009176 | Unclassified | 893 |
| 120 | Ga0105237_10340962 | 3300009545 | Bacteria | 1503 |
| 121 | Ga0105238_10000201 | 3300009551 | Bacteria | 66092 |
| 122 | Ga0105238_10330107 | 3300009551 | Bacteria | 1512 |
| 123 | Ga0105249_10000068 | 3300009553 | Bacteria | 148594 |
| 124 | Ga0105249_10051297 | 3300009553 | Bacteria | 3763 |
| 125 | Ga0105249_10595970 | 3300009553 | Bacteria | 1159 |
| 126 | Ga0105246_10077622 | 3300011119 | Bacteria | 2357 |
| 127 | Ga0157371_10007587 | 3300013102 | Bacteria | 8752 |
| 128 | Ga0157371_10239545 | 3300013102 | Bacteria | 1305 |
| 129 | Ga0157370_10072556 | 3300013104 | Bacteria | 3247 |
| 130 | Ga0157369_10321734 | 3300013105 | Bacteria | 1608 |
| 131 | Ga0157374_10004501 | 3300013296 | Bacteria | 11709 |
| 132 | Ga0157374_10072421 | 3300013296 | Bacteria | 3251 |
| 133 | Ga0157378_10073726 | 3300013297 | Bacteria | 3069 |
| 134 | Ga0163162_10183718 | 3300013306 | Bacteria | 2217 |
| 135 | Ga0163162_10438342 | 3300013306 | Bacteria | 1439 |
| 136 | Ga0163162_10528924 | 3300013306 | Bacteria | 1308 |
| 137 | Ga0157372_10174632 | 3300013307 | Bacteria | 2487 |
| 138 | Ga0157372_10815975 | 3300013307 | Bacteria | 1083 |
| 139 | Ga0157375_10005569 | 3300013308 | Bacteria | 10958 |
| 140 | Ga0157375_10178127 | 3300013308 | Bacteria | 2277 |
| 141 | Ga0157375_10217481 | 3300013308 | Bacteria | 2069 |
| 142 | Ga0157375_10248214 | 3300013308 | Bacteria | 1940 |
| 143 | Ga0163163_10156591 | 3300014325 | Bacteria | 2322 |
| 144 | Ga0157380_10002780 | 3300014326 | Bacteria | 11890 |
| 145 | Ga0157377_10050907 | 3300014745 | Bacteria | 2335 |
| 146 | Ga0157379_10178958 | 3300014968 | Bacteria | 1916 |
| 147 | Ga0157376_10140926 | 3300014969 | Bacteria | 2163 |
| 148 | Ga0163161_10000032 | 3300017792 | Bacteria | 165511 |
| 149 | Ga0207682_10000129 | 3300025893 | Bacteria | 33994 |
| 150 | Ga0207642_10000006 | 3300025899 | Bacteria | 230268 |
| 151 | Ga0207642_10000007 | 3300025899 | Bacteria | 226017 |
| 152 | Ga0207642_10000100 | 3300025899 | Bacteria | 22988 |
| 153 | Ga0207710_10000158 | 3300025900 | Bacteria | 72527 |
| 154 | Ga0207688_10052156 | 3300025901 | Bacteria | 2292 |
| 155 | Ga0207688_10145866 | 3300025901 | Bacteria | 1395 |
| 156 | Ga0207688_10509347 | 3300025901 | Bacteria | 754 |
| 157 | Ga0207680_10289379 | 3300025903 | Bacteria | 1140 |
| 158 | Ga0207685_10000011 | 3300025905 | Bacteria | 213430 |
| 159 | Ga0207645_10089035 | 3300025907 | Bacteria | 1985 |
| 160 | Ga0207643_10494060 | 3300025908 | Unclassified | 782 |
| 161 | Ga0207707_10011734 | 3300025912 | Bacteria | 7625 |
| 162 | Ga0207693_10007405 | 3300025915 | Bacteria | 9028 |
| 163 | Ga0207663_10040269 | 3300025916 | Bacteria | 2839 |
| 164 | Ga0207663_10047397 | 3300025916 | Bacteria | 2653 |
| 165 | Ga0207657_10022110 | 3300025919 | Bacteria | 5968 |
| 166 | Ga0207652_10002610 | 3300025921 | Bacteria | 15138 |
| 167 | Ga0207652_10022409 | 3300025921 | Bacteria | 5225 |
| 168 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 169 | Ga0207659_10013868 | 3300025926 | Bacteria | 5180 |
| 170 | Ga0207687_10000018 | 3300025927 | Bacteria | 236159 |
| 171 | Ga0207687_10000269 | 3300025927 | Bacteria | 35470 |
| 172 | Ga0207687_10028772 | 3300025927 | Bacteria | 3734 |
| 173 | Ga0207664_10176499 | 3300025929 | Bacteria | 1832 |
| 174 | Ga0207690_10578458 | 3300025932 | Bacteria | 915 |
| 175 | Ga0207706_10000068 | 3300025933 | Bacteria | 105795 |
| 176 | Ga0207706_10009597 | 3300025933 | Bacteria | 8883 |
| 177 | Ga0207686_10010918 | 3300025934 | Bacteria | 4954 |
| 178 | Ga0207686_10016655 | 3300025934 | Bacteria | 4127 |
| 179 | Ga0207686_10026894 | 3300025934 | Bacteria | 3363 |
| 180 | Ga0207709_10355678 | 3300025935 | Bacteria | 1107 |
| 181 | Ga0207670_10713994 | 3300025936 | Bacteria | 831 |
| 182 | Ga0207669_10000004 | 3300025937 | Bacteria | 196828 |
| 183 | Ga0207669_10000012 | 3300025937 | Bacteria | 138242 |
| 184 | Ga0207669_10036455 | 3300025937 | Bacteria | 2811 |
| 185 | Ga0207665_10076143 | 3300025939 | Bacteria | 2300 |
| 186 | Ga0207665_10114697 | 3300025939 | Bacteria | 1897 |
| 187 | Ga0207691_10013831 | 3300025940 | Bacteria | 7705 |
| 188 | Ga0207661_10005133 | 3300025944 | Bacteria | 9197 |
| 189 | Ga0207661_10010344 | 3300025944 | Bacteria | 6714 |
| 190 | Ga0207679_10009136 | 3300025945 | Bacteria | 6336 |
| 191 | Ga0207651_10001019 | 3300025960 | Bacteria | 12393 |
| 192 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 193 | Ga0207712_10362303 | 3300025961 | Bacteria | 1208 |
| 194 | Ga0207668_10017366 | 3300025972 | Bacteria | 4508 |
| 195 | Ga0207668_10383803 | 3300025972 | Bacteria | 1183 |
| 196 | Ga0207668_10555815 | 3300025972 | Bacteria | 995 |
| 197 | Ga0207640_10035024 | 3300025981 | Bacteria | 3138 |
| 198 | Ga0207640_10056964 | 3300025981 | Bacteria | 2569 |
| 199 | Ga0207677_10000421 | 3300026023 | Bacteria | 28837 |
| 200 | Ga0207677_10059255 | 3300026023 | Bacteria | 2640 |
| 201 | Ga0207703_10000040 | 3300026035 | Bacteria | 168191 |
| 202 | Ga0207703_10000322 | 3300026035 | Bacteria | 52048 |
| 203 | Ga0207703_10145475 | 3300026035 | Bacteria | 2061 |
| 204 | Ga0207639_10061761 | 3300026041 | Bacteria | 2895 |
| 205 | Ga0207639_10286427 | 3300026041 | Unclassified | 1451 |
| 206 | Ga0207678_10000834 | 3300026067 | Bacteria | 28248 |
| 207 | Ga0207678_10033206 | 3300026067 | Bacteria | 4497 |
| 208 | Ga0207678_10072290 | 3300026067 | Bacteria | 2956 |
| 209 | Ga0207708_10037663 | 3300026075 | Bacteria | 3684 |
| 210 | Ga0207708_10440999 | 3300026075 | Bacteria | 1083 |
| 211 | Ga0207702_10000016 | 3300026078 | Bacteria | 226633 |
| 212 | Ga0207702_10872258 | 3300026078 | Bacteria | 891 |
| 213 | Ga0207641_10002276 | 3300026088 | Bacteria | 17898 |
| 214 | Ga0207648_10009455 | 3300026089 | Bacteria | 9337 |
| 215 | Ga0207676_10000016 | 3300026095 | Bacteria | 311561 |
| 216 | Ga0207674_10087360 | 3300026116 | Bacteria | 3112 |
| 217 | Ga0207675_100299756 | 3300026118 | Unclassified | 1565 |
| 218 | Ga0207683_10009270 | 3300026121 | Bacteria | 8387 |
| 219 | Ga0207683_10078156 | 3300026121 | Bacteria | 2932 |
| 220 | Ga0207683_10318787 | 3300026121 | Bacteria | 1424 |
| 221 | Ga0268266_10000020 | 3300028379 | Bacteria | 527065 |
| 222 | Ga0268266_10652182 | 3300028379 | Bacteria | 1013 |
| 223 | Ga0268265_10265716 | 3300028380 | Bacteria | 1528 |
| 224 | Ga0268264_10034313 | 3300028381 | Bacteria | 4173 |
| 225 | Ga0268264_10096060 | 3300028381 | Bacteria | 2566 |
| 226 | Ga0265337_1000002 | 3300028556 | Bacteria | 139247 |
| 227 | Ga0265326_10000007 | 3300028558 | Bacteria | 223057 |
| 228 | Ga0265319_1000025 | 3300028563 | Bacteria | 142639 |
| 229 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 230 | Ga0265338_10000486 | 3300028800 | Bacteria | 70900 |
| 231 | Ga0265338_10214343 | 3300028800 | Bacteria | 1443 |
| 232 | Ga0265324_10000309 | 3300029957 | Bacteria | 35875 |
| 233 | Ga0265332_10020233 | 3300031238 | Bacteria | 2938 |
| 234 | Ga0265332_10052251 | 3300031238 | Bacteria | 1755 |
| 235 | Ga0265328_10013764 | 3300031239 | Bacteria | 3195 |
| 236 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 237 | Ga0265325_10026623 | 3300031241 | Bacteria | 3131 |
| 238 | Ga0265329_10004480 | 3300031242 | Bacteria | 5798 |
| 239 | Ga0265339_10022532 | 3300031249 | Bacteria | 3650 |
| 240 | Ga0265331_10000774 | 3300031250 | Bacteria | 26605 |
| 241 | Ga0265331_10013995 | 3300031250 | Bacteria | 4290 |
| 242 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 243 | Ga0265316_10009446 | 3300031344 | Bacteria | 8983 |
| 244 | Ga0265314_10000058 | 3300031711 | Bacteria | 167476 |
| 245 | Ga0265342_10060091 | 3300031712 | Bacteria | 2243 |
| 246 | Ga0307410_10371143 | 3300031852 | Bacteria | 1149 |
| 247 | Ga0307409_100007635 | 3300031995 | Bacteria | 6487 |
| 248 | Ga0307416_100038101 | 3300032002 | Bacteria | 3706 |
| 249 | Ga0307415_100009738 | 3300032126 | Bacteria | 5407 |
| 250 | Ga0307415_100177867 | 3300032126 | Bacteria | 1666 |
| 251 | Ga0373953_0156993 | 3300035117 | Bacteria | 977 |
| 252 | Ga0373937_0018686 | 3300036401 | Bacteria | 6194 |
| 253 | Ga0373937_1004778 | 3300036401 | Bacteria | 783 |
| 254 | Ga0316584_0034701 | 3300036712 | Bacteria | 3740 |
| 255 | Ga0316584_0164990 | 3300036712 | Bacteria | 1645 |
| 256 | Ga0395900_0089401 | 3300037418 | Bacteria | 3166 |
| 257 | Ga0395900_0309994 | 3300037418 | Bacteria | 1562 |
| 258 | Ga0395898_0022749 | 3300037466 | Bacteria | 6344 |
| 259 | Ga0395898_0531744 | 3300037466 | Unclassified | 1117 |
| 260 | Ga0395898_0545831 | 3300037466 | Bacteria | 1101 |
| 261 | Ga0395905_0860325 | 3300037471 | Bacteria | 810 |
| 262 | Ga0395901_0002589 | 3300038443 | Bacteria | 18335 |
| 263 | Ga0395901_0077381 | 3300038443 | Bacteria | 3472 |
| 264 | Ga0395901_0090816 | 3300038443 | Bacteria | 3197 |
| 265 | Ga0395901_0315520 | 3300038443 | Bacteria | 1618 |
| 266 | Ga0395901_0727788 | 3300038443 | Unclassified | 987 |
| 267 | Ga0451853_0709412 | 3300041512 | Bacteria | 4602 |
| 268 | Ga0451853_1528538 | 3300041512 | Bacteria | 1511 |
| 269 | Ga0439440_0076557 | 3300042993 | Unclassified | 879 |
| 270 | Ga0466963_0000023 | 3300044694 | Bacteria | 52546 |
| 271 | Ga0495592_0000036 | 3300046454 | Bacteria | 125461 |
| 272 | Ga0495603_0000097 | 3300046455 | Bacteria | 40321 |
| 273 | Ga0495603_0002177 | 3300046455 | Bacteria | 11524 |
| 274 | Ga0495629_0395852 | 3300046459 | Bacteria | 939 |
| 275 | Ga0495641_0000003 | 3300046461 | Bacteria | 242879 |
| 276 | Ga0495653_0055906 | 3300046463 | Bacteria | 3011 |
| 277 | Ga0495653_0106010 | 3300046463 | Bacteria | 2028 |
| 278 | Ga0495582_0000029 | 3300046473 | Bacteria | 77919 |
| 279 | Ga0495582_0170588 | 3300046473 | Bacteria | 1239 |
| 280 | Ga0495639_0116175 | 3300046475 | Bacteria | 1273 |
| 281 | Ga0495662_0000030 | 3300046476 | Bacteria | 48917 |
| 282 | Ga0495664_0383413 | 3300046477 | Unclassified | 845 |
| 283 | Ga0495596_0198913 | 3300046500 | Bacteria | 779 |
| 284 | Ga0495608_0000204 | 3300046511 | Bacteria | 42513 |
| 285 | Ga0495608_0069753 | 3300046511 | Bacteria | 2295 |
| 286 | Ga0495618_0000004 | 3300046514 | Bacteria | 245690 |
| 287 | Ga0495620_0001199 | 3300046515 | Bacteria | 15860 |
| 288 | Ga0495620_0028316 | 3300046515 | Bacteria | 2608 |
| 289 | Ga0495628_0000924 | 3300046516 | Bacteria | 26910 |
| 290 | Ga0495628_0003694 | 3300046516 | Bacteria | 13645 |
| 291 | Ga0495628_0045269 | 3300046516 | Bacteria | 3500 |
| 292 | Ga0495628_0162908 | 3300046516 | Bacteria | 1694 |
| 293 | Ga0495628_0650956 | 3300046516 | Bacteria | 748 |
| 294 | Ga0495630_0008823 | 3300046517 | Bacteria | 7238 |
| 295 | Ga0495630_0086434 | 3300046517 | Bacteria | 2368 |
| 296 | Ga0495630_0107309 | 3300046517 | Bacteria | 2115 |
| 297 | Ga0495644_0000535 | 3300046523 | Bacteria | 16123 |
| 298 | Ga0495652_0049862 | 3300046529 | Bacteria | 3582 |
| 299 | Ga0495652_0207823 | 3300046529 | Bacteria | 1481 |
| 300 | Ga0495586_0002147 | 3300046535 | Bacteria | 10705 |
| 301 | Ga0495598_0017950 | 3300046537 | Bacteria | 1831 |
| 302 | Ga0495609_0078949 | 3300046538 | Bacteria | 1440 |
| 303 | Ga0495645_0062020 | 3300046543 | Bacteria | 2709 |
| 304 | Ga0495645_0069625 | 3300046543 | Bacteria | 2540 |
| 305 | Ga0495645_0198402 | 3300046543 | Bacteria | 1363 |
| 306 | Ga0495622_0000014 | 3300046557 | Bacteria | 182142 |
| 307 | Ga0495667_0000032 | 3300046559 | Bacteria | 143493 |
| 308 | Ga0495656_0000617 | 3300046615 | Bacteria | 11371 |
| 309 | Ga0495634_0001201 | 3300046642 | Bacteria | 23885 |
| 310 | Ga0495634_0001774 | 3300046642 | Bacteria | 18668 |
| 311 | Ga0495634_0283298 | 3300046642 | Unclassified | 1006 |
| 312 | Ga0495625_0000122 | 3300046660 | Bacteria | 121146 |
| 313 | Ga0495625_0321982 | 3300046660 | Bacteria | 984 |
| 314 | Ga0495635_0000016 | 3300046663 | Bacteria | 214088 |
| 315 | Ga0495659_0109162 | 3300046664 | Bacteria | 1079 |
| 316 | Ga0495599_0003118 | 3300046678 | Bacteria | 9659 |
| 317 | Ga0495647_0000025 | 3300046681 | Bacteria | 65184 |
| 318 | Ga0495647_0002619 | 3300046681 | Bacteria | 5703 |
| 319 | Ga0495647_0070407 | 3300046681 | Bacteria | 1399 |
| 320 | Ga0495658_0000026 | 3300046683 | Bacteria | 77681 |
| 321 | Ga0495658_0580231 | 3300046683 | Bacteria | 718 |
| 322 | Ga0495669_0000260 | 3300046684 | Bacteria | 30549 |
| 323 | Ga0495669_0048162 | 3300046684 | Bacteria | 1906 |
| 324 | Ga0495613_0000152 | 3300046689 | Bacteria | 68384 |
| 325 | Ga0495613_0260737 | 3300046689 | Bacteria | 1208 |
| 326 | Ga0495624_0000009 | 3300046690 | Bacteria | 145026 |
| 327 | Ga0495624_0007124 | 3300046690 | Bacteria | 7868 |
| 328 | Ga0495670_0002839 | 3300046691 | Bacteria | 8563 |
| 329 | Ga0495649_0004521 | 3300046694 | Bacteria | 9080 |
| 330 | Ga0495600_0001553 | 3300046809 | Bacteria | 12768 |
| 331 | Ga0495600_0069366 | 3300046809 | Unclassified | 2304 |
| 332 | Ga0495600_0410043 | 3300046809 | Bacteria | 842 |
| 333 | Ga0495604_0000019 | 3300047317 | Bacteria | 175064 |
| 334 | Ga0495676_0000676 | 3300047321 | Bacteria | 28342 |
| 335 | Ga0495676_0178244 | 3300047321 | Bacteria | 1491 |
| 336 | Ga0495680_0000061 | 3300047322 | Bacteria | 90676 |
| 337 | Ga0495680_0001562 | 3300047322 | Bacteria | 24515 |
| 338 | Ga0495680_0004057 | 3300047322 | Bacteria | 14116 |
| 339 | Ga0495679_003496 | 3300047446 | Bacteria | 7522 |
| 340 | Ga0495685_006643 | 3300047447 | Bacteria | 3797 |
| 341 | Ga0495593_0088610 | 3300047673 | Bacteria | 1595 |
| 342 | Ga0495602_0005647 | 3300048088 | Bacteria | 13115 |
| 343 | Ga0495602_0057688 | 3300048088 | Bacteria | 3404 |
| 344 | Ga0495602_0090567 | 3300048088 | Bacteria | 2540 |
| 345 | Ga0495614_0044362 | 3300048089 | Bacteria | 1907 |
| 346 | Ga0495614_0060807 | 3300048089 | Bacteria | 1623 |
| 347 | Ga0496100_0000002 | 3300048903 | Bacteria | 489057 |
| 348 | Ga0496100_0039466 | 3300048903 | Bacteria | 2999 |
| 349 | Ga0496100_0572414 | 3300048903 | Bacteria | 875 |
| 350 | Ga0496101_0000001 | 3300048904 | Bacteria | 489057 |
| 351 | Ga0496101_0000361 | 3300048904 | Bacteria | 30335 |
| 352 | Ga0496102_0011652 | 3300048905 | Bacteria | 7588 |
| 353 | Ga0496102_0090162 | 3300048905 | Bacteria | 2837 |
| 354 | Ga0496102_1180343 | 3300048905 | Bacteria | 685 |
| 355 | Ga0496103_0001929 | 3300048906 | Bacteria | 13440 |
| 356 | Ga0496104_0000009 | 3300048907 | Bacteria | 488055 |
| 357 | Ga0496104_0001485 | 3300048907 | Bacteria | 20235 |
| 358 | Ga0496104_0210144 | 3300048907 | Bacteria | 1857 |
| 359 | Ga0496105_0000027 | 3300048908 | Bacteria | 148197 |
| 360 | Ga0496105_0013792 | 3300048908 | Bacteria | 6418 |
| 361 | Ga0496105_0027203 | 3300048908 | Bacteria | 4670 |
| 362 | Ga0496105_0061227 | 3300048908 | Bacteria | 3105 |
| 363 | Ga0496105_0067101 | 3300048908 | Bacteria | 2962 |
| 364 | Ga0496106_0000149 | 3300048909 | Bacteria | 51656 |
| 365 | Ga0496106_0010639 | 3300048909 | Bacteria | 6798 |
| 366 | Ga0496106_0022376 | 3300048909 | Bacteria | 4695 |
| 367 | Ga0496107_0000013 | 3300048910 | Bacteria | 178284 |
| 368 | Ga0496107_0035131 | 3300048910 | Bacteria | 3594 |
| 369 | Ga0496107_0083020 | 3300048910 | Bacteria | 2336 |
| 370 | Ga0496107_0094475 | 3300048910 | Bacteria | 2187 |
| 371 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 372 | Ga0496108_0000132 | 3300048911 | Bacteria | 73888 |
| 373 | Ga0496108_0005465 | 3300048911 | Bacteria | 10273 |
| 374 | Ga0496108_0022532 | 3300048911 | Bacteria | 5179 |
| 375 | Ga0496108_0031216 | 3300048911 | Bacteria | 4418 |
| 376 | Ga0496109_0000003 | 3300048912 | Bacteria | 420862 |
| 377 | Ga0496109_0000007 | 3300048912 | Bacteria | 247554 |
| 378 | Ga0496109_0000190 | 3300048912 | Bacteria | 61169 |
| 379 | Ga0496109_0070434 | 3300048912 | Bacteria | 3209 |
| 380 | Ga0496109_0119987 | 3300048912 | Bacteria | 2449 |
| 381 | Ga0496109_0207818 | 3300048912 | Unclassified | 1841 |
| 382 | Ga0496110_0001729 | 3300048913 | Bacteria | 16080 |
| 383 | Ga0496110_0005142 | 3300048913 | Bacteria | 10223 |
| 384 | Ga0496110_0005255 | 3300048913 | Bacteria | 10131 |
| 385 | Ga0496110_0016972 | 3300048913 | Bacteria | 6086 |
| 386 | Ga0496110_0168344 | 3300048913 | Bacteria | 1988 |
| 387 | Ga0496111_0003411 | 3300048914 | Bacteria | 9836 |
| 388 | Ga0496111_0057275 | 3300048914 | Bacteria | 2821 |
| 389 | Ga0496111_0192691 | 3300048914 | Bacteria | 1515 |
| 390 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 391 | Ga0496112_0104474 | 3300048915 | Bacteria | 2803 |
| 392 | Ga0496112_0130572 | 3300048915 | Bacteria | 2483 |
| 393 | Ga0496113_0043031 | 3300048916 | Bacteria | 3340 |
| 394 | Ga0496113_0048178 | 3300048916 | Bacteria | 3170 |
| 395 | Ga0496114_0001417 | 3300048917 | Bacteria | 18199 |
| 396 | Ga0496114_0004542 | 3300048917 | Bacteria | 10776 |
| 397 | Ga0496115_0050377 | 3300048918 | Bacteria | 3336 |
| 398 | Ga0496117_0009156 | 3300048920 | Bacteria | 9280 |
| 399 | Ga0496118_0004300 | 3300048921 | Bacteria | 17014 |
| 400 | Ga0496119_0008077 | 3300048922 | Bacteria | 9335 |
| 401 | Ga0496119_0013029 | 3300048922 | Bacteria | 6674 |
| 402 | Ga0496120_0016747 | 3300048923 | Bacteria | 4778 |
| 403 | Ga0496121_0023935 | 3300048924 | Bacteria | 5856 |
| 404 | Ga0496121_0038056 | 3300048924 | Bacteria | 4267 |
| 405 | Ga0496125_0096586 | 3300048928 | Bacteria | 2193 |
| 406 | Ga0496125_0184538 | 3300048928 | Bacteria | 1385 |
| 407 | Ga0496126_0014575 | 3300048929 | Bacteria | 7941 |
| 408 | Ga0501031_0007261 | 3300049568 | Bacteria | 7228 |
| 409 | Ga0501032_0009507 | 3300049569 | Bacteria | 7045 |
| 410 | Ga0501032_0178933 | 3300049569 | Bacteria | 1389 |
| 411 | Ga0501033_0010398 | 3300049570 | Bacteria | 7136 |
| 412 | Ga0501034_0027550 | 3300049571 | Bacteria | 5779 |
| 413 | Ga0501036_0011808 | 3300049572 | Bacteria | 7239 |
| 414 | Ga0501037_0009203 | 3300049573 | Bacteria | 7239 |
| 415 | Ga0501038_0015053 | 3300049574 | Bacteria | 7042 |
| 416 | Ga0501039_0084478 | 3300049575 | Bacteria | 2472 |
| 417 | Ga0501041_0030914 | 3300049577 | Bacteria | 3232 |
| 418 | Ga0501042_0020700 | 3300049578 | Bacteria | 4580 |
| 419 | Ga0501042_0078342 | 3300049578 | Bacteria | 2367 |
| 420 | Ga0501042_0125209 | 3300049578 | Bacteria | 1850 |
| 421 | Ga0501043_0010932 | 3300049579 | Bacteria | 7110 |
| 422 | Ga0501043_0469640 | 3300049579 | Bacteria | 943 |
| 423 | Ga0501046_0004506 | 3300049580 | Bacteria | 12624 |
| 424 | Ga0501046_0143649 | 3300049580 | Bacteria | 1804 |
| 425 | Ga0501047_0015685 | 3300049581 | Bacteria | 7219 |
| 426 | Ga0501047_0031873 | 3300049581 | Bacteria | 5086 |
| 427 | Ga0501047_0070990 | 3300049581 | Bacteria | 3352 |
| 428 | Ga0501048_0010026 | 3300049582 | Bacteria | 7089 |
| 429 | Ga0501048_0070524 | 3300049582 | Bacteria | 2468 |
| 430 | Ga0501048_0391868 | 3300049582 | Bacteria | 992 |
| 431 | Ga0501068_0019590 | 3300049584 | Bacteria | 3932 |
| 432 | Ga0501068_0070538 | 3300049584 | Bacteria | 2132 |
| 433 | Ga0501069_0013651 | 3300049585 | Bacteria | 4334 |
| 434 | Ga0501069_0025019 | 3300049585 | Bacteria | 3260 |
| 435 | Ga0501070_0006027 | 3300049586 | Bacteria | 10324 |
| 436 | Ga0501070_0012402 | 3300049586 | Bacteria | 7189 |
| 437 | Ga0501070_0181010 | 3300049586 | Bacteria | 1734 |
| 438 | Ga0501071_0186507 | 3300049587 | Bacteria | 1555 |
| 439 | Ga0501072_0008803 | 3300049588 | Bacteria | 7665 |
| 440 | Ga0501072_0038561 | 3300049588 | Bacteria | 3750 |
| 441 | Ga0501072_0112714 | 3300049588 | Bacteria | 2165 |
| 442 | Ga0501072_0118636 | 3300049588 | Bacteria | 2108 |
| 443 | Ga0501073_0009895 | 3300049589 | Bacteria | 7018 |
| 444 | Ga0501074_0024645 | 3300049590 | Bacteria | 4370 |
| 445 | Ga0501074_0070873 | 3300049590 | Bacteria | 2506 |
| 446 | Ga0501074_0264979 | 3300049590 | Unclassified | 1221 |
| 447 | Ga0501074_0316432 | 3300049590 | Bacteria | 1108 |
| 448 | Ga0501075_0006937 | 3300049591 | Bacteria | 7826 |
| 449 | Ga0501075_0011190 | 3300049591 | Bacteria | 6343 |
| 450 | Ga0501075_0253922 | 3300049591 | Bacteria | 1340 |
| 451 | Ga0501075_0257651 | 3300049591 | Unclassified | 1329 |
| 452 | Ga0501076_0072499 | 3300049592 | Bacteria | 2756 |
| 453 | Ga0501076_0133602 | 3300049592 | Bacteria | 2014 |
| 454 | Ga0501077_0240534 | 3300049593 | Unclassified | 1151 |
| 455 | Ga0501079_0037582 | 3300049741 | Bacteria | 3732 |
| 456 | Ga0501079_0066546 | 3300049741 | Bacteria | 2780 |
| 457 | Ga0501080_0007467 | 3300049742 | Bacteria | 9869 |
| 458 | Ga0501080_0953843 | 3300049742 | Bacteria | 746 |
| 459 | Ga0501081_0143593 | 3300049743 | Bacteria | 1711 |
| 460 | Ga0501081_0413123 | 3300049743 | Bacteria | 1000 |
| 461 | Ga0501081_0893612 | 3300049743 | Unclassified | 670 |
| 462 | Ga0501083_0008785 | 3300049744 | Bacteria | 7131 |
| 463 | Ga0501083_0037390 | 3300049744 | Bacteria | 3307 |
| 464 | Ga0501083_0231609 | 3300049744 | Unclassified | 1203 |
| 465 | Ga0501083_0280695 | 3300049744 | Bacteria | 1083 |
| 466 | Ga0501035_0004594 | 3300049822 | Bacteria | 13088 |
| 467 | Ga0501035_0498108 | 3300049822 | Bacteria | 1003 |
| 468 | Ga0501044_0009242 | 3300049823 | Bacteria | 10765 |
| 469 | Ga0501044_0019725 | 3300049823 | Bacteria | 7204 |
| 470 | Ga0501045_0040403 | 3300049824 | Bacteria | 3395 |
| 471 | Ga0501045_0058581 | 3300049824 | Bacteria | 2821 |
| 472 | Ga0501045_0216033 | 3300049824 | Bacteria | 1428 |
| 473 | nmdc:mga03n38_162569_c1 | 3300050490 | Unclassified | 1131 |
| 474 | nmdc:mga00v17_106452_c1 | 3300050491 | Bacteria | 1775 |
| 475 | nmdc:mga00v17_22375_c1 | 3300050491 | Bacteria | 3647 |
| 476 | nmdc:mga00v17_66116_c1 | 3300050491 | Bacteria | 2232 |
| 477 | nmdc:mga0yw44_12345_c1 | 3300050492 | Bacteria | 4449 |
| 478 | nmdc:mga0yw44_216078_c1 | 3300050492 | Unclassified | 1269 |
| 479 | nmdc:mga0yw44_398694_c1 | 3300050492 | Unclassified | 930 |
| 480 | nmdc:mga0yw44_66601_c1 | 3300050492 | Bacteria | 2223 |
| 481 | nmdc:mga06z11_130577_c1 | 3300050494 | Bacteria | 1410 |
| 482 | nmdc:mga06z11_216202_c1 | 3300050494 | Unclassified | 1118 |
| 483 | nmdc:mga06z11_237693_c1 | 3300050494 | Bacteria | 1069 |
| 484 | nmdc:mga06z11_396779_c1 | 3300050494 | Unclassified | 830 |
| 485 | nmdc:mga0qj67_101965_c1 | 3300050509 | Bacteria | 2314 |
| 486 | nmdc:mga0qj67_264404_c1 | 3300050509 | Unclassified | 1395 |
| 487 | nmdc:mga06r32_122677_c1 | 3300050510 | Bacteria | 2564 |
| 488 | nmdc:mga08y16_544672_c1 | 3300050511 | Bacteria | 1175 |
| 489 | nmdc:mga0n895_482937_c1 | 3300050512 | Bacteria | 1249 |
| 490 | Ga0495601_0000258 | 3300053077 | Bacteria | 28539 |
| 491 | Ga0495601_0002866 | 3300053077 | Bacteria | 9802 |
| 492 | Ga0495601_0003264 | 3300053077 | Bacteria | 9268 |
| 493 | Ga0495601_0200798 | 3300053077 | Bacteria | 1303 |
| 494 | Ga0495612_0000098 | 3300053078 | Bacteria | 37601 |
| 495 | Ga0495612_0003045 | 3300053078 | Bacteria | 6953 |
| 496 | Ga0495612_0008696 | 3300053078 | Bacteria | 4118 |
| 497 | Ga0495595_0000338 | 3300053084 | Bacteria | 18068 |
| 498 | Ga0495619_0000243 | 3300053085 | Bacteria | 39638 |
| 499 | Ga0495619_0069790 | 3300053085 | Bacteria | 2349 |
| 500 | Ga0500554_007168 | 3300053102 | Bacteria | 2549 |
| 501 | Ga0500595_014231 | 3300053119 | Bacteria | 3024 |
| 502 | Ga0500614_001316 | 3300053123 | Bacteria | 5986 |
| 503 | Ga0500658_0034552 | 3300053134 | Bacteria | 1996 |
| 504 | Ga0500568_0154603 | 3300053139 | Bacteria | 848 |
| 505 | Ga0501084_0057387 | 3300054114 | Bacteria | 3258 |
| 506 | Ga0501084_0373051 | 3300054114 | Bacteria | 1206 |
| 507 | Ga0501082_0024401 | 3300060353 | Bacteria | 5213 |
| 508 | Ga0501082_0032106 | 3300060353 | Bacteria | 4530 |
| 509 | Ga0501082_0166071 | 3300060353 | Bacteria | 1918 |
| 510 | Ga0530510_0202911 | 3300061734 | Bacteria | 1473 |
| 511 | Ga0530510_0263187 | 3300061734 | Unclassified | 1286 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_0860325 | Ga0395905_0860325_30_590 | 183 |
| 2 | 3300005347 | Ga0070668_100131231 | Ga0070668_1001312312 | 186 |
| 3 | 3300025972 | Ga0207668_10017366 | Ga0207668_100173664 | 186 |
| 4 | 3300049590 | Ga0501074_0316432 | Ga0501074_0316432_165_797 | 186 |
| 5 | 3300049744 | Ga0501083_0280695 | Ga0501083_0280695_139_771 | 186 |
| 6 | 3300025907 | Ga0207645_10089035 | Ga0207645_100890353 | 187 |
| 7 | 3300005937 | Ga0081455_10283109 | Ga0081455_102831091 | 188 |
| 8 | 3300048905 | Ga0496102_1180343 | Ga0496102_1180343_87_671 | 188 |
| 9 | 3300049823 | Ga0501044_0009242 | Ga0501044_0009242_9919_10572 | 189 |
| 10 | 3300032126 | Ga0307415_100009738 | Ga0307415_1000097386 | 191 |
| 11 | 3300046642 | Ga0495634_0001774 | Ga0495634_0001774_14286_14876 | 192 |
| 12 | 3300048922 | Ga0496119_0008077 | Ga0496119_0008077_8639_9292 | 192 |
| 13 | 3300025901 | Ga0207688_10509347 | Ga0207688_105093472 | 194 |
| 14 | 3300049590 | Ga0501074_0070873 | Ga0501074_0070873_1652_2302 | 194 |
| 15 | 3300009551 | Ga0105238_10330107 | Ga0105238_103301072 | 195 |
| 16 | 3300013105 | Ga0157369_10321734 | Ga0157369_103217342 | 195 |
| 17 | 3300049581 | Ga0501047_0070990 | Ga0501047_0070990_65_694 | 195 |
| 18 | 3300053119 | Ga0500595_014231 | Ga0500595_014231_462_1115 | 195 |
| 19 | 3300005840 | Ga0068870_10491298 | Ga0068870_104912982 | 196 |
| 20 | 3300025908 | Ga0207643_10494060 | Ga0207643_104940602 | 196 |
| 21 | 3300005543 | Ga0070672_100295045 | Ga0070672_1002950452 | 197 |
| 22 | 3300026078 | Ga0207702_10872258 | Ga0207702_108722581 | 197 |
| 23 | 3300037418 | Ga0395900_0089401 | Ga0395900_0089401_1948_2565 | 198 |
| 24 | 3300038443 | Ga0395901_0090816 | Ga0395901_0090816_1307_1924 | 198 |
| 25 | 3300005329 | Ga0070683_100021869 | Ga0070683_1000218692 | 199 |
| 26 | 3300005455 | Ga0070663_100011872 | Ga0070663_1000118722 | 199 |
| 27 | 3300005530 | Ga0070679_100034564 | Ga0070679_1000345647 | 199 |
| 28 | 3300025921 | Ga0207652_10022409 | Ga0207652_100224097 | 199 |
| 29 | 3300025944 | Ga0207661_10010344 | Ga0207661_100103447 | 199 |
| 30 | 3300026067 | Ga0207678_10000834 | Ga0207678_1000083423 | 199 |
| 31 | 3300036712 | Ga0316584_0034701 | Ga0316584_0034701_2231_2875 | 199 |
| 32 | 3300046684 | Ga0495669_0048162 | Ga0495669_0048162_365_991 | 199 |
| 33 | 3300048903 | Ga0496100_0039466 | Ga0496100_0039466_1118_1768 | 199 |
| 34 | 3300048908 | Ga0496105_0013792 | Ga0496105_0013792_3411_4061 | 199 |
| 35 | 3300048913 | Ga0496110_0168344 | Ga0496110_0168344_1229_1879 | 199 |
| 36 | 3300048922 | Ga0496119_0013029 | Ga0496119_0013029_2887_3537 | 199 |
| 37 | 3300048924 | Ga0496121_0038056 | Ga0496121_0038056_2614_3264 | 199 |
| 38 | 3300048928 | Ga0496125_0096586 | Ga0496125_0096586_736_1386 | 199 |
| 39 | 3300049742 | Ga0501080_0953843 | Ga0501080_0953843_20_673 | 199 |
| 40 | 3300053134 | Ga0500658_0034552 | Ga0500658_0034552_954_1607 | 199 |
| 41 | 3300050490 | nmdc:mga03n38_162569_c1 | nmdc:mga03n38_162569_c1_345_1001 | 201 |
| 42 | 3300014969 | Ga0157376_10140926 | Ga0157376_101409262 | 203 |
| 43 | 3300048923 | Ga0496120_0016747 | Ga0496120_0016747_2244_2897 | 203 |
| 44 | 3300009553 | Ga0105249_10595970 | Ga0105249_105959702 | 204 |
| 45 | 3300050509 | nmdc:mga0qj67_264404_c1 | nmdc:mga0qj67_264404_c1_50_673 | 204 |
| 46 | 3300006038 | Ga0075365_10398371 | Ga0075365_103983712 | 206 |
| 47 | 3300005356 | Ga0070674_100025824 | Ga0070674_1000258244 | 207 |
| 48 | 3300005365 | Ga0070688_100109917 | Ga0070688_1001099172 | 207 |
| 49 | 3300005439 | Ga0070711_100003694 | Ga0070711_1000036943 | 207 |
| 50 | 3300005456 | Ga0070678_100493528 | Ga0070678_1004935282 | 207 |
| 51 | 3300005466 | Ga0070685_10060157 | Ga0070685_100601572 | 207 |
| 52 | 3300005544 | Ga0070686_100005659 | Ga0070686_1000056593 | 207 |
| 53 | 3300006163 | Ga0070715_10220950 | Ga0070715_102209502 | 207 |
| 54 | 3300006173 | Ga0070716_100050897 | Ga0070716_1000508973 | 207 |
| 55 | 3300006175 | Ga0070712_100004037 | Ga0070712_10000403711 | 207 |
| 56 | 3300009148 | Ga0105243_10084276 | Ga0105243_100842763 | 207 |
| 57 | 3300011119 | Ga0105246_10077622 | Ga0105246_100776223 | 207 |
| 58 | 3300013306 | Ga0163162_10183718 | Ga0163162_101837183 | 207 |
| 59 | 3300013306 | Ga0163162_10528924 | Ga0163162_105289242 | 207 |
| 60 | 3300013307 | Ga0157372_10815975 | Ga0157372_108159752 | 207 |
| 61 | 3300013308 | Ga0157375_10005569 | Ga0157375_1000556910 | 207 |
| 62 | 3300025901 | Ga0207688_10052156 | Ga0207688_100521563 | 207 |
| 63 | 3300025915 | Ga0207693_10007405 | Ga0207693_1000740511 | 207 |
| 64 | 3300025916 | Ga0207663_10040269 | Ga0207663_100402692 | 207 |
| 65 | 3300025927 | Ga0207687_10028772 | Ga0207687_100287722 | 207 |
| 66 | 3300025935 | Ga0207709_10355678 | Ga0207709_103556782 | 207 |
| 67 | 3300025937 | Ga0207669_10036455 | Ga0207669_100364553 | 207 |
| 68 | 3300025939 | Ga0207665_10076143 | Ga0207665_100761433 | 207 |
| 69 | 3300026121 | Ga0207683_10009270 | Ga0207683_100092703 | 207 |
| 70 | 3300046463 | Ga0495653_0055906 | Ga0495653_0055906_330_965 | 207 |
| 71 | 3300046473 | Ga0495582_0170588 | Ga0495582_0170588_44_670 | 207 |
| 72 | 3300046557 | Ga0495622_0000014 | Ga0495622_0000014_20921_21568 | 207 |
| 73 | 3300046683 | Ga0495658_0580231 | Ga0495658_0580231_49_675 | 207 |
| 74 | 3300046689 | Ga0495613_0260737 | Ga0495613_0260737_398_1021 | 207 |
| 75 | 3300048089 | Ga0495614_0060807 | Ga0495614_0060807_501_1127 | 207 |
| 76 | 3300048903 | Ga0496100_0572414 | Ga0496100_0572414_238_864 | 207 |
| 77 | 3300048904 | Ga0496101_0000361 | Ga0496101_0000361_15104_15730 | 207 |
| 78 | 3300048905 | Ga0496102_0011652 | Ga0496102_0011652_6706_7332 | 207 |
| 79 | 3300048905 | Ga0496102_0090162 | Ga0496102_0090162_194_826 | 207 |
| 80 | 3300048906 | Ga0496103_0001929 | Ga0496103_0001929_8968_9594 | 207 |
| 81 | 3300048907 | Ga0496104_0210144 | Ga0496104_0210144_1198_1824 | 207 |
| 82 | 3300048908 | Ga0496105_0067101 | Ga0496105_0067101_1940_2566 | 207 |
| 83 | 3300048909 | Ga0496106_0010639 | Ga0496106_0010639_1950_2576 | 207 |
| 84 | 3300048910 | Ga0496107_0094475 | Ga0496107_0094475_161_787 | 207 |
| 85 | 3300048911 | Ga0496108_0005465 | Ga0496108_0005465_5789_6436 | 207 |
| 86 | 3300048911 | Ga0496108_0031216 | Ga0496108_0031216_2034_2660 | 207 |
| 87 | 3300048912 | Ga0496109_0070434 | Ga0496109_0070434_705_1352 | 207 |
| 88 | 3300048913 | Ga0496110_0005255 | Ga0496110_0005255_5439_6065 | 207 |
| 89 | 3300048914 | Ga0496111_0003411 | Ga0496111_0003411_3354_3980 | 207 |
| 90 | 3300048915 | Ga0496112_0130572 | Ga0496112_0130572_123_749 | 207 |
| 91 | 3300048916 | Ga0496113_0048178 | Ga0496113_0048178_2036_2683 | 207 |
| 92 | 3300048917 | Ga0496114_0001417 | Ga0496114_0001417_257_883 | 207 |
| 93 | 3300048920 | Ga0496117_0009156 | Ga0496117_0009156_6216_6848 | 207 |
| 94 | 3300048921 | Ga0496118_0004300 | Ga0496118_0004300_13921_14553 | 207 |
| 95 | 3300005329 | Ga0070683_100120233 | Ga0070683_1001202332 | 208 |
| 96 | 3300005564 | Ga0070664_100432858 | Ga0070664_1004328582 | 208 |
| 97 | 3300005618 | Ga0068864_100000045 | Ga0068864_10000004512 | 208 |
| 98 | 3300005985 | Ga0081539_10192870 | Ga0081539_101928702 | 208 |
| 99 | 3300006038 | Ga0075365_10000477 | Ga0075365_1000047715 | 208 |
| 100 | 3300006051 | Ga0075364_10016871 | Ga0075364_100168714 | 208 |
| 101 | 3300009147 | Ga0114129_10484097 | Ga0114129_104840972 | 208 |
| 102 | 3300009176 | Ga0105242_10017273 | Ga0105242_100172734 | 208 |
| 103 | 3300025939 | Ga0207665_10114697 | Ga0207665_101146972 | 208 |
| 104 | 3300026095 | Ga0207676_10000016 | Ga0207676_10000016151 | 208 |
| 105 | 3300036401 | Ga0373937_1004778 | Ga0373937_1004778_40_666 | 208 |
| 106 | 3300037466 | Ga0395898_0022749 | Ga0395898_0022749_4046_4693 | 208 |
| 107 | 3300038443 | Ga0395901_0002589 | Ga0395901_0002589_16165_16812 | 208 |
| 108 | 3300038443 | Ga0395901_0077381 | Ga0395901_0077381_1798_2424 | 208 |
| 109 | 3300046615 | Ga0495656_0000617 | Ga0495656_0000617_9800_10483 | 208 |
| 110 | 3300046809 | Ga0495600_0069366 | Ga0495600_0069366_861_1487 | 208 |
| 111 | 3300048913 | Ga0496110_0001729 | Ga0496110_0001729_12216_12842 | 208 |
| 112 | 3300048915 | Ga0496112_0104474 | Ga0496112_0104474_2001_2627 | 208 |
| 113 | 3300049586 | Ga0501070_0006027 | Ga0501070_0006027_2156_2791 | 208 |
| 114 | 3300049586 | Ga0501070_0181010 | Ga0501070_0181010_598_1233 | 208 |
| 115 | 3300049588 | Ga0501072_0112714 | Ga0501072_0112714_15_650 | 208 |
| 116 | 3300049590 | Ga0501074_0264979 | Ga0501074_0264979_157_792 | 208 |
| 117 | 3300050491 | nmdc:mga00v17_22375_c1 | nmdc:mga00v17_22375_c1_2470_3102 | 208 |
| 118 | 3300050492 | nmdc:mga0yw44_12345_c1 | nmdc:mga0yw44_12345_c1_3766_4398 | 208 |
| 119 | 3300050492 | nmdc:mga0yw44_398694_c1 | nmdc:mga0yw44_398694_c1_203_835 | 208 |
| 120 | 3300050494 | nmdc:mga06z11_216202_c1 | nmdc:mga06z11_216202_c1_464_1096 | 208 |
| 121 | 3300053077 | Ga0495601_0200798 | Ga0495601_0200798_266_892 | 208 |
| 122 | 3300053078 | Ga0495612_0000098 | Ga0495612_0000098_13608_14234 | 208 |
| 123 | 3300005343 | Ga0070687_100268044 | Ga0070687_1002680442 | 209 |
| 124 | 3300005844 | Ga0068862_100056118 | Ga0068862_1000561184 | 209 |
| 125 | 3300006038 | Ga0075365_10629353 | Ga0075365_106293531 | 209 |
| 126 | 3300006051 | Ga0075364_10049570 | Ga0075364_100495702 | 209 |
| 127 | 3300006852 | Ga0075433_10000478 | Ga0075433_1000047822 | 209 |
| 128 | 3300006871 | Ga0075434_100519509 | Ga0075434_1005195092 | 209 |
| 129 | 3300009094 | Ga0111539_10350557 | Ga0111539_103505572 | 209 |
| 130 | 3300013104 | Ga0157370_10072556 | Ga0157370_100725563 | 209 |
| 131 | 3300028380 | Ga0268265_10265716 | Ga0268265_102657162 | 209 |
| 132 | 3300048907 | Ga0496104_0001485 | Ga0496104_0001485_12734_13378 | 209 |
| 133 | 3300048908 | Ga0496105_0061227 | Ga0496105_0061227_2328_2972 | 209 |
| 134 | 3300049577 | Ga0501041_0030914 | Ga0501041_0030914_30_659 | 209 |
| 135 | 3300049580 | Ga0501046_0143649 | Ga0501046_0143649_843_1472 | 209 |
| 136 | 3300049582 | Ga0501048_0070524 | Ga0501048_0070524_1682_2311 | 209 |
| 137 | 3300049582 | Ga0501048_0391868 | Ga0501048_0391868_130_759 | 209 |
| 138 | 3300049587 | Ga0501071_0186507 | Ga0501071_0186507_206_835 | 209 |
| 139 | 3300049588 | Ga0501072_0008803 | Ga0501072_0008803_5070_5699 | 209 |
| 140 | 3300049588 | Ga0501072_0038561 | Ga0501072_0038561_2704_3333 | 209 |
| 141 | 3300049591 | Ga0501075_0011190 | Ga0501075_0011190_557_1186 | 209 |
| 142 | 3300049591 | Ga0501075_0257651 | Ga0501075_0257651_402_1031 | 209 |
| 143 | 3300049592 | Ga0501076_0072499 | Ga0501076_0072499_2085_2714 | 209 |
| 144 | 3300049741 | Ga0501079_0037582 | Ga0501079_0037582_474_1103 | 209 |
| 145 | 3300049743 | Ga0501081_0143593 | Ga0501081_0143593_280_909 | 209 |
| 146 | 3300049743 | Ga0501081_0413123 | Ga0501081_0413123_238_867 | 209 |
| 147 | 3300049743 | Ga0501081_0893612 | Ga0501081_0893612_28_657 | 209 |
| 148 | 3300049744 | Ga0501083_0231609 | Ga0501083_0231609_139_768 | 209 |
| 149 | 3300049824 | Ga0501045_0040403 | Ga0501045_0040403_1313_1942 | 209 |
| 150 | 3300049824 | Ga0501045_0058581 | Ga0501045_0058581_1326_1955 | 209 |
| 151 | 3300050491 | nmdc:mga00v17_106452_c1 | nmdc:mga00v17_106452_c1_677_1309 | 209 |
| 152 | 3300050491 | nmdc:mga00v17_66116_c1 | nmdc:mga00v17_66116_c1_975_1613 | 209 |
| 153 | 3300050492 | nmdc:mga0yw44_216078_c1 | nmdc:mga0yw44_216078_c1_500_1141 | 209 |
| 154 | 3300050511 | nmdc:mga08y16_544672_c1 | nmdc:mga08y16_544672_c1_454_1101 | 209 |
| 155 | 3300050512 | nmdc:mga0n895_482937_c1 | nmdc:mga0n895_482937_c1_322_969 | 209 |
| 156 | 3300053077 | Ga0495601_0002866 | Ga0495601_0002866_1308_1952 | 209 |
| 157 | 3300053085 | Ga0495619_0069790 | Ga0495619_0069790_455_1093 | 209 |
| 158 | 3300053102 | Ga0500554_007168 | Ga0500554_007168_34_669 | 209 |
| 159 | 3300054114 | Ga0501084_0057387 | Ga0501084_0057387_908_1537 | 209 |
| 160 | 3300060353 | Ga0501082_0032106 | Ga0501082_0032106_1624_2253 | 209 |
| 161 | 3300060353 | Ga0501082_0166071 | Ga0501082_0166071_404_1033 | 209 |
| 162 | 3300061734 | Ga0530510_0202911 | Ga0530510_0202911_662_1291 | 209 |
| 163 | 3300061734 | Ga0530510_0263187 | Ga0530510_0263187_584_1213 | 209 |
| 164 | 3300001977 | JGI24746J21847_1000325 | JGI24746J21847_10003255 | 210 |
| 165 | 3300002459 | JGI24751J29686_10010572 | JGI24751J29686_100105722 | 210 |
| 166 | 3300005329 | Ga0070683_100007429 | Ga0070683_10000742910 | 210 |
| 167 | 3300005333 | Ga0070677_10000057 | Ga0070677_1000005719 | 210 |
| 168 | 3300005334 | Ga0068869_100271279 | Ga0068869_1002712792 | 210 |
| 169 | 3300005335 | Ga0070666_10235173 | Ga0070666_102351732 | 210 |
| 170 | 3300005336 | Ga0070680_100059546 | Ga0070680_1000595462 | 210 |
| 171 | 3300005337 | Ga0070682_100000013 | Ga0070682_100000013199 | 210 |
| 172 | 3300005338 | Ga0068868_100000151 | Ga0068868_10000015118 | 210 |
| 173 | 3300005338 | Ga0068868_100289706 | Ga0068868_1002897062 | 210 |
| 174 | 3300005339 | Ga0070660_100001214 | Ga0070660_10000121416 | 210 |
| 175 | 3300005344 | Ga0070661_100098151 | Ga0070661_1000981511 | 210 |
| 176 | 3300005347 | Ga0070668_100205753 | Ga0070668_1002057532 | 210 |
| 177 | 3300005354 | Ga0070675_100011302 | Ga0070675_1000113025 | 210 |
| 178 | 3300005356 | Ga0070674_100000082 | Ga0070674_10000008214 | 210 |
| 179 | 3300005364 | Ga0070673_100017272 | Ga0070673_1000172724 | 210 |
| 180 | 3300005365 | Ga0070688_100171538 | Ga0070688_1001715382 | 210 |
| 181 | 3300005366 | Ga0070659_100188737 | Ga0070659_1001887371 | 210 |
| 182 | 3300005367 | Ga0070667_100323287 | Ga0070667_1003232872 | 210 |
| 183 | 3300005435 | Ga0070714_100067896 | Ga0070714_1000678962 | 210 |
| 184 | 3300005438 | Ga0070701_10057983 | Ga0070701_100579832 | 210 |
| 185 | 3300005439 | Ga0070711_100130638 | Ga0070711_1001306381 | 210 |
| 186 | 3300005440 | Ga0070705_100398070 | Ga0070705_1003980702 | 210 |
| 187 | 3300005441 | Ga0070700_100009313 | Ga0070700_1000093135 | 210 |
| 188 | 3300005441 | Ga0070700_100110610 | Ga0070700_1001106103 | 210 |
| 189 | 3300005455 | Ga0070663_100019356 | Ga0070663_1000193564 | 210 |
| 190 | 3300005455 | Ga0070663_100033112 | Ga0070663_1000331123 | 210 |
| 191 | 3300005456 | Ga0070678_100144185 | Ga0070678_1001441853 | 210 |
| 192 | 3300005457 | Ga0070662_100000016 | Ga0070662_10000001635 | 210 |
| 193 | 3300005457 | Ga0070662_100004751 | Ga0070662_1000047514 | 210 |
| 194 | 3300005458 | Ga0070681_10037206 | Ga0070681_100372064 | 210 |
| 195 | 3300005459 | Ga0068867_100005240 | Ga0068867_1000052409 | 210 |
| 196 | 3300005530 | Ga0070679_100001299 | Ga0070679_10000129914 | 210 |
| 197 | 3300005535 | Ga0070684_100007568 | Ga0070684_1000075683 | 210 |
| 198 | 3300005539 | Ga0068853_100009433 | Ga0068853_1000094336 | 210 |
| 199 | 3300005543 | Ga0070672_100055041 | Ga0070672_1000550413 | 210 |
| 200 | 3300005547 | Ga0070693_100044347 | Ga0070693_1000443472 | 210 |
| 201 | 3300005547 | Ga0070693_100059710 | Ga0070693_1000597102 | 210 |
| 202 | 3300005548 | Ga0070665_100000244 | Ga0070665_10000024479 | 210 |
| 203 | 3300005577 | Ga0068857_100093174 | Ga0068857_1000931743 | 210 |
| 204 | 3300005578 | Ga0068854_100014034 | Ga0068854_1000140343 | 210 |
| 205 | 3300005578 | Ga0068854_100111254 | Ga0068854_1001112542 | 210 |
| 206 | 3300005614 | Ga0068856_100002478 | Ga0068856_1000024785 | 210 |
| 207 | 3300005615 | Ga0070702_100021814 | Ga0070702_1000218144 | 210 |
| 208 | 3300005617 | Ga0068859_100694055 | Ga0068859_1006940552 | 210 |
| 209 | 3300005718 | Ga0068866_10000001 | Ga0068866_10000001198 | 210 |
| 210 | 3300005718 | Ga0068866_10000170 | Ga0068866_1000017016 | 210 |
| 211 | 3300005719 | Ga0068861_100156559 | Ga0068861_1001565593 | 210 |
| 212 | 3300005834 | Ga0068851_10004889 | Ga0068851_100048896 | 210 |
| 213 | 3300005840 | Ga0068870_10376318 | Ga0068870_103763182 | 210 |
| 214 | 3300005841 | Ga0068863_100044804 | Ga0068863_1000448044 | 210 |
| 215 | 3300005841 | Ga0068863_100233995 | Ga0068863_1002339952 | 210 |
| 216 | 3300005842 | Ga0068858_100000450 | Ga0068858_10000045037 | 210 |
| 217 | 3300005842 | Ga0068858_100520961 | Ga0068858_1005209612 | 210 |
| 218 | 3300005843 | Ga0068860_100003539 | Ga0068860_1000035392 | 210 |
| 219 | 3300005843 | Ga0068860_100236254 | Ga0068860_1002362541 | 210 |
| 220 | 3300005844 | Ga0068862_100001684 | Ga0068862_1000016846 | 210 |
| 221 | 3300005937 | Ga0081455_10029974 | Ga0081455_100299744 | 210 |
| 222 | 3300005937 | Ga0081455_10078207 | Ga0081455_100782073 | 210 |
| 223 | 3300005937 | Ga0081455_10103025 | Ga0081455_101030254 | 210 |
| 224 | 3300005937 | Ga0081455_10124105 | Ga0081455_101241053 | 210 |
| 225 | 3300005937 | Ga0081455_10181632 | Ga0081455_101816322 | 210 |
| 226 | 3300005981 | Ga0081538_10000030 | Ga0081538_1000003098 | 210 |
| 227 | 3300005981 | Ga0081538_10000426 | Ga0081538_100004267 | 210 |
| 228 | 3300005983 | Ga0081540_1001151 | Ga0081540_100115114 | 210 |
| 229 | 3300005983 | Ga0081540_1108183 | Ga0081540_11081832 | 210 |
| 230 | 3300005985 | Ga0081539_10005112 | Ga0081539_100051128 | 210 |
| 231 | 3300006038 | Ga0075365_10000463 | Ga0075365_1000046317 | 210 |
| 232 | 3300006048 | Ga0075363_100006477 | Ga0075363_1000064775 | 210 |
| 233 | 3300006048 | Ga0075363_100031179 | Ga0075363_1000311793 | 210 |
| 234 | 3300006048 | Ga0075363_100375852 | Ga0075363_1003758521 | 210 |
| 235 | 3300006163 | Ga0070715_10000001 | Ga0070715_10000001171 | 210 |
| 236 | 3300006178 | Ga0075367_10103137 | Ga0075367_101031373 | 210 |
| 237 | 3300006178 | Ga0075367_10128059 | Ga0075367_101280592 | 210 |
| 238 | 3300006178 | Ga0075367_10490911 | Ga0075367_104909111 | 210 |
| 239 | 3300006844 | Ga0075428_101149626 | Ga0075428_1011496262 | 210 |
| 240 | 3300006846 | Ga0075430_100063205 | Ga0075430_1000632054 | 210 |
| 241 | 3300006847 | Ga0075431_100098476 | Ga0075431_1000984763 | 210 |
| 242 | 3300006881 | Ga0068865_100004502 | Ga0068865_10000450210 | 210 |
| 243 | 3300006931 | Ga0097620_100693963 | Ga0097620_1006939632 | 210 |
| 244 | 3300009098 | Ga0105245_10000016 | Ga0105245_10000016177 | 210 |
| 245 | 3300009098 | Ga0105245_10000619 | Ga0105245_1000061916 | 210 |
| 246 | 3300009098 | Ga0105245_10008319 | Ga0105245_100083192 | 210 |
| 247 | 3300009147 | Ga0114129_10811518 | Ga0114129_108115182 | 210 |
| 248 | 3300009148 | Ga0105243_10026616 | Ga0105243_100266163 | 210 |
| 249 | 3300009176 | Ga0105242_10881484 | Ga0105242_108814842 | 210 |
| 250 | 3300009545 | Ga0105237_10340962 | Ga0105237_103409622 | 210 |
| 251 | 3300009551 | Ga0105238_10000201 | Ga0105238_1000020154 | 210 |
| 252 | 3300009553 | Ga0105249_10000068 | Ga0105249_1000006829 | 210 |
| 253 | 3300009553 | Ga0105249_10051297 | Ga0105249_100512972 | 210 |
| 254 | 3300013102 | Ga0157371_10007587 | Ga0157371_100075878 | 210 |
| 255 | 3300013102 | Ga0157371_10239545 | Ga0157371_102395451 | 210 |
| 256 | 3300013296 | Ga0157374_10004501 | Ga0157374_100045013 | 210 |
| 257 | 3300013296 | Ga0157374_10072421 | Ga0157374_100724213 | 210 |
| 258 | 3300013297 | Ga0157378_10073726 | Ga0157378_100737264 | 210 |
| 259 | 3300013306 | Ga0163162_10438342 | Ga0163162_104383422 | 210 |
| 260 | 3300013307 | Ga0157372_10174632 | Ga0157372_101746322 | 210 |
| 261 | 3300013308 | Ga0157375_10178127 | Ga0157375_101781273 | 210 |
| 262 | 3300013308 | Ga0157375_10217481 | Ga0157375_102174813 | 210 |
| 263 | 3300013308 | Ga0157375_10248214 | Ga0157375_102482142 | 210 |
| 264 | 3300014325 | Ga0163163_10156591 | Ga0163163_101565913 | 210 |
| 265 | 3300014326 | Ga0157380_10002780 | Ga0157380_100027802 | 210 |
| 266 | 3300014745 | Ga0157377_10050907 | Ga0157377_100509072 | 210 |
| 267 | 3300014968 | Ga0157379_10178958 | Ga0157379_101789583 | 210 |
| 268 | 3300017792 | Ga0163161_10000032 | Ga0163161_1000003286 | 210 |
| 269 | 3300025893 | Ga0207682_10000129 | Ga0207682_1000012917 | 210 |
| 270 | 3300025899 | Ga0207642_10000006 | Ga0207642_10000006201 | 210 |
| 271 | 3300025899 | Ga0207642_10000007 | Ga0207642_1000000735 | 210 |
| 272 | 3300025899 | Ga0207642_10000100 | Ga0207642_100001008 | 210 |
| 273 | 3300025900 | Ga0207710_10000158 | Ga0207710_1000015863 | 210 |
| 274 | 3300025901 | Ga0207688_10145866 | Ga0207688_101458661 | 210 |
| 275 | 3300025903 | Ga0207680_10289379 | Ga0207680_102893791 | 210 |
| 276 | 3300025905 | Ga0207685_10000011 | Ga0207685_10000011171 | 210 |
| 277 | 3300025912 | Ga0207707_10011734 | Ga0207707_100117344 | 210 |
| 278 | 3300025916 | Ga0207663_10047397 | Ga0207663_100473972 | 210 |
| 279 | 3300025919 | Ga0207657_10022110 | Ga0207657_100221105 | 210 |
| 280 | 3300025921 | Ga0207652_10002610 | Ga0207652_1000261014 | 210 |
| 281 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004633 | 210 |
| 282 | 3300025926 | Ga0207659_10013868 | Ga0207659_100138685 | 210 |
| 283 | 3300025927 | Ga0207687_10000018 | Ga0207687_1000001847 | 210 |
| 284 | 3300025927 | Ga0207687_10000269 | Ga0207687_1000026916 | 210 |
| 285 | 3300025929 | Ga0207664_10176499 | Ga0207664_101764992 | 210 |
| 286 | 3300025932 | Ga0207690_10578458 | Ga0207690_105784581 | 210 |
| 287 | 3300025933 | Ga0207706_10000068 | Ga0207706_1000006835 | 210 |
| 288 | 3300025933 | Ga0207706_10009597 | Ga0207706_100095974 | 210 |
| 289 | 3300025934 | Ga0207686_10010918 | Ga0207686_100109183 | 210 |
| 290 | 3300025934 | Ga0207686_10016655 | Ga0207686_100166554 | 210 |
| 291 | 3300025934 | Ga0207686_10026894 | Ga0207686_100268942 | 210 |
| 292 | 3300025936 | Ga0207670_10713994 | Ga0207670_107139941 | 210 |
| 293 | 3300025937 | Ga0207669_10000004 | Ga0207669_1000000473 | 210 |
| 294 | 3300025937 | Ga0207669_10000012 | Ga0207669_1000001218 | 210 |
| 295 | 3300025940 | Ga0207691_10013831 | Ga0207691_100138313 | 210 |
| 296 | 3300025944 | Ga0207661_10005133 | Ga0207661_1000513310 | 210 |
| 297 | 3300025945 | Ga0207679_10009136 | Ga0207679_100091365 | 210 |
| 298 | 3300025960 | Ga0207651_10001019 | Ga0207651_1000101913 | 210 |
| 299 | 3300025961 | Ga0207712_10000007 | Ga0207712_10000007181 | 210 |
| 300 | 3300025961 | Ga0207712_10362303 | Ga0207712_103623032 | 210 |
| 301 | 3300025972 | Ga0207668_10383803 | Ga0207668_103838031 | 210 |
| 302 | 3300025972 | Ga0207668_10555815 | Ga0207668_105558151 | 210 |
| 303 | 3300025981 | Ga0207640_10035024 | Ga0207640_100350242 | 210 |
| 304 | 3300025981 | Ga0207640_10056964 | Ga0207640_100569642 | 210 |
| 305 | 3300026023 | Ga0207677_10000421 | Ga0207677_1000042113 | 210 |
| 306 | 3300026023 | Ga0207677_10059255 | Ga0207677_100592553 | 210 |
| 307 | 3300026035 | Ga0207703_10000040 | Ga0207703_1000004079 | 210 |
| 308 | 3300026035 | Ga0207703_10000322 | Ga0207703_1000032237 | 210 |
| 309 | 3300026035 | Ga0207703_10145475 | Ga0207703_101454753 | 210 |
| 310 | 3300026041 | Ga0207639_10061761 | Ga0207639_100617612 | 210 |
| 311 | 3300026041 | Ga0207639_10286427 | Ga0207639_102864272 | 210 |
| 312 | 3300026067 | Ga0207678_10033206 | Ga0207678_100332064 | 210 |
| 313 | 3300026067 | Ga0207678_10072290 | Ga0207678_100722903 | 210 |
| 314 | 3300026075 | Ga0207708_10037663 | Ga0207708_100376633 | 210 |
| 315 | 3300026075 | Ga0207708_10440999 | Ga0207708_104409991 | 210 |
| 316 | 3300026078 | Ga0207702_10000016 | Ga0207702_10000016200 | 210 |
| 317 | 3300026088 | Ga0207641_10002276 | Ga0207641_100022764 | 210 |
| 318 | 3300026089 | Ga0207648_10009455 | Ga0207648_100094559 | 210 |
| 319 | 3300026116 | Ga0207674_10087360 | Ga0207674_100873603 | 210 |
| 320 | 3300026118 | Ga0207675_100299756 | Ga0207675_1002997562 | 210 |
| 321 | 3300026121 | Ga0207683_10078156 | Ga0207683_100781563 | 210 |
| 322 | 3300026121 | Ga0207683_10318787 | Ga0207683_103187871 | 210 |
| 323 | 3300028379 | Ga0268266_10000020 | Ga0268266_1000002077 | 210 |
| 324 | 3300028379 | Ga0268266_10652182 | Ga0268266_106521821 | 210 |
| 325 | 3300028381 | Ga0268264_10034313 | Ga0268264_100343131 | 210 |
| 326 | 3300028381 | Ga0268264_10096060 | Ga0268264_100960602 | 210 |
| 327 | 3300028556 | Ga0265337_1000002 | Ga0265337_100000240 | 210 |
| 328 | 3300028558 | Ga0265326_10000007 | Ga0265326_1000000799 | 210 |
| 329 | 3300028563 | Ga0265319_1000025 | Ga0265319_1000025112 | 210 |
| 330 | 3300028654 | Ga0265322_10000001 | Ga0265322_10000001206 | 210 |
| 331 | 3300028800 | Ga0265338_10000486 | Ga0265338_1000048641 | 210 |
| 332 | 3300028800 | Ga0265338_10214343 | Ga0265338_102143432 | 210 |
| 333 | 3300029957 | Ga0265324_10000309 | Ga0265324_1000030914 | 210 |
| 334 | 3300031238 | Ga0265332_10020233 | Ga0265332_100202332 | 210 |
| 335 | 3300031238 | Ga0265332_10052251 | Ga0265332_100522512 | 210 |
| 336 | 3300031239 | Ga0265328_10013764 | Ga0265328_100137642 | 210 |
| 337 | 3300031240 | Ga0265320_10000002 | Ga0265320_10000002205 | 210 |
| 338 | 3300031241 | Ga0265325_10026623 | Ga0265325_100266233 | 210 |
| 339 | 3300031242 | Ga0265329_10004480 | Ga0265329_100044804 | 210 |
| 340 | 3300031249 | Ga0265339_10022532 | Ga0265339_100225324 | 210 |
| 341 | 3300031250 | Ga0265331_10000774 | Ga0265331_1000077422 | 210 |
| 342 | 3300031250 | Ga0265331_10013995 | Ga0265331_100139953 | 210 |
| 343 | 3300031251 | Ga0265327_10000011 | Ga0265327_10000011205 | 210 |
| 344 | 3300031344 | Ga0265316_10009446 | Ga0265316_100094469 | 210 |
| 345 | 3300031711 | Ga0265314_10000058 | Ga0265314_10000058112 | 210 |
| 346 | 3300031712 | Ga0265342_10060091 | Ga0265342_100600912 | 210 |
| 347 | 3300031852 | Ga0307410_10371143 | Ga0307410_103711432 | 210 |
| 348 | 3300031995 | Ga0307409_100007635 | Ga0307409_1000076352 | 210 |
| 349 | 3300032002 | Ga0307416_100038101 | Ga0307416_1000381013 | 210 |
| 350 | 3300032126 | Ga0307415_100177867 | Ga0307415_1001778672 | 210 |
| 351 | 3300035117 | Ga0373953_0156993 | Ga0373953_0156993_104_736 | 210 |
| 352 | 3300036401 | Ga0373937_0018686 | Ga0373937_0018686_1922_2554 | 210 |
| 353 | 3300036712 | Ga0316584_0164990 | Ga0316584_0164990_421_1062 | 210 |
| 354 | 3300037418 | Ga0395900_0309994 | Ga0395900_0309994_232_873 | 210 |
| 355 | 3300037466 | Ga0395898_0531744 | Ga0395898_0531744_276_914 | 210 |
| 356 | 3300037466 | Ga0395898_0545831 | Ga0395898_0545831_311_949 | 210 |
| 357 | 3300038443 | Ga0395901_0315520 | Ga0395901_0315520_53_691 | 210 |
| 358 | 3300038443 | Ga0395901_0727788 | Ga0395901_0727788_96_737 | 210 |
| 359 | 3300041512 | Ga0451853_0709412 | Ga0451853_0709412_3087_3719 | 210 |
| 360 | 3300041512 | Ga0451853_1528538 | Ga0451853_1528538_191_832 | 210 |
| 361 | 3300042993 | Ga0439440_0076557 | Ga0439440_0076557_202_834 | 210 |
| 362 | 3300044694 | Ga0466963_0000023 | Ga0466963_0000023_24316_24954 | 210 |
| 363 | 3300046454 | Ga0495592_0000036 | Ga0495592_0000036_26644_27276 | 210 |
| 364 | 3300046455 | Ga0495603_0000097 | Ga0495603_0000097_28143_28790 | 210 |
| 365 | 3300046455 | Ga0495603_0002177 | Ga0495603_0002177_8984_9625 | 210 |
| 366 | 3300046459 | Ga0495629_0395852 | Ga0495629_0395852_76_729 | 210 |
| 367 | 3300046461 | Ga0495641_0000003 | Ga0495641_0000003_193360_193992 | 210 |
| 368 | 3300046463 | Ga0495653_0106010 | Ga0495653_0106010_215_847 | 210 |
| 369 | 3300046473 | Ga0495582_0000029 | Ga0495582_0000029_61375_62016 | 210 |
| 370 | 3300046475 | Ga0495639_0116175 | Ga0495639_0116175_41_673 | 210 |
| 371 | 3300046476 | Ga0495662_0000030 | Ga0495662_0000030_27940_28572 | 210 |
| 372 | 3300046477 | Ga0495664_0383413 | Ga0495664_0383413_175_825 | 210 |
| 373 | 3300046500 | Ga0495596_0198913 | Ga0495596_0198913_108_746 | 210 |
| 374 | 3300046511 | Ga0495608_0000204 | Ga0495608_0000204_22164_22796 | 210 |
| 375 | 3300046511 | Ga0495608_0069753 | Ga0495608_0069753_749_1381 | 210 |
| 376 | 3300046514 | Ga0495618_0000004 | Ga0495618_0000004_123828_124472 | 210 |
| 377 | 3300046515 | Ga0495620_0001199 | Ga0495620_0001199_14825_15457 | 210 |
| 378 | 3300046515 | Ga0495620_0028316 | Ga0495620_0028316_1790_2431 | 210 |
| 379 | 3300046516 | Ga0495628_0000924 | Ga0495628_0000924_4718_5374 | 210 |
| 380 | 3300046516 | Ga0495628_0003694 | Ga0495628_0003694_1260_1892 | 210 |
| 381 | 3300046516 | Ga0495628_0045269 | Ga0495628_0045269_62_694 | 210 |
| 382 | 3300046516 | Ga0495628_0162908 | Ga0495628_0162908_386_1039 | 210 |
| 383 | 3300046516 | Ga0495628_0650956 | Ga0495628_0650956_39_692 | 210 |
| 384 | 3300046517 | Ga0495630_0008823 | Ga0495630_0008823_5471_6103 | 210 |
| 385 | 3300046517 | Ga0495630_0086434 | Ga0495630_0086434_756_1388 | 210 |
| 386 | 3300046517 | Ga0495630_0107309 | Ga0495630_0107309_1341_1976 | 210 |
| 387 | 3300046523 | Ga0495644_0000535 | Ga0495644_0000535_10269_10910 | 210 |
| 388 | 3300046529 | Ga0495652_0049862 | Ga0495652_0049862_590_1246 | 210 |
| 389 | 3300046529 | Ga0495652_0207823 | Ga0495652_0207823_224_856 | 210 |
| 390 | 3300046535 | Ga0495586_0002147 | Ga0495586_0002147_1578_2210 | 210 |
| 391 | 3300046537 | Ga0495598_0017950 | Ga0495598_0017950_1030_1671 | 210 |
| 392 | 3300046538 | Ga0495609_0078949 | Ga0495609_0078949_387_1025 | 210 |
| 393 | 3300046543 | Ga0495645_0062020 | Ga0495645_0062020_1764_2414 | 210 |
| 394 | 3300046543 | Ga0495645_0069625 | Ga0495645_0069625_1785_2417 | 210 |
| 395 | 3300046543 | Ga0495645_0198402 | Ga0495645_0198402_520_1152 | 210 |
| 396 | 3300046559 | Ga0495667_0000032 | Ga0495667_0000032_107350_107982 | 210 |
| 397 | 3300046642 | Ga0495634_0001201 | Ga0495634_0001201_11893_12546 | 210 |
| 398 | 3300046642 | Ga0495634_0283298 | Ga0495634_0283298_46_678 | 210 |
| 399 | 3300046660 | Ga0495625_0000122 | Ga0495625_0000122_38103_38744 | 210 |
| 400 | 3300046660 | Ga0495625_0321982 | Ga0495625_0321982_146_787 | 210 |
| 401 | 3300046663 | Ga0495635_0000016 | Ga0495635_0000016_26608_27240 | 210 |
| 402 | 3300046664 | Ga0495659_0109162 | Ga0495659_0109162_160_798 | 210 |
| 403 | 3300046678 | Ga0495599_0003118 | Ga0495599_0003118_4878_5510 | 210 |
| 404 | 3300046681 | Ga0495647_0000025 | Ga0495647_0000025_16872_17504 | 210 |
| 405 | 3300046681 | Ga0495647_0002619 | Ga0495647_0002619_3687_4319 | 210 |
| 406 | 3300046681 | Ga0495647_0070407 | Ga0495647_0070407_111_752 | 210 |
| 407 | 3300046683 | Ga0495658_0000026 | Ga0495658_0000026_15927_16568 | 210 |
| 408 | 3300046684 | Ga0495669_0000260 | Ga0495669_0000260_27334_27966 | 210 |
| 409 | 3300046689 | Ga0495613_0000152 | Ga0495613_0000152_33814_34446 | 210 |
| 410 | 3300046690 | Ga0495624_0000009 | Ga0495624_0000009_106877_107509 | 210 |
| 411 | 3300046690 | Ga0495624_0007124 | Ga0495624_0007124_2386_3018 | 210 |
| 412 | 3300046691 | Ga0495670_0002839 | Ga0495670_0002839_1484_2128 | 210 |
| 413 | 3300046694 | Ga0495649_0004521 | Ga0495649_0004521_3158_3790 | 210 |
| 414 | 3300046809 | Ga0495600_0001553 | Ga0495600_0001553_522_1166 | 210 |
| 415 | 3300046809 | Ga0495600_0410043 | Ga0495600_0410043_15_650 | 210 |
| 416 | 3300047317 | Ga0495604_0000019 | Ga0495604_0000019_33427_34059 | 210 |
| 417 | 3300047321 | Ga0495676_0000676 | Ga0495676_0000676_14623_15255 | 210 |
| 418 | 3300047321 | Ga0495676_0178244 | Ga0495676_0178244_182_814 | 210 |
| 419 | 3300047322 | Ga0495680_0000061 | Ga0495680_0000061_64434_65066 | 210 |
| 420 | 3300047322 | Ga0495680_0001562 | Ga0495680_0001562_9006_9638 | 210 |
| 421 | 3300047322 | Ga0495680_0004057 | Ga0495680_0004057_11443_12075 | 210 |
| 422 | 3300047446 | Ga0495679_003496 | Ga0495679_003496_6329_6961 | 210 |
| 423 | 3300047447 | Ga0495685_006643 | Ga0495685_006643_2875_3507 | 210 |
| 424 | 3300047673 | Ga0495593_0088610 | Ga0495593_0088610_923_1579 | 210 |
| 425 | 3300048088 | Ga0495602_0005647 | Ga0495602_0005647_3208_3864 | 210 |
| 426 | 3300048088 | Ga0495602_0057688 | Ga0495602_0057688_2752_3384 | 210 |
| 427 | 3300048088 | Ga0495602_0090567 | Ga0495602_0090567_1338_1988 | 210 |
| 428 | 3300048089 | Ga0495614_0044362 | Ga0495614_0044362_553_1212 | 210 |
| 429 | 3300048903 | Ga0496100_0000002 | Ga0496100_0000002_174891_175523 | 210 |
| 430 | 3300048904 | Ga0496101_0000001 | Ga0496101_0000001_174891_175523 | 210 |
| 431 | 3300048907 | Ga0496104_0000009 | Ga0496104_0000009_2909_3541 | 210 |
| 432 | 3300048908 | Ga0496105_0000027 | Ga0496105_0000027_144984_145616 | 210 |
| 433 | 3300048908 | Ga0496105_0027203 | Ga0496105_0027203_1789_2445 | 210 |
| 434 | 3300048909 | Ga0496106_0000149 | Ga0496106_0000149_21840_22472 | 210 |
| 435 | 3300048909 | Ga0496106_0022376 | Ga0496106_0022376_2819_3451 | 210 |
| 436 | 3300048910 | Ga0496107_0000013 | Ga0496107_0000013_2613_3245 | 210 |
| 437 | 3300048910 | Ga0496107_0035131 | Ga0496107_0035131_2674_3324 | 210 |
| 438 | 3300048910 | Ga0496107_0083020 | Ga0496107_0083020_256_888 | 210 |
| 439 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_459217_459849 | 210 |
| 440 | 3300048911 | Ga0496108_0000132 | Ga0496108_0000132_55881_56522 | 210 |
| 441 | 3300048911 | Ga0496108_0022532 | Ga0496108_0022532_232_882 | 210 |
| 442 | 3300048912 | Ga0496109_0000003 | Ga0496109_0000003_133763_134395 | 210 |
| 443 | 3300048912 | Ga0496109_0000007 | Ga0496109_0000007_162715_163356 | 210 |
| 444 | 3300048912 | Ga0496109_0000190 | Ga0496109_0000190_46311_46976 | 210 |
| 445 | 3300048912 | Ga0496109_0119987 | Ga0496109_0119987_94_744 | 210 |
| 446 | 3300048912 | Ga0496109_0207818 | Ga0496109_0207818_830_1468 | 210 |
| 447 | 3300048913 | Ga0496110_0005142 | Ga0496110_0005142_3758_4390 | 210 |
| 448 | 3300048913 | Ga0496110_0016972 | Ga0496110_0016972_4677_5315 | 210 |
| 449 | 3300048914 | Ga0496111_0057275 | Ga0496111_0057275_2089_2727 | 210 |
| 450 | 3300048914 | Ga0496111_0192691 | Ga0496111_0192691_58_708 | 210 |
| 451 | 3300048915 | Ga0496112_0000003 | Ga0496112_0000003_160062_160694 | 210 |
| 452 | 3300048916 | Ga0496113_0043031 | Ga0496113_0043031_2080_2712 | 210 |
| 453 | 3300048917 | Ga0496114_0004542 | Ga0496114_0004542_9230_9862 | 210 |
| 454 | 3300048918 | Ga0496115_0050377 | Ga0496115_0050377_487_1131 | 210 |
| 455 | 3300048924 | Ga0496121_0023935 | Ga0496121_0023935_1852_2505 | 210 |
| 456 | 3300048928 | Ga0496125_0184538 | Ga0496125_0184538_495_1127 | 210 |
| 457 | 3300048929 | Ga0496126_0014575 | Ga0496126_0014575_7161_7811 | 210 |
| 458 | 3300049568 | Ga0501031_0007261 | Ga0501031_0007261_2949_3608 | 210 |
| 459 | 3300049569 | Ga0501032_0009507 | Ga0501032_0009507_2927_3586 | 210 |
| 460 | 3300049569 | Ga0501032_0178933 | Ga0501032_0178933_261_914 | 210 |
| 461 | 3300049570 | Ga0501033_0010398 | Ga0501033_0010398_3484_4143 | 210 |
| 462 | 3300049571 | Ga0501034_0027550 | Ga0501034_0027550_3487_4146 | 210 |
| 463 | 3300049572 | Ga0501036_0011808 | Ga0501036_0011808_3111_3770 | 210 |
| 464 | 3300049573 | Ga0501037_0009203 | Ga0501037_0009203_3178_3837 | 210 |
| 465 | 3300049574 | Ga0501038_0015053 | Ga0501038_0015053_2918_3577 | 210 |
| 466 | 3300049575 | Ga0501039_0084478 | Ga0501039_0084478_602_1261 | 210 |
| 467 | 3300049578 | Ga0501042_0020700 | Ga0501042_0020700_334_975 | 210 |
| 468 | 3300049578 | Ga0501042_0078342 | Ga0501042_0078342_462_1151 | 210 |
| 469 | 3300049578 | Ga0501042_0125209 | Ga0501042_0125209_974_1633 | 210 |
| 470 | 3300049579 | Ga0501043_0010932 | Ga0501043_0010932_2993_3652 | 210 |
| 471 | 3300049579 | Ga0501043_0469640 | Ga0501043_0469640_272_925 | 210 |
| 472 | 3300049580 | Ga0501046_0004506 | Ga0501046_0004506_8909_9568 | 210 |
| 473 | 3300049581 | Ga0501047_0015685 | Ga0501047_0015685_3074_3733 | 210 |
| 474 | 3300049581 | Ga0501047_0031873 | Ga0501047_0031873_1994_2653 | 210 |
| 475 | 3300049582 | Ga0501048_0010026 | Ga0501048_0010026_3462_4121 | 210 |
| 476 | 3300049584 | Ga0501068_0019590 | Ga0501068_0019590_1282_1941 | 210 |
| 477 | 3300049584 | Ga0501068_0070538 | Ga0501068_0070538_635_1288 | 210 |
| 478 | 3300049585 | Ga0501069_0013651 | Ga0501069_0013651_1440_2093 | 210 |
| 479 | 3300049585 | Ga0501069_0025019 | Ga0501069_0025019_2366_3025 | 210 |
| 480 | 3300049586 | Ga0501070_0012402 | Ga0501070_0012402_3476_4135 | 210 |
| 481 | 3300049588 | Ga0501072_0118636 | Ga0501072_0118636_785_1444 | 210 |
| 482 | 3300049589 | Ga0501073_0009895 | Ga0501073_0009895_3437_4096 | 210 |
| 483 | 3300049590 | Ga0501074_0024645 | Ga0501074_0024645_1396_2055 | 210 |
| 484 | 3300049591 | Ga0501075_0006937 | Ga0501075_0006937_5365_6006 | 210 |
| 485 | 3300049591 | Ga0501075_0253922 | Ga0501075_0253922_144_800 | 210 |
| 486 | 3300049592 | Ga0501076_0133602 | Ga0501076_0133602_722_1378 | 210 |
| 487 | 3300049593 | Ga0501077_0240534 | Ga0501077_0240534_432_1070 | 210 |
| 488 | 3300049741 | Ga0501079_0066546 | Ga0501079_0066546_1107_1766 | 210 |
| 489 | 3300049742 | Ga0501080_0007467 | Ga0501080_0007467_733_1386 | 210 |
| 490 | 3300049744 | Ga0501083_0008785 | Ga0501083_0008785_3462_4121 | 210 |
| 491 | 3300049744 | Ga0501083_0037390 | Ga0501083_0037390_370_1023 | 210 |
| 492 | 3300049822 | Ga0501035_0004594 | Ga0501035_0004594_8943_9602 | 210 |
| 493 | 3300049822 | Ga0501035_0498108 | Ga0501035_0498108_39_698 | 210 |
| 494 | 3300049823 | Ga0501044_0019725 | Ga0501044_0019725_3067_3726 | 210 |
| 495 | 3300049824 | Ga0501045_0216033 | Ga0501045_0216033_388_1044 | 210 |
| 496 | 3300050492 | nmdc:mga0yw44_66601_c1 | nmdc:mga0yw44_66601_c1_1132_1791 | 210 |
| 497 | 3300050494 | nmdc:mga06z11_130577_c1 | nmdc:mga06z11_130577_c1_671_1330 | 210 |
| 498 | 3300050494 | nmdc:mga06z11_237693_c1 | nmdc:mga06z11_237693_c1_187_837 | 210 |
| 499 | 3300050494 | nmdc:mga06z11_396779_c1 | nmdc:mga06z11_396779_c1_106_765 | 210 |
| 500 | 3300050509 | nmdc:mga0qj67_101965_c1 | nmdc:mga0qj67_101965_c1_999_1640 | 210 |
| 501 | 3300050510 | nmdc:mga06r32_122677_c1 | nmdc:mga06r32_122677_c1_86_727 | 210 |
| 502 | 3300053077 | Ga0495601_0000258 | Ga0495601_0000258_13517_14149 | 210 |
| 503 | 3300053077 | Ga0495601_0003264 | Ga0495601_0003264_583_1239 | 210 |
| 504 | 3300053078 | Ga0495612_0003045 | Ga0495612_0003045_2387_3028 | 210 |
| 505 | 3300053078 | Ga0495612_0008696 | Ga0495612_0008696_1465_2115 | 210 |
| 506 | 3300053084 | Ga0495595_0000338 | Ga0495595_0000338_15723_16355 | 210 |
| 507 | 3300053085 | Ga0495619_0000243 | Ga0495619_0000243_4678_5328 | 210 |
| 508 | 3300053123 | Ga0500614_001316 | Ga0500614_001316_5259_5891 | 210 |
| 509 | 3300053139 | Ga0500568_0154603 | Ga0500568_0154603_46_699 | 210 |
| 510 | 3300054114 | Ga0501084_0373051 | Ga0501084_0373051_48_704 | 210 |
| 511 | 3300060353 | Ga0501082_0024401 | Ga0501082_0024401_1646_2305 | 210 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3aje-assembly1.cif.gz_A | crystal structure of s. tokodaii sua5 complexed with l-threonine and amppnp | 0.869 | 2 | 208 |
| 6f89-assembly1.cif.gz_A | structure of h234a/y235a p.abyssi sua5 | 0.8586 | 1 | 205 |
| 2eqa-assembly1.cif.gz_A | crystal structure of the hypothetical sua5 protein from sulfolobus tokodaii | 0.8563 | 2 | 209 |
| 6f87-assembly3.cif.gz_C | crystal structure of p. abyssi sua5 complexed with l-threonine and ppi | 0.8549 | 2 | 207 |
| 6f89-assembly2.cif.gz_B | structure of h234a/y235a p.abyssi sua5 | 0.8547 | 1 | 206 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4IB24_661_876_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.8771 | 4 | 209 | 3.90.870.10 |
| af_Q60369_7_206_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.8728 | 13 | 204 | 3.90.870.10 |
| af_P9WGC9_2_211_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.8657 | 2 | 208 | 3.90.870.10 |
| af_A0A1D8PQL4_32_243_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.8601 | 7 | 209 | 3.90.870.10 |
| af_F1QWR2_601_815_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.8596 | 5 | 209 | 3.90.870.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537ZZP7-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.994 | 1 | 207 |
GO:0000049
GO:0003725 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |
| AF-A0A537ZZP7-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.9752 | 1 | 207 |
GO:0000049
GO:0003725 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |
| AF-A0A2W6BC31-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.9637 | 16 | 207 |
GO:0000049
GO:0003725 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |
| AF-A0A1H6FHM2-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.9466 | 1 | 207 |
GO:0000049
GO:0003725 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |
| AF-A0A1H6FHM2-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.929 | 1 | 207 |
GO:0000049
GO:0003725 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar