F457330

General Info

Members Datasets Scaffolds Average Seq Length
511 312 1022 484

Family's Representative Sequence

Representative Sequence 3300047443|Ga0495687_008331|Ga0495687_008331_4121_5815
Length 564
Sequence MTGFWEIEVASPRLRATFLKSSDMRFVDNLSYVKSTIRRRAHLTTSDPPGTAVHRFEPSRMIVSPFRRRTLSHPMFDLQTSHATLRIFDAVRALAFIGDLSMGQPTDHSLRTGWLAVRLAQAAGLEASACDAVREVSLLRWSGCTANAAGFATVFGDDIAVRTAMLESRPGIAETIGGVGAAMMPLAQTHCEVSGEVARIMGLSSGTETALRHIFETWDGSGLPAQLARDAVPISVLVVALAGDLEVFSRTYGVEAALALIEQRAGTRYPESLVAVATRHAGSWLTELERQALDDFDVVLATADMQRTTSAELIADIIDLKLPWMTGFSRAVAVTAAECYARFTSNDAAGALVYRAGLIHGIGRAAVPNEVWNLPTRLSPSAWEKVRLVPYWTERAGKQTGSLGEATVLASHAYERQDGSGYFRGVRDPALTLEARVLAASVAWVALRSTRPWRAALTDEAAAHVLQXXXANGRLCREVVDALVAERVPVARRAARSVLHGPRLSAREIDVLRAISRGASNKQAAQELTMSPSTVRTHVESVFRKLECSTRAAATLKASTMGLI

Samples

Sample ID Description Type Environment
1 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
45 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
55 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
56 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
90 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
91 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
92 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
93 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
94 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
95 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
96 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
97 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
98 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
99 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
100 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
101 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
102 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
103 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
104 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
105 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
106 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
107 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
108 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
109 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
132 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
152 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
181 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
182 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
188 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
210 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
213 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
214 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
215 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
216 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
217 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
218 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
219 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
220 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
221 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
222 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
223 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
224 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
225 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
226 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
227 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
228 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
229 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
230 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
231 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
232 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
233 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
234 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
235 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
236 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
237 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
238 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
239 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
240 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
241 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
242 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
243 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
244 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
245 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
246 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
247 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
248 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
249 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
250 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
251 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
252 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
253 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
254 2643221556 Massilia sp. Root1485 Isolate Unclassified
255 2643221684 Massilia sp. Root133 Isolate Unclassified
256 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
257 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
258 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
259 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
260 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
261 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
262 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
263 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
264 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
265 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
266 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
267 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
268 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
269 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
270 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
271 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
272 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
273 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
274 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
275 2818991452 Burkholderia cepacia 561 Isolate Unclassified
276 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
277 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
278 2831864461 Roseateles noduli HZ7 Isolate Nodule
279 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
280 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
281 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
282 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
283 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
284 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
285 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
286 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
287 2904564687 Burkholderia sp. 571 Isolate Unclassified
288 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
289 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
290 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
291 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
292 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
293 2928058823 Ralstonia sp. 1138 Isolate Unclassified
294 2928163908 Burkholderia sp. 567 Isolate Unclassified
295 2928170801 Burkholderia sp. 572 Isolate Unclassified
296 2928536128 Burkholderia sola 565 Isolate Unclassified
297 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
298 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
299 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
300 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
301 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
302 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
303 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
304 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
305 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
306 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
307 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
308 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
309 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
310 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
311 8052494512 Pseudomonas putida LD6 Isolate Unclassified
312 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.02
Metatranscriptomes 0
Isolates 18.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.02
Nodule 1.37
Rhizoplane 9.2
Rhizosphere 64.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495687_008331 3300047443 Bacteria 5950
2 SwRhRL2b_contig_3363960 2162886007 Bacteria 3915
3 JGI24740J21852_10001733 3300001979 Bacteria 10019
4 JGI24739J22299_10003743 3300001989 Bacteria 5807
5 JGI24735J21928_10001856 3300002067 Bacteria 7416
6 JGI24738J21930_10006078 3300002075 Bacteria 2856
7 JGI25156J39149_1000226 3300002705 Bacteria 38895
8 JGI25154J39366_1001582 3300002738 Bacteria 7782
9 JGI25157J39369_1001238 3300002741 Bacteria 10562
10 JGI25165J46597_1001109 3300003214 Bacteria 17051
11 rootH1_10125262 3300003316 Bacteria 2669
12 rootH2_10019355 3300003320 Bacteria 3717
13 rootL2_10012728 3300003322 Bacteria 11042
14 rootL2_10028803 3300003322 Bacteria 8449
15 rootL2_10028804 3300003322 Bacteria 8173
16 rootH1_10250090 3300003323 Bacteria 3757
17 JGI25160J50197_1000029 3300003354 Bacteria 179129
18 Ga0055533_1000070 3300003756 Bacteria 153414
19 Ga0055532_1000011 3300003758 Bacteria 385294
20 Ga0055527_1000009 3300003760 Bacteria 385294
21 Ga0055535_1000008 3300003761 Bacteria 385294
22 Ga0055542_1000014 3300003762 Bacteria 385294
23 Ga0055529_1000010 3300003763 Bacteria 385294
24 Ga0055526_1003951 3300003771 Bacteria 9152
25 Ga0055543_1005593 3300004625 Bacteria 3183
26 Ga0065165_1000040 3300005262 Bacteria 205767
27 Ga0065165_1000323 3300005262 Bacteria 78079
28 Ga0065704_10074367 3300005289 Bacteria 6333
29 Ga0070660_100135801 3300005339 Bacteria 1970
30 Ga0070661_100025867 3300005344 Bacteria 4218
31 Ga0070663_100016391 3300005455 Bacteria 4811
32 Ga0070685_10004194 3300005466 Bacteria 7274
33 Ga0068855_100147477 3300005563 Bacteria 2677
34 Ga0070664_100077982 3300005564 Bacteria 2849
35 Ga0068857_100014899 3300005577 Bacteria 6781
36 Ga0081540_1001041 3300005983 Bacteria 24781
37 Ga0105251_10005218 3300009011 Bacteria 8563
38 Ga0105250_10013668 3300009092 Bacteria 3344
39 Ga0105240_10000197 3300009093 Bacteria 123221
40 Ga0105240_10000199 3300009093 Bacteria 122191
41 Ga0105240_10002431 3300009093 Bacteria 29942
42 Ga0105240_10106596 3300009093 Bacteria 3398
43 Ga0105243_10028941 3300009148 Bacteria 4257
44 Ga0105248_10047248 3300009177 Bacteria 4827
45 Ga0105248_10053236 3300009177 Bacteria 4542
46 Ga0105237_10020007 3300009545 Bacteria 6910
47 Ga0105239_10000110 3300010375 Bacteria 115508
48 Ga0157369_10180933 3300013105 Bacteria 2218
49 Ga0163162_10000812 3300013306 Bacteria 28975
50 Ga0163162_10037086 3300013306 Bacteria 4862
51 Ga0182008_10002724 3300014497 Bacteria 10968
52 Ga0182006_1000325 3300015261 Bacteria 41285
53 Ga0182006_1002591 3300015261 Bacteria 9778
54 Ga0182006_1006066 3300015261 Bacteria 5654
55 Ga0183361_10027 3300016635 Bacteria 59884
56 Ga0213872_10000527 3300021361 Bacteria 29927
57 Ga0209566_100790 3300025225 Bacteria 16697
58 Ga0209674_100011 3300025226 Bacteria 997175
59 Ga0209674_101037 3300025226 Bacteria 8444
60 Ga0209674_101929 3300025226 Bacteria 4868
61 Ga0209672_100002 3300025228 Bacteria 1733325
62 Ga0209147_100003 3300025229 Bacteria 1733325
63 Ga0209147_100037 3300025229 Bacteria 326977
64 Ga0209147_100039 3300025229 Bacteria 311101
65 Ga0209563_100011 3300025230 Bacteria 1187808
66 Ga0207427_100540 3300025231 Bacteria 19616
67 Ga0209258_100005 3300025242 Bacteria 1087938
68 Ga0209258_100062 3300025242 Bacteria 311101
69 Ga0209646_1000256 3300025246 Bacteria 52374
70 Ga0209026_1000069 3300025250 Bacteria 207574
71 Ga0209677_101913 3300025253 Bacteria 8386
72 Ga0209677_108336 3300025253 Bacteria 2026
73 Ga0209148_1000006 3300025254 Bacteria 1733325
74 Ga0209148_1000075 3300025254 Bacteria 311101
75 Ga0209148_1003713 3300025254 Bacteria 4040
76 Ga0209759_1000006 3300025256 Bacteria 492407
77 Ga0209759_1000543 3300025256 Bacteria 39344
78 Ga0209233_1000018 3300025261 Bacteria 886857
79 Ga0209455_1000003 3300025272 Bacteria 1471893
80 Ga0209455_1000067 3300025272 Bacteria 311101
81 Ga0209673_1000044 3300025273 Bacteria 290647
82 Ga0209564_1000097 3300025295 Bacteria 231436
83 Ga0209564_1006345 3300025295 Bacteria 6414
84 Ga0207426_1000004 3300025302 Bacteria 1047900
85 Ga0207713_1007866 3300025735 Bacteria 6215
86 Ga0207705_10006970 3300025909 Bacteria 8346
87 Ga0207695_10000040 3300025913 Bacteria 452787
88 Ga0207695_10000207 3300025913 Bacteria 160390
89 Ga0207695_10002579 3300025913 Bacteria 26579
90 Ga0207671_10013310 3300025914 Bacteria 6559
91 Ga0207657_10138802 3300025919 Bacteria 1987
92 Ga0207709_10038511 3300025935 Bacteria 2848
93 Ga0207709_10085380 3300025935 Bacteria 2046
94 Ga0207711_10025394 3300025941 Bacteria 4972
95 Ga0207679_10055280 3300025945 Bacteria 2925
96 Ga0207667_10010081 3300025949 Bacteria 11076
97 Ga0207674_10013039 3300026116 Bacteria 9257
98 Ga0207698_10015410 3300026142 Bacteria 5117
99 Ga0209371_1001121 3300027312 Bacteria 19748
100 Ga0265338_10000871 3300028800 Bacteria 51091
101 Ga0268256_1000952 3300030500 Bacteria 19756
102 Ga0307408_100000002 3300031548 Bacteria 827227
103 Ga0307408_100006901 3300031548 Bacteria 7521
104 Ga0307408_100038403 3300031548 Bacteria 3378
105 Ga0307407_10031912 3300031903 Bacteria 2858
106 Ga0307412_10000003 3300031911 Bacteria 659081
107 Ga0307412_10065238 3300031911 Bacteria 2463
108 Ga0307409_100109260 3300031995 Bacteria 2315
109 Ga0307414_10057606 3300032004 Bacteria 2732
110 Ga0373931_0001517 3300035691 Bacteria 9994
111 Ga0395899_0027078 3300037312 Bacteria 4324
112 Ga0395899_0029100 3300037312 Bacteria 4154
113 Ga0395899_0097165 3300037312 Bacteria 2129
114 Ga0395899_0133960 3300037312 Bacteria 1767
115 Ga0395900_0011287 3300037418 Bacteria 9138
116 Ga0395900_0149632 3300037418 Bacteria 2385
117 Ga0395900_0156861 3300037418 Bacteria 2324
118 Ga0395898_0011777 3300037466 Bacteria 9065
119 Ga0395898_0205436 3300037466 Bacteria 1879
120 Ga0395898_0283486 3300037466 Bacteria 1580
121 Ga0395905_0000035 3300037471 Bacteria 272014
122 Ga0395905_0122946 3300037471 Bacteria 2440
123 Ga0395901_0000187 3300038443 Bacteria 79696
124 Ga0395901_0001076 3300038443 Bacteria 29192
125 Ga0395901_0028139 3300038443 Bacteria 5781
126 Ga0395901_0297531 3300038443 Bacteria 1673
127 Ga0395901_0335481 3300038443 Bacteria 1562
128 Ga0436361_0054243 3300039447 Bacteria 2576
129 Ga0436361_0393634 3300039447 Bacteria 4074
130 Ga0436361_0444627 3300039447 Bacteria 4584
131 Ga0436361_0844409 3300039447 Bacteria 52533
132 Ga0436361_1152328 3300039447 Bacteria 4257
133 Ga0439438_000113 3300041405 Bacteria 37577
134 Ga0439438_000114 3300041405 Bacteria 36989
135 Ga0439447_001096 3300041407 Bacteria 9806
136 Ga0439447_005335 3300041407 Bacteria 4283
137 Ga0439447_007019 3300041407 Bacteria 3609
138 Ga0451793_1822033 3300041452 Bacteria 1435
139 Ga0439431_0000009 3300041997 Bacteria 33859
140 Ga0439448_0000838 3300042005 Bacteria 7483
141 Ga0439432_000081 3300042006 Bacteria 29803
142 Ga0439432_005236 3300042006 Bacteria 4679
143 Ga0439432_005381 3300042006 Bacteria 4613
144 Ga0439451_000103 3300042009 Bacteria 15215
145 Ga0439451_003151 3300042009 Bacteria 3349
146 Ga0439452_000107 3300042010 Bacteria 67397
147 Ga0439452_003374 3300042010 Bacteria 5607
148 Ga0450911_000010 3300042115 Bacteria 149605
149 Ga0450911_000426 3300042115 Bacteria 13913
150 Ga0450911_004292 3300042115 Bacteria 2356
151 Ga0450891_002113 3300042129 Bacteria 2020
152 Ga0450900_000380 3300042136 Bacteria 3362
153 Ga0450902_000513 3300042137 Bacteria 4840
154 Ga0450903_003747 3300042138 Bacteria 2621
155 Ga0450904_000094 3300042139 Bacteria 19949
156 Ga0450905_002265 3300042142 Bacteria 2466
157 Ga0450905_002507 3300042142 Bacteria 2362
158 Ga0450906_000007 3300042145 Bacteria 42541
159 Ga0450910_000224 3300042147 Bacteria 6431
160 Ga0439459_0005469 3300042438 Bacteria 2089
161 Ga0439464_0011033 3300042439 Bacteria 2389
162 Ga0450901_000139 3300042533 Bacteria 8049
163 Ga0466969_0028891 3300044656 Bacteria 2834
164 Ga0466969_0063215 3300044656 Bacteria 1794
165 Ga0466972_0022515 3300044658 Bacteria 3137
166 Ga0466966_0046940 3300044684 Bacteria 2755
167 Ga0466966_0048094 3300044684 Bacteria 2717
168 Ga0466966_0071496 3300044684 Bacteria 2174
169 Ga0466966_0092149 3300044684 Bacteria 1880
170 Ga0466966_0108069 3300044684 Bacteria 1716
171 Ga0466961_0005265 3300044693 Bacteria 8143
172 Ga0466961_0093766 3300044693 Bacteria 1894
173 Ga0466970_0008747 3300044765 Bacteria 5102
174 Ga0466957_0013153 3300044842 Bacteria 4797
175 Ga0466957_0037586 3300044842 Bacteria 2915
176 Ga0466957_0050873 3300044842 Bacteria 2522
177 Ga0466960_0010123 3300044901 Bacteria 3909
178 Ga0466959_0024157 3300045049 Bacteria 4500
179 Ga0466959_0043277 3300045049 Bacteria 3319
180 Ga0466958_0037838 3300045836 Bacteria 2892
181 Ga0495603_0002701 3300046455 Bacteria 10460
182 Ga0495590_0007134 3300046457 Bacteria 4324
183 Ga0495590_0021841 3300046457 Bacteria 2266
184 Ga0495629_0000054 3300046459 Bacteria 106374
185 Ga0495629_0005850 3300046459 Bacteria 9174
186 Ga0495629_0060488 3300046459 Bacteria 2647
187 Ga0495641_0016747 3300046461 Bacteria 3850
188 Ga0495651_0005248 3300046462 Bacteria 9875
189 Ga0495653_0000099 3300046463 Bacteria 71802
190 Ga0495653_0008463 3300046463 Bacteria 8436
191 Ga0495650_0014685 3300046471 Bacteria 4054
192 Ga0495650_0038497 3300046471 Bacteria 2071
193 Ga0495580_0000594 3300046472 Bacteria 30607
194 Ga0495580_0001487 3300046472 Bacteria 20578
195 Ga0495580_0008497 3300046472 Bacteria 8163
196 Ga0495580_0020356 3300046472 Bacteria 4910
197 Ga0495580_0038210 3300046472 Bacteria 3439
198 Ga0495582_0006663 3300046473 Bacteria 6416
199 Ga0495582_0007771 3300046473 Bacteria 5930
200 Ga0495582_0010701 3300046473 Bacteria 5046
201 Ga0495605_0000263 3300046474 Bacteria 60765
202 Ga0495605_0014009 3300046474 Bacteria 4399
203 Ga0495605_0058440 3300046474 Bacteria 1854
204 Ga0495605_0059560 3300046474 Bacteria 1833
205 Ga0495664_0000188 3300046477 Bacteria 30394
206 Ga0495584_0002446 3300046491 Bacteria 10530
207 Ga0495584_0011408 3300046491 Bacteria 4552
208 Ga0495596_0006306 3300046500 Bacteria 5477
209 Ga0495607_0000981 3300046501 Bacteria 26455
210 Ga0495607_0004709 3300046501 Bacteria 9983
211 Ga0495607_0008646 3300046501 Bacteria 6943
212 Ga0495583_0023960 3300046506 Bacteria 3076
213 Ga0495606_0002371 3300046507 Bacteria 22116
214 Ga0495606_0013679 3300046507 Bacteria 6394
215 Ga0495606_0046077 3300046507 Bacteria 2884
216 Ga0495608_0009064 3300046511 Bacteria 6959
217 Ga0495608_0011160 3300046511 Bacteria 6254
218 Ga0495610_0007683 3300046512 Bacteria 7120
219 Ga0495616_0008447 3300046513 Bacteria 6099
220 Ga0495616_0017177 3300046513 Bacteria 3992
221 Ga0495616_0044268 3300046513 Bacteria 2258
222 Ga0495618_0001351 3300046514 Bacteria 16490
223 Ga0495618_0007070 3300046514 Bacteria 6789
224 Ga0495618_0034789 3300046514 Bacteria 3161
225 Ga0495628_0001732 3300046516 Bacteria 19860
226 Ga0495628_0002801 3300046516 Bacteria 15649
227 Ga0495628_0004709 3300046516 Bacteria 12031
228 Ga0495628_0011965 3300046516 Bacteria 7317
229 Ga0495628_0015370 3300046516 Bacteria 6392
230 Ga0495630_0006005 3300046517 Bacteria 8589
231 Ga0495630_0015864 3300046517 Bacteria 5505
232 Ga0495630_0092052 3300046517 Bacteria 2291
233 Ga0495643_0003204 3300046522 Bacteria 12144
234 Ga0495648_0001271 3300046524 Bacteria 25153
235 Ga0495648_0026640 3300046524 Bacteria 3888
236 Ga0495648_0045813 3300046524 Bacteria 2717
237 Ga0495663_0006506 3300046525 Bacteria 3225
238 Ga0495666_0000335 3300046526 Bacteria 20557
239 Ga0495666_0008955 3300046526 Bacteria 5008
240 Ga0495666_0010771 3300046526 Bacteria 4561
241 Ga0495642_0001491 3300046528 Bacteria 10449
242 Ga0495642_0013143 3300046528 Bacteria 3198
243 Ga0495652_0030763 3300046529 Bacteria 4704
244 Ga0495652_0145000 3300046529 Bacteria 1862
245 Ga0495652_0179897 3300046529 Bacteria 1624
246 Ga0495665_0002074 3300046531 Bacteria 10844
247 Ga0495665_0002423 3300046531 Bacteria 10080
248 Ga0495665_0010976 3300046531 Bacteria 4901
249 Ga0495640_0002769 3300046533 Bacteria 14103
250 Ga0495640_0005656 3300046533 Bacteria 9941
251 Ga0495586_0000616 3300046535 Bacteria 20577
252 Ga0495587_0013668 3300046536 Bacteria 5099
253 Ga0495609_0000007 3300046538 Bacteria 398812
254 Ga0495597_0001299 3300046542 Bacteria 18334
255 Ga0495645_0003450 3300046543 Bacteria 10721
256 Ga0495645_0045674 3300046543 Bacteria 3196
257 Ga0495622_0000005 3300046557 Bacteria 254434
258 Ga0495622_0014463 3300046557 Bacteria 3664
259 Ga0495668_0000376 3300046616 Bacteria 59159
260 Ga0495634_0003611 3300046642 Bacteria 12356
261 Ga0495634_0038003 3300046642 Bacteria 3284
262 Ga0495635_0003283 3300046663 Bacteria 11172
263 Ga0495635_0009569 3300046663 Bacteria 6772
264 Ga0495635_0011055 3300046663 Bacteria 6329
265 Ga0495661_0000343 3300046665 Bacteria 50849
266 Ga0495661_0001659 3300046665 Bacteria 18142
267 Ga0495661_0004566 3300046665 Bacteria 9973
268 Ga0495661_0012390 3300046665 Bacteria 5756
269 Ga0495661_0062764 3300046665 Bacteria 2199
270 Ga0495661_0076234 3300046665 Bacteria 1946
271 Ga0495588_0000199 3300046674 Bacteria 60892
272 Ga0495588_0035364 3300046674 Bacteria 2531
273 Ga0495588_0075810 3300046674 Bacteria 1752
274 Ga0495657_0052338 3300046675 Bacteria 2738
275 Ga0495599_0010934 3300046678 Bacteria 5565
276 Ga0495623_0003527 3300046679 Bacteria 10356
277 Ga0495623_0024211 3300046679 Bacteria 3915
278 Ga0495623_0038179 3300046679 Bacteria 3071
279 Ga0495646_0000570 3300046680 Bacteria 20025
280 Ga0495646_0001418 3300046680 Bacteria 14248
281 Ga0495646_0022957 3300046680 Bacteria 3929
282 Ga0495613_0002909 3300046689 Bacteria 12825
283 Ga0495613_0018255 3300046689 Bacteria 5230
284 Ga0495624_0011116 3300046690 Bacteria 6191
285 Ga0495624_0011665 3300046690 Bacteria 6035
286 Ga0495624_0044213 3300046690 Bacteria 2839
287 Ga0495624_0054034 3300046690 Bacteria 2533
288 Ga0495671_0000618 3300046692 Bacteria 26020
289 Ga0495671_0012571 3300046692 Bacteria 4618
290 Ga0495649_0030435 3300046694 Bacteria 2981
291 Ga0495649_0046329 3300046694 Bacteria 2368
292 Ga0495589_0000081 3300046794 Bacteria 88067
293 Ga0495589_0000368 3300046794 Bacteria 34953
294 Ga0495589_0007012 3300046794 Bacteria 5910
295 Ga0495600_0002767 3300046809 Bacteria 10167
296 Ga0495600_0060313 3300046809 Bacteria 2477
297 Ga0495660_0000101 3300046810 Bacteria 91466
298 Ga0495581_0000739 3300047315 Bacteria 17317
299 Ga0495581_0007022 3300047315 Bacteria 6526
300 Ga0495604_0002010 3300047317 Bacteria 16396
301 Ga0495604_0057376 3300047317 Bacteria 2994
302 Ga0495636_0000170 3300047318 Bacteria 26126
303 Ga0495636_0019166 3300047318 Bacteria 2748
304 Ga0495636_0029676 3300047318 Bacteria 2233
305 Ga0495674_0003547 3300047319 Bacteria 15166
306 Ga0495674_0004220 3300047319 Bacteria 13838
307 Ga0495674_0011275 3300047319 Bacteria 8438
308 Ga0495672_0003505 3300047320 Bacteria 13371
309 Ga0495676_0001635 3300047321 Bacteria 19509
310 Ga0495676_0004511 3300047321 Bacteria 12733
311 Ga0495676_0069887 3300047321 Bacteria 2707
312 Ga0495680_0003491 3300047322 Bacteria 15436
313 Ga0495680_0007694 3300047322 Bacteria 9835
314 Ga0495680_0072085 3300047322 Bacteria 2628
315 Ga0495680_0092024 3300047322 Bacteria 2272
316 Ga0495683_0003040 3300047323 Bacteria 9861
317 Ga0495683_0027222 3300047323 Bacteria 2924
318 Ga0495683_0062366 3300047323 Bacteria 1844
319 Ga0495687_000120 3300047443 Bacteria 120987
320 Ga0495687_002854 3300047443 Bacteria 13253
321 Ga0495687_003330 3300047443 Bacteria 11771
322 Ga0495687_006779 3300047443 Bacteria 6927
323 Ga0495687_013022 3300047443 Bacteria 4361
324 Ga0495687_057088 3300047443 Bacteria 1625
325 Ga0495675_0000565 3300047444 Bacteria 23906
326 Ga0495675_0009994 3300047444 Bacteria 5919
327 Ga0495675_0015845 3300047444 Bacteria 4767
328 Ga0495675_0026717 3300047444 Bacteria 3680
329 Ga0495677_0000051 3300047445 Bacteria 67038
330 Ga0495677_0001159 3300047445 Bacteria 10551
331 Ga0495679_000063 3300047446 Bacteria 103758
332 Ga0495679_009120 3300047446 Bacteria 3993
333 Ga0495673_0001958 3300047469 Bacteria 15273
334 Ga0495673_0005324 3300047469 Bacteria 7806
335 Ga0495673_0035801 3300047469 Bacteria 2283
336 Ga0495684_0032976 3300047471 Bacteria 3977
337 Ga0495686_0000012 3300047472 Bacteria 508428
338 Ga0495686_0000110 3300047472 Bacteria 169827
339 Ga0495686_0001042 3300047472 Bacteria 33274
340 Ga0495686_0060063 3300047472 Bacteria 2364
341 Ga0495593_0003322 3300047673 Bacteria 9645
342 Ga0495593_0004290 3300047673 Bacteria 8477
343 Ga0495593_0006544 3300047673 Bacteria 6821
344 Ga0495602_0005930 3300048088 Bacteria 12818
345 Ga0495602_0110277 3300048088 Bacteria 2237
346 Ga0495614_0000420 3300048089 Bacteria 17434
347 Ga0495614_0030760 3300048089 Bacteria 2311
348 Ga0495626_0000227 3300048091 Bacteria 66048
349 Ga0495626_0006315 3300048091 Bacteria 6759
350 Ga0495626_0023128 3300048091 Bacteria 3063
351 Ga0495626_0039655 3300048091 Bacteria 2228
352 Ga0496100_0000130 3300048903 Bacteria 42674
353 Ga0496101_0000134 3300048904 Bacteria 65710
354 Ga0496101_0024410 3300048904 Bacteria 4184
355 Ga0496102_0000812 3300048905 Bacteria 30387
356 Ga0496102_0292779 3300048905 Bacteria 1534
357 Ga0496103_0000384 3300048906 Bacteria 39595
358 Ga0496104_0035755 3300048907 Bacteria 4640
359 Ga0496104_0097192 3300048907 Bacteria 2818
360 Ga0496105_0000587 3300048908 Bacteria 24213
361 Ga0496105_0086945 3300048908 Bacteria 2583
362 Ga0496106_0003765 3300048909 Bacteria 11299
363 Ga0496106_0111078 3300048909 Bacteria 2134
364 Ga0496113_0075573 3300048916 Bacteria 2571
365 Ga0496115_0091885 3300048918 Bacteria 2481
366 Ga0496115_0125345 3300048918 Bacteria 2115
367 Ga0496116_0038743 3300048919 Bacteria 3305
368 Ga0496117_0000697 3300048920 Bacteria 53296
369 Ga0496117_0001888 3300048920 Bacteria 28090
370 Ga0496117_0004391 3300048920 Bacteria 15625
371 Ga0496117_0037149 3300048920 Bacteria 3633
372 Ga0496117_0066917 3300048920 Bacteria 2434
373 Ga0496118_0000135 3300048921 Bacteria 130330
374 Ga0496118_0000568 3300048921 Bacteria 61136
375 Ga0496118_0013732 3300048921 Bacteria 7640
376 Ga0496118_0041533 3300048921 Bacteria 3640
377 Ga0496118_0052924 3300048921 Bacteria 3091
378 Ga0496118_0058289 3300048921 Bacteria 2887
379 Ga0496119_0000029 3300048922 Bacteria 243194
380 Ga0496119_0005574 3300048922 Bacteria 11978
381 Ga0496120_0000015 3300048923 Bacteria 310795
382 Ga0496120_0000039 3300048923 Bacteria 202237
383 Ga0496121_0000102 3300048924 Bacteria 195341
384 Ga0496121_0000188 3300048924 Bacteria 138221
385 Ga0496121_0000361 3300048924 Bacteria 93571
386 Ga0496121_0004105 3300048924 Bacteria 19974
387 Ga0496121_0006494 3300048924 Bacteria 14471
388 Ga0496121_0012742 3300048924 Bacteria 9111
389 Ga0496121_0067287 3300048924 Bacteria 2904
390 Ga0496121_0092833 3300048924 Bacteria 2352
391 Ga0496121_0141537 3300048924 Bacteria 1783
392 Ga0496122_0010737 3300048925 Bacteria 9393
393 Ga0496122_0019605 3300048925 Bacteria 6168
394 Ga0496123_0009517 3300048926 Bacteria 8741
395 Ga0496123_0074733 3300048926 Bacteria 2096
396 Ga0496124_0001924 3300048927 Bacteria 28443
397 Ga0496124_0009421 3300048927 Bacteria 10058
398 Ga0496124_0021593 3300048927 Bacteria 5930
399 Ga0496124_0069572 3300048927 Bacteria 2922
400 Ga0496125_0078329 3300048928 Bacteria 2541
401 Ga0496126_0000679 3300048929 Bacteria 62626
402 Ga0496126_0000783 3300048929 Bacteria 57293
403 Ga0496126_0002757 3300048929 Bacteria 23180
404 Ga0496126_0004734 3300048929 Bacteria 16053
405 Ga0496126_0111589 3300048929 Bacteria 2381
406 Ga0495678_026840 3300049459 Bacteria 2451
407 Ga0495682_0007322 3300049460 Bacteria 4401
408 Ga0495682_0017630 3300049460 Bacteria 2692
409 Ga0501035_0003072 3300049822 Bacteria 16023
410 Ga0500610_0000636 3300053079 Bacteria 10807
411 Ga0500643_001233 3300053087 Bacteria 15204
412 Ga0500651_0000119 3300053093 Bacteria 48696
413 Ga0500651_0000196 3300053093 Bacteria 38629
414 Ga0500597_000060 3300053120 Bacteria 21908
415 2501071628 2501025501 Bacteria 7768574
416 2501406962 2501025504 Bacteria 8008976
417 2509127385 2508501125 Bacteria 7208311
418 2511091994 2510917013 Bacteria 9951648
419 2511097864 2510917014 Bacteria 8296963
420 2511108050 2510917015 Bacteria 7950052
421 2513921965 2513237145 Bacteria 8979722
422 2514047083 2513237166 Bacteria 10373764
423 2516019999 2515154189 Bacteria 9629850
424 2563060759 2562617112 Bacteria 10918404
425 2599501784 2599185188 Bacteria 6164180
426 2599611183 2599185212 Bacteria 6765997
427 2599737874 2599185239 Bacteria 8686614
428 2599770003 2599185248 Bacteria 6696816
429 2599887327 2599185289 Bacteria 6778765
430 2599898508 2599185291 Bacteria 6775623
431 2599931263 2599185300 Bacteria 6062622
432 2599944355 2599185302 Bacteria 5954930
433 2599954827 2599185304 Bacteria 5951361
434 2599958967 2599185305 Bacteria 6748700
435 2599984244 2599185309 Bacteria 5969593
436 2599991452 2599185310 Bacteria 6014457
437 2599994501 2599185311 Bacteria 6354990
438 2600001168 2599185312 Bacteria 5912071
439 2600017189 2599185315 Bacteria 6771107
440 2600023456 2599185316 Bacteria 6320029
441 2600029197 2599185317 Bacteria 6435722
442 2600035650 2599185318 Bacteria 6961590
443 2600042072 2599185319 Bacteria 6637840
444 2600048957 2599185320 Bacteria 5963263
445 2600052012 2599185321 Bacteria 6764560
446 2600057126 2599185322 Bacteria 6763055
447 2600064972 2599185323 Bacteria 6688755
448 2600077387 2599185325 Bacteria 6324919
449 2600358571 2600254930 Bacteria 6431253
450 2600444221 2600254954 Bacteria 5100516
451 2600811460 2600255067 Bacteria 6795583
452 2602008300 2600255389 Bacteria 5275336
453 2643799479 2643221556 Bacteria 7251154
454 2644471569 2643221684 Bacteria 7145183
455 2671091000 2667528170 Bacteria 6786960
456 2671124671 2667528176 Bacteria 6724917
457 2713480342 2711768613 Bacteria 11048459
458 2738820959 2738541296 Bacteria 7285013
459 2738833441 2738541298 Bacteria 7286732
460 2738874968 2738541306 Bacteria 7284992
461 2739186597 2738543002 Bacteria 7284546
462 2739221566 2738543008 Bacteria 7282815
463 2746090352 2744054900 Bacteria 8399525
464 2746095792 2744054901 Bacteria 8397047
465 2765567943 2765235838 Bacteria 5445269
466 2794597765 2791355520 Bacteria 5948615
467 2808929760 2808606377 Bacteria 6646337
468 2808951661 2808606381 Bacteria 6646461
469 2808969184 2808606384 Bacteria 8474373
470 2808977250 2808606385 Bacteria 6711065
471 2808992405 2808606388 Bacteria 6706662
472 2809004015 2808606390 Bacteria 8476311
473 2809012734 2808606391 Bacteria 8308166
474 2819631718 2818991452 Bacteria 8442785
475 2823425848 2823421272 Bacteria 5372474
476 2825657199 2825651385 Bacteria 6715909
477 2831867219 2831864461 Bacteria 6502356
478 2839097768 2839094727 Bacteria 5534556
479 2842835197 2842832357 Bacteria 5959113
480 2852613392 2852612431 Bacteria 6885235
481 2852668872 2852667396 Bacteria 6885555
482 2857366075 2857357740 Bacteria 9937880
483 2883088595 2883087390 Bacteria 9532701
484 2900635447 2900634093 Bacteria 10263517
485 2904486326 2904483920 Bacteria 7545285
486 2904566810 2904564687 Bacteria 7609577
487 2904574246 2904571731 Bacteria 7608790
488 2919391123 2919385768 Bacteria 5897293
489 2919502604 2919501602 Bacteria 5286340
490 2919527669 2919527303 Bacteria 7718827
491 2926064277 2926063275 Bacteria 5285848
492 2928060484 2928058823 Bacteria 5520022
493 2928166024 2928163908 Bacteria 7561269
494 2928173575 2928170801 Bacteria 8785406
495 2928539710 2928536128 Bacteria 7657547
496 2945936753 2945934425 Bacteria 7444609
497 2974291435 2974289157 Bacteria 6080362
498 2990709317 2990703756 Bacteria 7715990
499 2998142332 2998139840 Bacteria 6073514
500 3007318579 3007315729 Bacteria 5076637
501 642423338 641736151 Bacteria 7477263
502 642597542 642555112 Bacteria 8676562
503 642621070 642555113 Bacteria 8214658
504 8020940483 8020938398 Bacteria 7472757
505 8020949287 8020945358 Bacteria 8467355
506 8020955138 8020953355 Bacteria 7439080
507 8029998364 8029995093 Bacteria 5990776
508 8034965184 8034962539 Bacteria 4884839
509 8047676030 8047673197 Bacteria 7395230
510 8052496675 8052494512 Bacteria 5765634
511 8055306990 8055301274 Bacteria 8587385
512 Ga0495687_008331
513 SwRhRL2b_contig_3363960
514 JGI24740J21852_10001733
515 JGI24739J22299_10003743
516 JGI24735J21928_10001856
517 JGI24738J21930_10006078
518 JGI25156J39149_1000226
519 JGI25154J39366_1001582
520 JGI25157J39369_1001238
521 JGI25165J46597_1001109
522 rootH1_10125262
523 rootH2_10019355
524 rootL2_10012728
525 rootL2_10028803
526 rootL2_10028804
527 rootH1_10250090
528 JGI25160J50197_1000029
529 Ga0055533_1000070
530 Ga0055532_1000011
531 Ga0055527_1000009
532 Ga0055535_1000008
533 Ga0055542_1000014
534 Ga0055529_1000010
535 Ga0055526_1003951
536 Ga0055543_1005593
537 Ga0065165_1000040
538 Ga0065165_1000323
539 Ga0065704_10074367
540 Ga0070660_100135801
541 Ga0070661_100025867
542 Ga0070663_100016391
543 Ga0070685_10004194
544 Ga0068855_100147477
545 Ga0070664_100077982
546 Ga0068857_100014899
547 Ga0081540_1001041
548 Ga0105251_10005218
549 Ga0105250_10013668
550 Ga0105240_10000197
551 Ga0105240_10000199
552 Ga0105240_10002431
553 Ga0105240_10106596
554 Ga0105243_10028941
555 Ga0105248_10047248
556 Ga0105248_10053236
557 Ga0105237_10020007
558 Ga0105239_10000110
559 Ga0157369_10180933
560 Ga0163162_10000812
561 Ga0163162_10037086
562 Ga0182008_10002724
563 Ga0182006_1000325
564 Ga0182006_1002591
565 Ga0182006_1006066
566 Ga0183361_10027
567 Ga0213872_10000527
568 Ga0209566_100790
569 Ga0209674_100011
570 Ga0209674_101037
571 Ga0209674_101929
572 Ga0209672_100002
573 Ga0209147_100003
574 Ga0209147_100037
575 Ga0209147_100039
576 Ga0209563_100011
577 Ga0207427_100540
578 Ga0209258_100005
579 Ga0209258_100062
580 Ga0209646_1000256
581 Ga0209026_1000069
582 Ga0209677_101913
583 Ga0209677_108336
584 Ga0209148_1000006
585 Ga0209148_1000075
586 Ga0209148_1003713
587 Ga0209759_1000006
588 Ga0209759_1000543
589 Ga0209233_1000018
590 Ga0209455_1000003
591 Ga0209455_1000067
592 Ga0209673_1000044
593 Ga0209564_1000097
594 Ga0209564_1006345
595 Ga0207426_1000004
596 Ga0207713_1007866
597 Ga0207705_10006970
598 Ga0207695_10000040
599 Ga0207695_10000207
600 Ga0207695_10002579
601 Ga0207671_10013310
602 Ga0207657_10138802
603 Ga0207709_10038511
604 Ga0207709_10085380
605 Ga0207711_10025394
606 Ga0207679_10055280
607 Ga0207667_10010081
608 Ga0207674_10013039
609 Ga0207698_10015410
610 Ga0209371_1001121
611 Ga0265338_10000871
612 Ga0268256_1000952
613 Ga0307408_100000002
614 Ga0307408_100006901
615 Ga0307408_100038403
616 Ga0307407_10031912
617 Ga0307412_10000003
618 Ga0307412_10065238
619 Ga0307409_100109260
620 Ga0307414_10057606
621 Ga0373931_0001517
622 Ga0395899_0027078
623 Ga0395899_0029100
624 Ga0395899_0097165
625 Ga0395899_0133960
626 Ga0395900_0011287
627 Ga0395900_0149632
628 Ga0395900_0156861
629 Ga0395898_0011777
630 Ga0395898_0205436
631 Ga0395898_0283486
632 Ga0395905_0000035
633 Ga0395905_0122946
634 Ga0395901_0000187
635 Ga0395901_0001076
636 Ga0395901_0028139
637 Ga0395901_0297531
638 Ga0395901_0335481
639 Ga0436361_0054243
640 Ga0436361_0393634
641 Ga0436361_0444627
642 Ga0436361_0844409
643 Ga0436361_1152328
644 Ga0439438_000113
645 Ga0439438_000114
646 Ga0439447_001096
647 Ga0439447_005335
648 Ga0439447_007019
649 Ga0451793_1822033
650 Ga0439431_0000009
651 Ga0439448_0000838
652 Ga0439432_000081
653 Ga0439432_005236
654 Ga0439432_005381
655 Ga0439451_000103
656 Ga0439451_003151
657 Ga0439452_000107
658 Ga0439452_003374
659 Ga0450911_000010
660 Ga0450911_000426
661 Ga0450911_004292
662 Ga0450891_002113
663 Ga0450900_000380
664 Ga0450902_000513
665 Ga0450903_003747
666 Ga0450904_000094
667 Ga0450905_002265
668 Ga0450905_002507
669 Ga0450906_000007
670 Ga0450910_000224
671 Ga0439459_0005469
672 Ga0439464_0011033
673 Ga0450901_000139
674 Ga0466969_0028891
675 Ga0466969_0063215
676 Ga0466972_0022515
677 Ga0466966_0046940
678 Ga0466966_0048094
679 Ga0466966_0071496
680 Ga0466966_0092149
681 Ga0466966_0108069
682 Ga0466961_0005265
683 Ga0466961_0093766
684 Ga0466970_0008747
685 Ga0466957_0013153
686 Ga0466957_0037586
687 Ga0466957_0050873
688 Ga0466960_0010123
689 Ga0466959_0024157
690 Ga0466959_0043277
691 Ga0466958_0037838
692 Ga0495603_0002701
693 Ga0495590_0007134
694 Ga0495590_0021841
695 Ga0495629_0000054
696 Ga0495629_0005850
697 Ga0495629_0060488
698 Ga0495641_0016747
699 Ga0495651_0005248
700 Ga0495653_0000099
701 Ga0495653_0008463
702 Ga0495650_0014685
703 Ga0495650_0038497
704 Ga0495580_0000594
705 Ga0495580_0001487
706 Ga0495580_0008497
707 Ga0495580_0020356
708 Ga0495580_0038210
709 Ga0495582_0006663
710 Ga0495582_0007771
711 Ga0495582_0010701
712 Ga0495605_0000263
713 Ga0495605_0014009
714 Ga0495605_0058440
715 Ga0495605_0059560
716 Ga0495664_0000188
717 Ga0495584_0002446
718 Ga0495584_0011408
719 Ga0495596_0006306
720 Ga0495607_0000981
721 Ga0495607_0004709
722 Ga0495607_0008646
723 Ga0495583_0023960
724 Ga0495606_0002371
725 Ga0495606_0013679
726 Ga0495606_0046077
727 Ga0495608_0009064
728 Ga0495608_0011160
729 Ga0495610_0007683
730 Ga0495616_0008447
731 Ga0495616_0017177
732 Ga0495616_0044268
733 Ga0495618_0001351
734 Ga0495618_0007070
735 Ga0495618_0034789
736 Ga0495628_0001732
737 Ga0495628_0002801
738 Ga0495628_0004709
739 Ga0495628_0011965
740 Ga0495628_0015370
741 Ga0495630_0006005
742 Ga0495630_0015864
743 Ga0495630_0092052
744 Ga0495643_0003204
745 Ga0495648_0001271
746 Ga0495648_0026640
747 Ga0495648_0045813
748 Ga0495663_0006506
749 Ga0495666_0000335
750 Ga0495666_0008955
751 Ga0495666_0010771
752 Ga0495642_0001491
753 Ga0495642_0013143
754 Ga0495652_0030763
755 Ga0495652_0145000
756 Ga0495652_0179897
757 Ga0495665_0002074
758 Ga0495665_0002423
759 Ga0495665_0010976
760 Ga0495640_0002769
761 Ga0495640_0005656
762 Ga0495586_0000616
763 Ga0495587_0013668
764 Ga0495609_0000007
765 Ga0495597_0001299
766 Ga0495645_0003450
767 Ga0495645_0045674
768 Ga0495622_0000005
769 Ga0495622_0014463
770 Ga0495668_0000376
771 Ga0495634_0003611
772 Ga0495634_0038003
773 Ga0495635_0003283
774 Ga0495635_0009569
775 Ga0495635_0011055
776 Ga0495661_0000343
777 Ga0495661_0001659
778 Ga0495661_0004566
779 Ga0495661_0012390
780 Ga0495661_0062764
781 Ga0495661_0076234
782 Ga0495588_0000199
783 Ga0495588_0035364
784 Ga0495588_0075810
785 Ga0495657_0052338
786 Ga0495599_0010934
787 Ga0495623_0003527
788 Ga0495623_0024211
789 Ga0495623_0038179
790 Ga0495646_0000570
791 Ga0495646_0001418
792 Ga0495646_0022957
793 Ga0495613_0002909
794 Ga0495613_0018255
795 Ga0495624_0011116
796 Ga0495624_0011665
797 Ga0495624_0044213
798 Ga0495624_0054034
799 Ga0495671_0000618
800 Ga0495671_0012571
801 Ga0495649_0030435
802 Ga0495649_0046329
803 Ga0495589_0000081
804 Ga0495589_0000368
805 Ga0495589_0007012
806 Ga0495600_0002767
807 Ga0495600_0060313
808 Ga0495660_0000101
809 Ga0495581_0000739
810 Ga0495581_0007022
811 Ga0495604_0002010
812 Ga0495604_0057376
813 Ga0495636_0000170
814 Ga0495636_0019166
815 Ga0495636_0029676
816 Ga0495674_0003547
817 Ga0495674_0004220
818 Ga0495674_0011275
819 Ga0495672_0003505
820 Ga0495676_0001635
821 Ga0495676_0004511
822 Ga0495676_0069887
823 Ga0495680_0003491
824 Ga0495680_0007694
825 Ga0495680_0072085
826 Ga0495680_0092024
827 Ga0495683_0003040
828 Ga0495683_0027222
829 Ga0495683_0062366
830 Ga0495687_000120
831 Ga0495687_002854
832 Ga0495687_003330
833 Ga0495687_006779
834 Ga0495687_013022
835 Ga0495687_057088
836 Ga0495675_0000565
837 Ga0495675_0009994
838 Ga0495675_0015845
839 Ga0495675_0026717
840 Ga0495677_0000051
841 Ga0495677_0001159
842 Ga0495679_000063
843 Ga0495679_009120
844 Ga0495673_0001958
845 Ga0495673_0005324
846 Ga0495673_0035801
847 Ga0495684_0032976
848 Ga0495686_0000012
849 Ga0495686_0000110
850 Ga0495686_0001042
851 Ga0495686_0060063
852 Ga0495593_0003322
853 Ga0495593_0004290
854 Ga0495593_0006544
855 Ga0495602_0005930
856 Ga0495602_0110277
857 Ga0495614_0000420
858 Ga0495614_0030760
859 Ga0495626_0000227
860 Ga0495626_0006315
861 Ga0495626_0023128
862 Ga0495626_0039655
863 Ga0496100_0000130
864 Ga0496101_0000134
865 Ga0496101_0024410
866 Ga0496102_0000812
867 Ga0496102_0292779
868 Ga0496103_0000384
869 Ga0496104_0035755
870 Ga0496104_0097192
871 Ga0496105_0000587
872 Ga0496105_0086945
873 Ga0496106_0003765
874 Ga0496106_0111078
875 Ga0496113_0075573
876 Ga0496115_0091885
877 Ga0496115_0125345
878 Ga0496116_0038743
879 Ga0496117_0000697
880 Ga0496117_0001888
881 Ga0496117_0004391
882 Ga0496117_0037149
883 Ga0496117_0066917
884 Ga0496118_0000135
885 Ga0496118_0000568
886 Ga0496118_0013732
887 Ga0496118_0041533
888 Ga0496118_0052924
889 Ga0496118_0058289
890 Ga0496119_0000029
891 Ga0496119_0005574
892 Ga0496120_0000015
893 Ga0496120_0000039
894 Ga0496121_0000102
895 Ga0496121_0000188
896 Ga0496121_0000361
897 Ga0496121_0004105
898 Ga0496121_0006494
899 Ga0496121_0012742
900 Ga0496121_0067287
901 Ga0496121_0092833
902 Ga0496121_0141537
903 Ga0496122_0010737
904 Ga0496122_0019605
905 Ga0496123_0009517
906 Ga0496123_0074733
907 Ga0496124_0001924
908 Ga0496124_0009421
909 Ga0496124_0021593
910 Ga0496124_0069572
911 Ga0496125_0078329
912 Ga0496126_0000679
913 Ga0496126_0000783
914 Ga0496126_0002757
915 Ga0496126_0004734
916 Ga0496126_0111589
917 Ga0495678_026840
918 Ga0495682_0007322
919 Ga0495682_0017630
920 Ga0501035_0003072
921 Ga0500610_0000636
922 Ga0500643_001233
923 Ga0500651_0000119
924 Ga0500651_0000196
925 Ga0500597_000060
926 2501071628
927 2501406962
928 2509127385
929 2511091994
930 2511097864
931 2511108050
932 2513921965
933 2514047083
934 2516019999
935 2563060759
936 2599501784
937 2599611183
938 2599737874
939 2599770003
940 2599887327
941 2599898508
942 2599931263
943 2599944355
944 2599954827
945 2599958967
946 2599984244
947 2599991452
948 2599994501
949 2600001168
950 2600017189
951 2600023456
952 2600029197
953 2600035650
954 2600042072
955 2600048957
956 2600052012
957 2600057126
958 2600064972
959 2600077387
960 2600358571
961 2600444221
962 2600811460
963 2602008300
964 2643799479
965 2644471569
966 2671091000
967 2671124671
968 2713480342
969 2738820959
970 2738833441
971 2738874968
972 2739186597
973 2739221566
974 2746090352
975 2746095792
976 2765567943
977 2794597765
978 2808929760
979 2808951661
980 2808969184
981 2808977250
982 2808992405
983 2809004015
984 2809012734
985 2819631718
986 2823425848
987 2825657199
988 2831867219
989 2839097768
990 2842835197
991 2852613392
992 2852668872
993 2857366075
994 2883088595
995 2900635447
996 2904486326
997 2904566810
998 2904574246
999 2919391123
1000 2919502604
1001 2919527669
1002 2926064277
1003 2928060484
1004 2928166024
1005 2928173575
1006 2928539710
1007 2945936753
1008 2974291435
1009 2990709317
1010 2998142332
1011 3007318579
1012 642423338
1013 642597542
1014 642621070
1015 8020940483
1016 8020949287
1017 8020955138
1018 8029998364
1019 8034965184
1020 8047676030
1021 8052496675
1022 8055306990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13487

HD_5

HD domain

312

479

0.97

PF00196

GerE

Bacterial regulatory proteins, luxR family

502

558

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3clo-assembly1.cif.gz_B crystal structure of putative transcriptional regulator containing a luxr dna binding domain (np_811094.1) from bacteroides thetaiotaomicron vpi-5482 at 2.04 a resolution 0.986 430 490
3clo-assembly2.cif.gz_C-2 crystal structure of putative transcriptional regulator containing a luxr dna binding domain (np_811094.1) from bacteroides thetaiotaomicron vpi-5482 at 2.04 a resolution 0.9831 430 490
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.972 431 486
6jqs-assembly1.cif.gz_A structure of transcription factor, gere 0.9608 429 492
1fse-assembly2.cif.gz_C crystal structure of the bacillus subtilis regulatory protein gere 0.9594 427 492
ID Description Score Start End Superfamily
3cloC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9942 430 486 1.10.10.10
3cloA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9926 430 486 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.972 431 486 1.10.10.10
6cbqB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9717 431 490 1.10.10.10
3sztA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9679 431 492 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7C6TD58-F1-model_v4 HD domain-containing protein 0.9438 263 418 GO:0016787
AF-A0A353BHG7-F1-model_v4 HD-GYP domain-containing protein 0.943 240 413
AF-A0A7C6IVN1-F1-model_v4 HD-GYP domain-containing protein 0.9335 260 418
AF-A0A398CL70-F1-model_v4 HD-GYP domain-containing protein 0.9229 258 418
AF-A0A2K2VHJ2-F1-model_v4 Phosphohydrolase 0.9205 254 419 GO:0016787

Map