F457313

General Info

Members Datasets Scaffolds Average Seq Length
511 302 476 261

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0135805|Ga0395899_0135805_381_1211
Length 276
Sequence MPGMTDQVECIVRQAITGVETMSDENPVLTEVRGPILIVTLNRPEAKNAVNLALAKAVAAAMDKLDTDDSLAVGIITGAGGTFCSGMDLKGFLKGERPFVPGRGFAGLAEAPPKKPLIAAVDGYALAGGMEIALSCDMIVANRNAKFGIPEVKRGLAAAAGGLIRMPRQMPFRVAMEYALTGEFFGAERAYELGIINRLTDGAALDAALELAKTIGANGPLAVKASKQVVVQSRLWTEDEMWKKQQDIVAPIFTSEDAREGAAAFAEKRAPNWKGK

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
6 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
7 2547132424 Nocardia nova SH22a Isolate Unclassified
8 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
9 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
10 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
11 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
12 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
13 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
14 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
15 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
16 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
17 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
18 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
19 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
20 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
21 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
22 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
23 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
24 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
25 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
26 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
27 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
28 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
29 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
30 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
187 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
188 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
189 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
190 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
191 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
211 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
212 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
229 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
280 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
281 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
282 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
283 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
288 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
289 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
290 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
291 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
292 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
293 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
294 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
295 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
296 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
297 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
298 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
299 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
300 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
301 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
302 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.7
Metatranscriptomes 0
Isolates 6.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.57
Nodule 3.13
Rhizoplane 9
Rhizosphere 67.91
Stem 0
Stem Tuber 0
Unclassified 9.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001223 3300001977 Bacteria 4081
2 JGI24739J22299_10020106 3300001989 Bacteria 2385
3 JGI24738J21930_10006464 3300002075 Bacteria 2748
4 JGI24744J21845_10006003 3300002077 Bacteria 2519
5 JGI25153J46596_10000258 3300003215 Bacteria 42730
6 Ga0070690_100030734 3300005330 Bacteria 3341
7 Ga0070670_100151939 3300005331 Bacteria 2004
8 Ga0068869_100010429 3300005334 Bacteria 6061
9 Ga0068869_100020467 3300005334 Bacteria 4536
10 Ga0070666_10235508 3300005335 Bacteria 1294
11 Ga0070682_100004484 3300005337 Bacteria 7757
12 Ga0070682_100227302 3300005337 Bacteria 1332
13 Ga0068868_100005904 3300005338 Bacteria 8639
14 Ga0068868_100031993 3300005338 Bacteria 4044
15 Ga0068868_100100744 3300005338 Bacteria 2337
16 Ga0070691_10108553 3300005341 Bacteria 1386
17 Ga0070692_10029731 3300005345 Bacteria 2726
18 Ga0070668_100017929 3300005347 Bacteria 5310
19 Ga0070668_100048178 3300005347 Bacteria 3277
20 Ga0070669_100013957 3300005353 Bacteria 5713
21 Ga0070675_100114370 3300005354 Bacteria 2287
22 Ga0070671_100037796 3300005355 Bacteria 4005
23 Ga0070671_100201407 3300005355 Bacteria 1688
24 Ga0070674_100000279 3300005356 Bacteria 24930
25 Ga0070673_100032847 3300005364 Bacteria 3912
26 Ga0070688_100024948 3300005365 Bacteria 3535
27 Ga0070659_100146600 3300005366 Bacteria 1923
28 Ga0070667_100002372 3300005367 Bacteria 16505
29 Ga0070667_100011785 3300005367 Bacteria 7225
30 Ga0070667_100144075 3300005367 Bacteria 2088
31 Ga0070667_100272992 3300005367 Bacteria 1516
32 Ga0070709_10127512 3300005434 Bacteria 1733
33 Ga0070709_10291230 3300005434 Bacteria 1190
34 Ga0070714_100125461 3300005435 Bacteria 2288
35 Ga0070710_10198362 3300005437 Bacteria 1266
36 Ga0070701_10000811 3300005438 Bacteria 11160
37 Ga0070711_100062393 3300005439 Bacteria 2597
38 Ga0070705_100024565 3300005440 Bacteria 3255
39 Ga0070700_100000661 3300005441 Bacteria 17040
40 Ga0070694_100033743 3300005444 Bacteria 3371
41 Ga0070678_100000073 3300005456 Bacteria 37362
42 Ga0070678_100118152 3300005456 Bacteria 2086
43 Ga0070678_100450289 3300005456 Bacteria 1127
44 Ga0070662_100011539 3300005457 Bacteria 5831
45 Ga0070662_100271007 3300005457 Bacteria 1371
46 Ga0068867_100000103 3300005459 Bacteria 54156
47 Ga0068867_100046949 3300005459 Bacteria 3173
48 Ga0070685_10005685 3300005466 Bacteria 6333
49 Ga0070685_10146400 3300005466 Bacteria 1493
50 Ga0068853_100006446 3300005539 Bacteria 9329
51 Ga0068853_100159139 3300005539 Bacteria 2037
52 Ga0070672_100067098 3300005543 Bacteria 2842
53 Ga0070686_100071637 3300005544 Bacteria 2270
54 Ga0070695_100023575 3300005545 Bacteria 3784
55 Ga0070696_100020015 3300005546 Bacteria 4537
56 Ga0070665_100002596 3300005548 Bacteria 19722
57 Ga0070665_100003028 3300005548 Bacteria 18124
58 Ga0070665_100068697 3300005548 Bacteria 3553
59 Ga0070704_100019247 3300005549 Bacteria 4384
60 Ga0068855_100025574 3300005563 Bacteria 7060
61 Ga0068855_100400609 3300005563 Bacteria 1504
62 Ga0070664_100499534 3300005564 Bacteria 1121
63 Ga0068854_100000290 3300005578 Bacteria 33622
64 Ga0068854_100190049 3300005578 Bacteria 1608
65 Ga0068856_100645351 3300005614 Bacteria 1079
66 Ga0070702_100001458 3300005615 Bacteria 9695
67 Ga0070702_100091887 3300005615 Bacteria 1842
68 Ga0070702_100097372 3300005615 Bacteria 1797
69 Ga0068852_100089675 3300005616 Bacteria 2749
70 Ga0068852_100166140 3300005616 Bacteria 2065
71 Ga0068852_100431953 3300005616 Bacteria 1301
72 Ga0068859_100007119 3300005617 Bacteria 11352
73 Ga0068859_100070780 3300005617 Bacteria 3523
74 Ga0068864_100055532 3300005618 Bacteria 3420
75 Ga0068864_100149105 3300005618 Bacteria 2117
76 Ga0068864_100269836 3300005618 Bacteria 1585
77 Ga0068866_10000932 3300005718 Bacteria 12843
78 Ga0068866_10094818 3300005718 Bacteria 1633
79 Ga0068861_100000332 3300005719 Bacteria 26721
80 Ga0068861_100427991 3300005719 Bacteria 1181
81 Ga0068863_100000666 3300005841 Bacteria 34638
82 Ga0068858_100000981 3300005842 Bacteria 29454
83 Ga0068858_100118357 3300005842 Bacteria 2476
84 Ga0068860_100000721 3300005843 Bacteria 37719
85 Ga0068862_100001612 3300005844 Bacteria 20542
86 Ga0081538_10066186 3300005981 Bacteria 2028
87 Ga0075365_10001321 3300006038 Bacteria 11075
88 Ga0075365_10018089 3300006038 Bacteria 4326
89 Ga0075365_10167483 3300006038 Bacteria 1533
90 Ga0075363_100000957 3300006048 Bacteria 10255
91 Ga0075363_100001438 3300006048 Bacteria 9026
92 Ga0075363_100009446 3300006048 Bacteria 4585
93 Ga0075363_100011815 3300006048 Bacteria 4191
94 Ga0075363_100011977 3300006048 Bacteria 4169
95 Ga0075363_100013668 3300006048 Bacteria 3945
96 Ga0075363_100060193 3300006048 Bacteria 2044
97 Ga0075363_100071328 3300006048 Bacteria 1888
98 Ga0075364_10005065 3300006051 Bacteria 7640
99 Ga0075364_10016973 3300006051 Bacteria 4537
100 Ga0075364_10037541 3300006051 Bacteria 3137
101 Ga0070715_10014831 3300006163 Bacteria 2894
102 Ga0070716_100159833 3300006173 Bacteria 1459
103 Ga0070716_100223464 3300006173 Bacteria 1267
104 Ga0070712_100001695 3300006175 Bacteria 13508
105 Ga0070712_100021645 3300006175 Bacteria 4226
106 Ga0075362_10003997 3300006177 Bacteria 5246
107 Ga0075367_10122809 3300006178 Bacteria 1601
108 Ga0075367_10291522 3300006178 Bacteria 1027
109 Ga0075369_10000962 3300006186 Bacteria 9573
110 Ga0075369_10020687 3300006186 Bacteria 2696
111 Ga0075369_10031830 3300006186 Bacteria 2229
112 Ga0075370_10005284 3300006353 Bacteria 6396
113 Ga0075370_10026117 3300006353 Bacteria 3232
114 Ga0075370_10028988 3300006353 Bacteria 3080
115 Ga0075370_10139332 3300006353 Bacteria 1418
116 Ga0075428_100010531 3300006844 Bacteria 10277
117 Ga0075428_100777993 3300006844 Bacteria 1018
118 Ga0075430_100071615 3300006846 Bacteria 2908
119 Ga0075431_100092873 3300006847 Bacteria 3115
120 Ga0068865_100000117 3300006881 Bacteria 40034
121 Ga0068865_100388959 3300006881 Bacteria 1139
122 Ga0097620_100007119 3300006931 Bacteria 11352
123 Ga0097620_100070781 3300006931 Bacteria 3523
124 Ga0105250_10015853 3300009092 Bacteria 3080
125 Ga0105250_10023977 3300009092 Bacteria 2459
126 Ga0105245_10007465 3300009098 Bacteria 9575
127 Ga0105247_10000873 3300009101 Bacteria 22828
128 Ga0114129_10118452 3300009147 Bacteria 3647
129 Ga0105243_10001802 3300009148 Bacteria 18396
130 Ga0105241_10113831 3300009174 Bacteria 2169
131 Ga0105242_10000223 3300009176 Bacteria 44623
132 Ga0105248_10043513 3300009177 Bacteria 5034
133 Ga0105237_10146760 3300009545 Bacteria 2354
134 Ga0105238_10098330 3300009551 Bacteria 2910
135 Ga0105249_10000191 3300009553 Bacteria 70329
136 Ga0105249_10010189 3300009553 Bacteria 8255
137 Ga0105239_10000928 3300010375 Bacteria 41511
138 Ga0105239_10256848 3300010375 Bacteria 1963
139 Ga0105246_10106202 3300011119 Bacteria 2053
140 Ga0105246_10410776 3300011119 Bacteria 1127
141 Ga0157371_10099675 3300013102 Bacteria 2060
142 Ga0157369_10088982 3300013105 Bacteria 3296
143 Ga0157369_10649448 3300013105 Bacteria 1088
144 Ga0157374_10043142 3300013296 Bacteria 4164
145 Ga0157374_10334348 3300013296 Bacteria 1503
146 Ga0157378_10000258 3300013297 Bacteria 52075
147 Ga0157378_10582681 3300013297 Bacteria 1128
148 Ga0163162_10125884 3300013306 Bacteria 2668
149 Ga0163162_10178336 3300013306 Bacteria 2250
150 Ga0163162_10267483 3300013306 Bacteria 1841
151 Ga0157372_10006212 3300013307 Bacteria 12696
152 Ga0157372_10628019 3300013307 Bacteria 1252
153 Ga0157375_10006042 3300013308 Bacteria 10558
154 Ga0157375_10139935 3300013308 Bacteria 2547
155 Ga0163163_10075154 3300014325 Bacteria 3372
156 Ga0163163_10259363 3300014325 Bacteria 1789
157 Ga0163163_10264021 3300014325 Bacteria 1773
158 Ga0157380_10001005 3300014326 Bacteria 17944
159 Ga0157379_10002371 3300014968 Bacteria 15746
160 Ga0157379_10053500 3300014968 Bacteria 3606
161 Ga0157376_10037392 3300014969 Bacteria 3940
162 Ga0163161_10007463 3300017792 Bacteria 7557
163 Ga0213876_10003462 3300021384 Bacteria 9022
164 Ga0213876_10046114 3300021384 Bacteria 2305
165 Ga0213875_10024634 3300021388 Bacteria 2869
166 Ga0213875_10054829 3300021388 Bacteria 1867
167 Ga0209758_1000087 3300025297 Bacteria 254384
168 Ga0207692_10119765 3300025898 Bacteria 1472
169 Ga0207642_10303554 3300025899 Bacteria 926
170 Ga0207710_10028410 3300025900 Bacteria 2428
171 Ga0207688_10002939 3300025901 Bacteria 9271
172 Ga0207688_10011632 3300025901 Bacteria 4786
173 Ga0207688_10146903 3300025901 Bacteria 1390
174 Ga0207680_10059441 3300025903 Bacteria 2322
175 Ga0207680_10317021 3300025903 Bacteria 1089
176 Ga0207647_10136931 3300025904 Bacteria 1436
177 Ga0207685_10024415 3300025905 Bacteria 2072
178 Ga0207685_10052486 3300025905 Bacteria 1580
179 Ga0207699_10144399 3300025906 Bacteria 1567
180 Ga0207643_10113688 3300025908 Bacteria 1597
181 Ga0207671_10080746 3300025914 Bacteria 2438
182 Ga0207693_10000302 3300025915 Bacteria 45878
183 Ga0207693_10006396 3300025915 Bacteria 9764
184 Ga0207663_10000841 3300025916 Bacteria 13922
185 Ga0207657_10196293 3300025919 Bacteria 1626
186 Ga0207681_10034711 3300025923 Bacteria 3318
187 Ga0207681_10066163 3300025923 Bacteria 2501
188 Ga0207659_10016299 3300025926 Bacteria 4834
189 Ga0207687_10031648 3300025927 Bacteria 3577
190 Ga0207687_10043718 3300025927 Bacteria 3088
191 Ga0207700_10160861 3300025928 Bacteria 1865
192 Ga0207700_10340129 3300025928 Bacteria 1304
193 Ga0207644_10014311 3300025931 Bacteria 5307
194 Ga0207644_10087037 3300025931 Bacteria 2321
195 Ga0207706_10006775 3300025933 Bacteria 10594
196 Ga0207706_10021060 3300025933 Bacteria 5857
197 Ga0207706_10432627 3300025933 Bacteria 1139
198 Ga0207686_10003075 3300025934 Bacteria 8982
199 Ga0207670_10279990 3300025936 Bacteria 1299
200 Ga0207669_10011917 3300025937 Bacteria 4253
201 Ga0207704_10001701 3300025938 Bacteria 9846
202 Ga0207704_10629503 3300025938 Bacteria 881
203 Ga0207665_10057964 3300025939 Bacteria 2617
204 Ga0207665_10063728 3300025939 Bacteria 2504
205 Ga0207665_10197313 3300025939 Bacteria 1465
206 Ga0207691_10084931 3300025940 Bacteria 2841
207 Ga0207711_10048955 3300025941 Bacteria 3617
208 Ga0207689_10012510 3300025942 Bacteria 7249
209 Ga0207661_10241422 3300025944 Bacteria 1603
210 Ga0207667_10126312 3300025949 Bacteria 2634
211 Ga0207651_10105993 3300025960 Bacteria 2098
212 Ga0207668_10078845 3300025972 Bacteria 2380
213 Ga0207640_10003005 3300025981 Bacteria 9070
214 Ga0207640_10394888 3300025981 Bacteria 1125
215 Ga0207658_10006351 3300025986 Bacteria 8071
216 Ga0207658_10050868 3300025986 Bacteria 3051
217 Ga0207658_10112636 3300025986 Bacteria 2154
218 Ga0207677_10047190 3300026023 Bacteria 2890
219 Ga0207677_10099907 3300026023 Bacteria 2132
220 Ga0207703_10019039 3300026035 Bacteria 5362
221 Ga0207703_10022562 3300026035 Bacteria 4938
222 Ga0207703_10484046 3300026035 Bacteria 1160
223 Ga0207708_10000461 3300026075 Bacteria 31553
224 Ga0207708_10016961 3300026075 Bacteria 5482
225 Ga0207648_10000139 3300026089 Bacteria 72553
226 Ga0207648_10035314 3300026089 Bacteria 4404
227 Ga0207676_10034886 3300026095 Bacteria 3812
228 Ga0207676_10262064 3300026095 Bacteria 1561
229 Ga0207676_10398366 3300026095 Bacteria 1286
230 Ga0207675_100000106 3300026118 Bacteria 67171
231 Ga0207675_100027749 3300026118 Bacteria 5274
232 Ga0207675_100199477 3300026118 Bacteria 1921
233 Ga0207683_10000296 3300026121 Bacteria 44761
234 Ga0207683_10099652 3300026121 Bacteria 2593
235 Ga0207698_10176763 3300026142 Bacteria 1886
236 Ga0207698_10438787 3300026142 Bacteria 1257
237 Ga0268266_10013936 3300028379 Bacteria 6922
238 Ga0268266_10135231 3300028379 Bacteria 2207
239 Ga0268266_10146399 3300028379 Bacteria 2124
240 Ga0268265_10011081 3300028380 Bacteria 6092
241 Ga0268264_10387765 3300028381 Bacteria 1339
242 Ga0307513_10138481 3300031456 Bacteria 2364
243 Ga0307413_10006449 3300031824 Bacteria 5360
244 Ga0307407_10048436 3300031903 Bacteria 2419
245 Ga0307409_100100489 3300031995 Bacteria 2398
246 Ga0307409_100180547 3300031995 Bacteria 1868
247 Ga0307409_100377371 3300031995 Bacteria 1347
248 Ga0307411_10062615 3300032005 Bacteria 2482
249 Ga0307411_10127047 3300032005 Bacteria 1856
250 Ga0315911_1000027 3300033442 Bacteria 85143
251 Ga0373931_0038568 3300035691 Bacteria 2500
252 Ga0373931_0171069 3300035691 Bacteria 1280
253 Ga0395899_0135805 3300037312 Bacteria 1753
254 Ga0395900_0008536 3300037418 Bacteria 10530
255 Ga0395900_0538460 3300037418 Bacteria 1114
256 Ga0395898_0002054 3300037466 Bacteria 25114
257 Ga0395898_0310056 3300037466 Bacteria 1505
258 Ga0395898_0768340 3300037466 Bacteria 904
259 Ga0395905_0100196 3300037471 Bacteria 2720
260 Ga0436364_0815004 3300037853 Bacteria 3333
261 Ga0436364_0913770 3300037853 Bacteria 25850
262 Ga0436364_1325339 3300037853 Bacteria 11134
263 Ga0395901_0518211 3300038443 Bacteria 1212
264 Ga0436365_0161820 3300039437 Bacteria 55653
265 Ga0436365_1050442 3300039437 Bacteria 9663
266 Ga0436365_1226094 3300039437 Bacteria 4209
267 Ga0436365_1377767 3300039437 Bacteria 53266
268 Ga0436361_0004060 3300039447 Bacteria 953
269 Ga0436363_0790803 3300039450 Bacteria 935
270 Ga0439461_0073030 3300041410 Bacteria 798
271 Ga0439466_0020404 3300041411 Bacteria 2362
272 Ga0439465_0001843 3300041413 Bacteria 6935
273 Ga0439465_0002890 3300041413 Bacteria 5628
274 Ga0439431_0024646 3300041997 Bacteria 1465
275 Ga0439445_0033251 3300042004 Bacteria 1347
276 Ga0450911_001867 3300042115 Bacteria 4461
277 Ga0466969_0018079 3300044656 Bacteria 3678
278 Ga0466972_0012005 3300044658 Bacteria 4352
279 Ga0466972_0016180 3300044658 Bacteria 3728
280 Ga0466972_0065509 3300044658 Bacteria 1738
281 Ga0466972_0174496 3300044658 Bacteria 1008
282 Ga0453683_0001564 3300044673 Bacteria 19405
283 Ga0466965_0145003 3300044683 Bacteria 1238
284 Ga0466965_0187584 3300044683 Bacteria 1093
285 Ga0466966_0020709 3300044684 Bacteria 4322
286 Ga0466966_0070445 3300044684 Bacteria 2192
287 Ga0466961_0009448 3300044693 Bacteria 6209
288 Ga0466961_0038617 3300044693 Bacteria 3063
289 Ga0466961_0055836 3300044693 Bacteria 2517
290 Ga0466963_0032255 3300044694 Bacteria 3391
291 Ga0466963_0040270 3300044694 Bacteria 3062
292 Ga0466968_0018514 3300044735 Bacteria 2794
293 Ga0466968_0021233 3300044735 Bacteria 2628
294 Ga0466970_0006766 3300044765 Bacteria 5739
295 Ga0466970_0033006 3300044765 Bacteria 2736
296 Ga0466957_0002695 3300044842 Bacteria 9600
297 Ga0466957_0024642 3300044842 Bacteria 3562
298 Ga0466957_0083465 3300044842 Bacteria 1993
299 Ga0466960_0000316 3300044901 Bacteria 16570
300 Ga0466960_0100927 3300044901 Bacteria 1486
301 Ga0466959_0035736 3300045049 Bacteria 3672
302 Ga0466959_0083612 3300045049 Bacteria 2298
303 Ga0466959_0273553 3300045049 Bacteria 1160
304 Ga0451576_0000017 3300045051 Bacteria 558261
305 Ga0451576_0006183 3300045051 Bacteria 14745
306 Ga0466958_0005616 3300045836 Bacteria 6766
307 Ga0466958_0033481 3300045836 Bacteria 3062
308 Ga0466958_0116190 3300045836 Bacteria 1672
309 Ga0466967_0001731 3300045976 Bacteria 13020
310 Ga0466967_0060235 3300045976 Bacteria 3363
311 Ga0466967_0119575 3300045976 Bacteria 2432
312 Ga0466967_0238299 3300045976 Bacteria 1734
313 Ga0466967_0416025 3300045976 Bacteria 1310
314 Ga0495592_0034864 3300046454 Bacteria 3792
315 Ga0495638_0015442 3300046460 Bacteria 5126
316 Ga0495664_0065472 3300046477 Bacteria 2167
317 Ga0495596_0000749 3300046500 Bacteria 19919
318 Ga0495583_0049862 3300046506 Bacteria 1915
319 Ga0495606_0026524 3300046507 Bacteria 4129
320 Ga0495608_0037816 3300046511 Bacteria 3244
321 Ga0495610_0002681 3300046512 Bacteria 14677
322 Ga0495630_0102053 3300046517 Bacteria 2170
323 Ga0495632_0197001 3300046519 Bacteria 919
324 Ga0495643_0000945 3300046522 Bacteria 30097
325 Ga0495643_0029065 3300046522 Bacteria 3094
326 Ga0495652_0003139 3300046529 Bacteria 16503
327 Ga0495640_0068171 3300046533 Bacteria 2395
328 Ga0495587_0114878 3300046536 Bacteria 1544
329 Ga0495609_0006434 3300046538 Bacteria 5989
330 Ga0495645_0038945 3300046543 Bacteria 3467
331 Ga0495667_0053623 3300046559 Bacteria 2655
332 Ga0495656_0105524 3300046615 Bacteria 1310
333 Ga0495657_0009591 3300046675 Bacteria 7333
334 Ga0495599_0005989 3300046678 Bacteria 7318
335 Ga0495623_0029770 3300046679 Bacteria 3513
336 Ga0495646_0030517 3300046680 Bacteria 3366
337 Ga0495671_0037188 3300046692 Bacteria 2463
338 Ga0495649_0114587 3300046694 Bacteria 1428
339 Ga0495600_0008557 3300046809 Bacteria 6293
340 Ga0495604_0008090 3300047317 Bacteria 8328
341 Ga0495674_0024251 3300047319 Bacteria 5577
342 Ga0495672_0048999 3300047320 Bacteria 2503
343 Ga0495680_0035974 3300047322 Bacteria 3981
344 Ga0495675_0032097 3300047444 Bacteria 3352
345 Ga0495684_0180625 3300047471 Bacteria 1564
346 Ga0495602_0026104 3300048088 Bacteria 5641
347 Ga0495615_0000187 3300048090 Bacteria 15044
348 Ga0496100_0000788 3300048903 Bacteria 15081
349 Ga0496100_0105500 3300048903 Bacteria 1949
350 Ga0496100_0187614 3300048903 Bacteria 1499
351 Ga0496101_0069852 3300048904 Bacteria 2570
352 Ga0496101_0353803 3300048904 Bacteria 1154
353 Ga0496102_0047276 3300048905 Bacteria 3909
354 Ga0496102_0064165 3300048905 Bacteria 3364
355 Ga0496102_0066284 3300048905 Bacteria 3309
356 Ga0496102_0088172 3300048905 Bacteria 2868
357 Ga0496102_0099586 3300048905 Bacteria 2698
358 Ga0496102_0198766 3300048905 Bacteria 1889
359 Ga0496103_0065198 3300048906 Bacteria 2271
360 Ga0496103_0118133 3300048906 Bacteria 1688
361 Ga0496103_0160707 3300048906 Bacteria 1441
362 Ga0496104_0046621 3300048907 Bacteria 4082
363 Ga0496105_0432418 3300048908 Bacteria 1041
364 Ga0496106_0024206 3300048909 Bacteria 4512
365 Ga0496106_0141044 3300048909 Bacteria 1896
366 Ga0496106_0235489 3300048909 Bacteria 1462
367 Ga0496106_0460389 3300048909 Bacteria 1022
368 Ga0496107_0001768 3300048910 Bacteria 13612
369 Ga0496108_0000811 3300048911 Bacteria 24279
370 Ga0496108_0115551 3300048911 Bacteria 2298
371 Ga0496109_0007888 3300048912 Bacteria 9023
372 Ga0496109_0010225 3300048912 Bacteria 8012
373 Ga0496109_0220549 3300048912 Bacteria 1783
374 Ga0496110_0031326 3300048913 Bacteria 4588
375 Ga0496110_0312896 3300048913 Bacteria 1430
376 Ga0496111_0054519 3300048914 Bacteria 2890
377 Ga0496111_0155172 3300048914 Bacteria 1699
378 Ga0496111_0331463 3300048914 Bacteria 1127
379 Ga0496111_0459244 3300048914 Bacteria 939
380 Ga0496112_0075337 3300048915 Bacteria 3337
381 Ga0496112_0090257 3300048915 Bacteria 3033
382 Ga0496112_0152900 3300048915 Bacteria 2275
383 Ga0496112_0370137 3300048915 Bacteria 1374
384 Ga0496113_0009461 3300048916 Bacteria 6393
385 Ga0496113_0052282 3300048916 Bacteria 3051
386 Ga0496113_0377342 3300048916 Bacteria 1138
387 Ga0496113_0584017 3300048916 Bacteria 895
388 Ga0496114_0000374 3300048917 Bacteria 32986
389 Ga0496114_0404147 3300048917 Bacteria 1209
390 Ga0496115_0000482 3300048918 Bacteria 31567
391 Ga0496115_0269300 3300048918 Bacteria 1400
392 Ga0496115_0488247 3300048918 Bacteria 991
393 Ga0496117_0161987 3300048920 Bacteria 1309
394 Ga0496118_0000652 3300048921 Bacteria 56676
395 Ga0496118_0061348 3300048921 Bacteria 2785
396 Ga0496121_0038299 3300048924 Bacteria 4249
397 Ga0496121_0072187 3300048924 Bacteria 2772
398 Ga0496121_0102636 3300048924 Bacteria 2203
399 Ga0496122_0020437 3300048925 Bacteria 5982
400 Ga0496123_0015506 3300048926 Bacteria 6244
401 Ga0496124_0036411 3300048927 Bacteria 4293
402 Ga0496125_0000571 3300048928 Bacteria 63074
403 Ga0496125_0007259 3300048928 Bacteria 11805
404 Ga0496125_0013064 3300048928 Bacteria 8189
405 Ga0496125_0050394 3300048928 Bacteria 3447
406 Ga0496125_0091602 3300048928 Bacteria 2277
407 Ga0496125_0162428 3300048928 Bacteria 1515
408 Ga0496126_0002449 3300048929 Bacteria 25054
409 Ga0496126_0018862 3300048929 Bacteria 6818
410 Ga0496126_0023913 3300048929 Bacteria 5908
411 Ga0496126_0085570 3300048929 Bacteria 2779
412 Ga0496126_0236577 3300048929 Bacteria 1528
413 Ga0496126_0447806 3300048929 Bacteria 1040
414 Ga0501032_0034473 3300049569 Bacteria 3465
415 Ga0501033_0067481 3300049570 Bacteria 2630
416 Ga0501033_0090234 3300049570 Bacteria 2242
417 Ga0501034_0004016 3300049571 Bacteria 16506
418 Ga0501034_0015628 3300049571 Bacteria 7797
419 Ga0501034_0308515 3300049571 Bacteria 1517
420 Ga0501034_0692919 3300049571 Bacteria 918
421 Ga0501036_0223815 3300049572 Bacteria 1579
422 Ga0501038_0060688 3300049574 Bacteria 3236
423 Ga0501043_0006913 3300049579 Bacteria 9050
424 Ga0501043_0088309 3300049579 Bacteria 2436
425 Ga0501046_0146570 3300049580 Bacteria 1782
426 Ga0501047_0000661 3300049581 Bacteria 35985
427 Ga0501047_0002041 3300049581 Bacteria 19301
428 Ga0501047_0004052 3300049581 Bacteria 13773
429 Ga0501047_0197437 3300049581 Bacteria 1874
430 Ga0501048_0001321 3300049582 Bacteria 18778
431 Ga0501048_0032734 3300049582 Bacteria 3757
432 Ga0501070_0005341 3300049586 Bacteria 10957
433 Ga0501072_0510886 3300049588 Bacteria 950
434 Ga0501073_0085268 3300049589 Bacteria 2198
435 Ga0501073_0240811 3300049589 Bacteria 1249
436 Ga0501080_0033286 3300049742 Bacteria 4810
437 Ga0501035_0000221 3300049822 Bacteria 67786
438 Ga0501035_0007357 3300049822 Bacteria 10290
439 Ga0501035_0305302 3300049822 Bacteria 1340
440 Ga0501044_0000083 3300049823 Bacteria 114743
441 Ga0501044_0007519 3300049823 Bacteria 11985
442 Ga0501044_0448863 3300049823 Bacteria 1196
443 nmdc:mga03683_35661_c1 3300050489 Bacteria 2018
444 nmdc:mga03n38_13423_c1 3300050490 Bacteria 3111
445 nmdc:mga03n38_256388_c1 3300050490 Bacteria 926
446 nmdc:mga03n38_53619_c1 3300050490 Bacteria 1809
447 nmdc:mga03n38_54003_c1 3300050490 Bacteria 1804
448 nmdc:mga03n38_666_c1 3300050490 Bacteria 8870
449 nmdc:mga03n38_7842_c1 3300050490 Bacteria 3795
450 nmdc:mga00v17_31675_c1 3300050491 Bacteria 3120
451 nmdc:mga00v17_7243_c1 3300050491 Bacteria 5911
452 nmdc:mga0yw44_20026_c1 3300050492 Bacteria 3703
453 nmdc:mga0yw44_239278_c1 3300050492 Bacteria 1206
454 nmdc:mga0yw44_4232_c1 3300050492 Bacteria 6539
455 nmdc:mga0yw44_6496_c1 3300050492 Bacteria 5659
456 nmdc:mga0yw44_75354_c1 3300050492 Bacteria 2103
457 nmdc:mga06z11_64822_c1 3300050494 Bacteria 1916
458 nmdc:mga05p37_74532_c1 3300050507 Bacteria 4177
459 nmdc:mga0qj67_207019_c1 3300050509 Bacteria 1593
460 nmdc:mga06r32_128115_c1 3300050510 Bacteria 2508
461 nmdc:mga0sz30_1396_c1 3300050516 Bacteria 8631
462 nmdc:mga0sz30_17398_c1 3300050516 Bacteria 2866
463 nmdc:mga0sz30_66139_c2 3300050516 Bacteria 1180
464 nmdc:mga0sz30_7819_c1 3300050516 Bacteria 4020
465 Ga0500635_0001043 3300053080 Bacteria 6628
466 Ga0500635_0041949 3300053080 Bacteria 1533
467 Ga0500643_012577 3300053087 Bacteria 3026
468 Ga0500569_100450 3300053109 Bacteria 948
469 Ga0500628_022489 3300053129 Bacteria 1290
470 Ga0500652_000103 3300053131 Bacteria 33562
471 Ga0500568_0051479 3300053139 Bacteria 1620
472 Ga0500627_0008366 3300053158 Bacteria 3670
473 Ga0500645_000071 3300053730 Bacteria 79901
474 Ga0466962_0008904 3300061719 Bacteria 4812
475 Ga0466962_0032133 3300061719 Bacteria 2513
476 Ga0466962_0058068 3300061719 Bacteria 1847

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031995 Ga0307409_100377371 Ga0307409_1003773712 226
2 3300046454 Ga0495592_0034864 Ga0495592_0034864_2202_2945 228
3 3300037418 Ga0395900_0008536 Ga0395900_0008536_7996_8760 230
4 3300037466 Ga0395898_0002054 Ga0395898_0002054_1878_2642 230
5 3300044673 Ga0453683_0001564 Ga0453683_0001564_10242_11006 231
6 3300045051 Ga0451576_0006183 Ga0451576_0006183_13562_14326 231
7 iso_pu_bacteria 2922425934 2922428061 231
8 3300048913 Ga0496110_0312896 Ga0496110_0312896_463_1170 234
9 3300037466 Ga0395898_0768340 Ga0395898_0768340_44_754 235
10 3300046477 Ga0495664_0065472 Ga0495664_0065472_830_1597 236
11 3300046511 Ga0495608_0037816 Ga0495608_0037816_216_983 236
12 3300046517 Ga0495630_0102053 Ga0495630_0102053_377_1144 236
13 3300046529 Ga0495652_0003139 Ga0495652_0003139_13964_14731 236
14 3300046533 Ga0495640_0068171 Ga0495640_0068171_658_1425 236
15 3300046536 Ga0495587_0114878 Ga0495587_0114878_589_1356 236
16 3300046543 Ga0495645_0038945 Ga0495645_0038945_501_1268 236
17 3300046559 Ga0495667_0053623 Ga0495667_0053623_219_986 236
18 3300046675 Ga0495657_0009591 Ga0495657_0009591_4936_5703 236
19 3300046678 Ga0495599_0005989 Ga0495599_0005989_5000_5767 236
20 3300046679 Ga0495623_0029770 Ga0495623_0029770_1588_2355 236
21 3300046680 Ga0495646_0030517 Ga0495646_0030517_176_943 236
22 3300046809 Ga0495600_0008557 Ga0495600_0008557_3265_4032 236
23 3300047317 Ga0495604_0008090 Ga0495604_0008090_5044_5811 236
24 3300047319 Ga0495674_0024251 Ga0495674_0024251_1564_2331 236
25 3300047322 Ga0495680_0035974 Ga0495680_0035974_2771_3538 236
26 3300047444 Ga0495675_0032097 Ga0495675_0032097_890_1657 236
27 3300047471 Ga0495684_0180625 Ga0495684_0180625_710_1477 236
28 3300048088 Ga0495602_0026104 Ga0495602_0026104_4062_4829 236
29 3300048924 Ga0496121_0102636 Ga0496121_0102636_801_1568 236
30 iso_pu_bacteria 8056207758 8056209839 239
31 3300006173 Ga0070716_100223464 Ga0070716_1002234642 241
32 3300044693 Ga0466961_0055836 Ga0466961_0055836_1346_2125 242
33 3300044735 Ga0466968_0018514 Ga0466968_0018514_481_1260 242
34 3300044765 Ga0466970_0006766 Ga0466970_0006766_4066_4845 242
35 3300045049 Ga0466959_0273553 Ga0466959_0273553_36_818 242
36 3300031995 Ga0307409_100100489 Ga0307409_1001004891 243
37 3300025933 Ga0207706_10432627 Ga0207706_104326271 244
38 3300005616 Ga0068852_100431953 Ga0068852_1004319532 247
39 3300026142 Ga0207698_10438787 Ga0207698_104387872 247
40 3300045051 Ga0451576_0000017 Ga0451576_0000017_411047_411793 247
41 3300013306 Ga0163162_10178336 Ga0163162_101783362 248
42 3300048929 Ga0496126_0236577 Ga0496126_0236577_527_1348 248
43 3300050490 nmdc:mga03n38_13423_c1 nmdc:mga03n38_13423_c1_49_795 248
44 3300050516 nmdc:mga0sz30_66139_c2 nmdc:mga0sz30_66139_c2_376_1122 248
45 iso_pu_bacteria 2510917021 2511126218 248
46 iso_pu_bacteria 2882806704 2882806993 248
47 3300003215 JGI25153J46596_10000258 JGI25153J46596_1000025827 249
48 3300025297 Ga0209758_1000087 Ga0209758_1000087216 249
49 3300049588 Ga0501072_0510886 Ga0501072_0510886_82_831 249
50 3300049589 Ga0501073_0085268 Ga0501073_0085268_374_1123 249
51 3300049742 Ga0501080_0033286 Ga0501080_0033286_151_900 249
52 iso_pu_bacteria 2858688981 2858691637 249
53 3300041410 Ga0439461_0073030 Ga0439461_0073030_36_788 250
54 iso_pu_bacteria 2513237096 2513660272 250
55 iso_pu_bacteria 2513237137 2513858431 250
56 iso_pu_bacteria 2513237145 2513919516 250
57 iso_pu_bacteria 2523231044 2523384301 250
58 iso_pu_bacteria 2524023228 2524535845 250
59 iso_pu_bacteria 2547132424 2548695001 250
60 iso_pu_bacteria 2667528175 2671118964 250
61 iso_pu_bacteria 2791355197 2793072224 250
62 iso_pu_bacteria 2881665667 2881668000 250
63 iso_pu_bacteria 2885374607 2885376640 250
64 iso_pu_bacteria 2885409591 2885415588 250
65 iso_pu_bacteria 2903748898 2903758659 250
66 iso_pu_bacteria 2904699407 2904705573 250
67 iso_pu_bacteria 2906610324 2906611251 250
68 iso_pu_bacteria 2906635258 2906641805 250
69 iso_pu_bacteria 2906660503 2906667765 250
70 iso_pu_bacteria 2908739725 2908744777 250
71 iso_pu_bacteria 2935630451 2935632033 250
72 iso_pu_bacteria 2941507105 2941507981 250
73 iso_pu_bacteria 2941515067 2941515514 250
74 iso_pu_bacteria 2941523033 2941523911 250
75 iso_pu_bacteria 3005474847 3005478045 250
76 iso_pu_bacteria 8006933436 8006943158 250
77 iso_pu_bacteria 8006973647 8006982953 250
78 iso_pu_bacteria 8019555841 8019559062 250
79 iso_pu_bacteria 8019565922 8019566241 250
80 3300031456 Ga0307513_10138481 Ga0307513_101384812 251
81 3300049581 Ga0501047_0197437 Ga0501047_0197437_751_1521 251
82 3300005563 Ga0068855_100400609 Ga0068855_1004006092 252
83 3300032005 Ga0307411_10127047 Ga0307411_101270472 252
84 3300044683 Ga0466965_0187584 Ga0466965_0187584_262_1023 252
85 3300044693 Ga0466961_0038617 Ga0466961_0038617_670_1431 252
86 3300044694 Ga0466963_0032255 Ga0466963_0032255_365_1126 252
87 3300045836 Ga0466958_0005616 Ga0466958_0005616_626_1387 252
88 3300045976 Ga0466967_0416025 Ga0466967_0416025_205_966 252
89 3300046500 Ga0495596_0000749 Ga0495596_0000749_17587_18348 252
90 3300046506 Ga0495583_0049862 Ga0495583_0049862_978_1739 252
91 3300046512 Ga0495610_0002681 Ga0495610_0002681_787_1548 252
92 3300046522 Ga0495643_0000945 Ga0495643_0000945_28725_29486 252
93 3300046538 Ga0495609_0006434 Ga0495609_0006434_4519_5280 252
94 3300046692 Ga0495671_0037188 Ga0495671_0037188_569_1330 252
95 3300048090 Ga0495615_0000187 Ga0495615_0000187_449_1210 252
96 3300048914 Ga0496111_0331463 Ga0496111_0331463_111_872 252
97 3300048925 Ga0496122_0020437 Ga0496122_0020437_4970_5731 252
98 3300048926 Ga0496123_0015506 Ga0496123_0015506_494_1255 252
99 3300048928 Ga0496125_0162428 Ga0496125_0162428_388_1149 252
100 3300049822 Ga0501035_0305302 Ga0501035_0305302_456_1217 252
101 3300061719 Ga0466962_0008904 Ga0466962_0008904_2253_3014 252
102 iso_pu_bacteria 8054302542 8054302695 252
103 3300042004 Ga0439445_0033251 Ga0439445_0033251_31_795 253
104 3300042115 Ga0450911_001867 Ga0450911_001867_804_1568 253
105 3300048924 Ga0496121_0038299 Ga0496121_0038299_2376_3140 253
106 3300048927 Ga0496124_0036411 Ga0496124_0036411_857_1621 253
107 3300048928 Ga0496125_0007259 Ga0496125_0007259_9009_9773 253
108 3300048928 Ga0496125_0013064 Ga0496125_0013064_1087_1851 253
109 3300048928 Ga0496125_0050394 Ga0496125_0050394_850_1614 253
110 3300048929 Ga0496126_0085570 Ga0496126_0085570_1879_2643 253
111 3300049571 Ga0501034_0692919 Ga0501034_0692919_71_838 253
112 3300006038 Ga0075365_10167483 Ga0075365_101674832 254
113 3300006353 Ga0075370_10139332 Ga0075370_101393321 254
114 3300033442 Ga0315911_1000027 Ga0315911_100002766 254
115 3300037312 Ga0395899_0135805 Ga0395899_0135805_381_1211 254
116 3300037418 Ga0395900_0538460 Ga0395900_0538460_164_931 254
117 3300037466 Ga0395898_0310056 Ga0395898_0310056_153_920 254
118 3300037471 Ga0395905_0100196 Ga0395905_0100196_1456_2223 254
119 3300037853 Ga0436364_0815004 Ga0436364_0815004_1043_1822 254
120 3300038443 Ga0395901_0518211 Ga0395901_0518211_50_817 254
121 3300044658 Ga0466972_0065509 Ga0466972_0065509_919_1686 254
122 3300044683 Ga0466965_0145003 Ga0466965_0145003_177_944 254
123 3300048909 Ga0496106_0141044 Ga0496106_0141044_79_846 254
124 3300048914 Ga0496111_0459244 Ga0496111_0459244_94_861 254
125 3300048918 Ga0496115_0269300 Ga0496115_0269300_157_924 254
126 3300048924 Ga0496121_0072187 Ga0496121_0072187_1659_2426 254
127 3300048929 Ga0496126_0447806 Ga0496126_0447806_11_778 254
128 3300049569 Ga0501032_0034473 Ga0501032_0034473_939_1712 254
129 3300049570 Ga0501033_0067481 Ga0501033_0067481_927_1694 254
130 3300049579 Ga0501043_0006913 Ga0501043_0006913_376_1149 254
131 3300049580 Ga0501046_0146570 Ga0501046_0146570_928_1701 254
132 3300049581 Ga0501047_0000661 Ga0501047_0000661_608_1381 254
133 3300049582 Ga0501048_0032734 Ga0501048_0032734_1269_2042 254
134 3300049823 Ga0501044_0448863 Ga0501044_0448863_270_1037 254
135 3300050492 nmdc:mga0yw44_239278_c1 nmdc:mga0yw44_239278_c1_204_980 254
136 iso_pu_bacteria 2738541274 2738702153 254
137 iso_pu_bacteria 2738543028 2739331410 254
138 iso_pu_bacteria 2902799365 2902802556 254
139 3300005435 Ga0070714_100125461 Ga0070714_1001254611 255
140 3300013105 Ga0157369_10088982 Ga0157369_100889822 255
141 3300021384 Ga0213876_10046114 Ga0213876_100461143 255
142 3300025928 Ga0207700_10340129 Ga0207700_103401292 255
143 3300025981 Ga0207640_10394888 Ga0207640_103948881 255
144 3300037853 Ga0436364_0913770 Ga0436364_0913770_15577_16344 255
145 3300039437 Ga0436365_1226094 Ga0436365_1226094_1333_2100 255
146 3300039447 Ga0436361_0004060 Ga0436361_0004060_74_841 255
147 3300045976 Ga0466967_0060235 Ga0466967_0060235_1447_2223 255
148 3300048928 Ga0496125_0000571 Ga0496125_0000571_57445_58215 255
149 3300048929 Ga0496126_0023913 Ga0496126_0023913_4434_5204 255
150 3300021384 Ga0213876_10003462 Ga0213876_100034624 256
151 3300021388 Ga0213875_10024634 Ga0213875_100246342 256
152 3300037853 Ga0436364_1325339 Ga0436364_1325339_9047_9841 256
153 3300039437 Ga0436365_0161820 Ga0436365_0161820_17117_17911 256
154 3300044694 Ga0466963_0040270 Ga0466963_0040270_1426_2220 256
155 3300044842 Ga0466957_0024642 Ga0466957_0024642_1174_1959 256
156 3300044901 Ga0466960_0000316 Ga0466960_0000316_12507_13301 256
157 3300045836 Ga0466958_0116190 Ga0466958_0116190_97_891 256
158 3300045976 Ga0466967_0001731 Ga0466967_0001731_3131_3925 256
159 3300046522 Ga0495643_0029065 Ga0495643_0029065_428_1201 256
160 3300048917 Ga0496114_0404147 Ga0496114_0404147_357_1142 256
161 3300048929 Ga0496126_0002449 Ga0496126_0002449_16324_17109 256
162 3300049571 Ga0501034_0015628 Ga0501034_0015628_1668_2528 256
163 3300049581 Ga0501047_0004052 Ga0501047_0004052_2106_2966 256
164 3300049822 Ga0501035_0000221 Ga0501035_0000221_52112_52972 256
165 3300049823 Ga0501044_0000083 Ga0501044_0000083_88405_89265 256
166 3300001977 JGI24746J21847_1001223 JGI24746J21847_10012233 257
167 3300001989 JGI24739J22299_10020106 JGI24739J22299_100201062 257
168 3300002075 JGI24738J21930_10006464 JGI24738J21930_100064642 257
169 3300002077 JGI24744J21845_10006003 JGI24744J21845_100060032 257
170 3300005330 Ga0070690_100030734 Ga0070690_1000307342 257
171 3300005331 Ga0070670_100151939 Ga0070670_1001519394 257
172 3300005334 Ga0068869_100010429 Ga0068869_1000104292 257
173 3300005334 Ga0068869_100020467 Ga0068869_1000204673 257
174 3300005335 Ga0070666_10235508 Ga0070666_102355082 257
175 3300005337 Ga0070682_100004484 Ga0070682_1000044848 257
176 3300005337 Ga0070682_100227302 Ga0070682_1002273022 257
177 3300005338 Ga0068868_100005904 Ga0068868_1000059048 257
178 3300005338 Ga0068868_100031993 Ga0068868_1000319933 257
179 3300005338 Ga0068868_100100744 Ga0068868_1001007442 257
180 3300005341 Ga0070691_10108553 Ga0070691_101085532 257
181 3300005345 Ga0070692_10029731 Ga0070692_100297313 257
182 3300005347 Ga0070668_100017929 Ga0070668_1000179296 257
183 3300005347 Ga0070668_100048178 Ga0070668_1000481783 257
184 3300005353 Ga0070669_100013957 Ga0070669_1000139572 257
185 3300005354 Ga0070675_100114370 Ga0070675_1001143702 257
186 3300005355 Ga0070671_100037796 Ga0070671_1000377963 257
187 3300005355 Ga0070671_100201407 Ga0070671_1002014072 257
188 3300005356 Ga0070674_100000279 Ga0070674_10000027926 257
189 3300005364 Ga0070673_100032847 Ga0070673_1000328472 257
190 3300005365 Ga0070688_100024948 Ga0070688_1000249482 257
191 3300005366 Ga0070659_100146600 Ga0070659_1001466002 257
192 3300005367 Ga0070667_100002372 Ga0070667_10000237219 257
193 3300005367 Ga0070667_100011785 Ga0070667_1000117857 257
194 3300005367 Ga0070667_100144075 Ga0070667_1001440751 257
195 3300005367 Ga0070667_100272992 Ga0070667_1002729921 257
196 3300005434 Ga0070709_10127512 Ga0070709_101275122 257
197 3300005434 Ga0070709_10291230 Ga0070709_102912302 257
198 3300005437 Ga0070710_10198362 Ga0070710_101983622 257
199 3300005438 Ga0070701_10000811 Ga0070701_100008118 257
200 3300005439 Ga0070711_100062393 Ga0070711_1000623932 257
201 3300005440 Ga0070705_100024565 Ga0070705_1000245652 257
202 3300005441 Ga0070700_100000661 Ga0070700_10000066112 257
203 3300005444 Ga0070694_100033743 Ga0070694_1000337433 257
204 3300005456 Ga0070678_100000073 Ga0070678_10000007335 257
205 3300005456 Ga0070678_100118152 Ga0070678_1001181523 257
206 3300005456 Ga0070678_100450289 Ga0070678_1004502891 257
207 3300005457 Ga0070662_100011539 Ga0070662_1000115395 257
208 3300005457 Ga0070662_100271007 Ga0070662_1002710071 257
209 3300005459 Ga0068867_100000103 Ga0068867_10000010339 257
210 3300005459 Ga0068867_100046949 Ga0068867_1000469493 257
211 3300005466 Ga0070685_10005685 Ga0070685_100056857 257
212 3300005466 Ga0070685_10146400 Ga0070685_101464002 257
213 3300005539 Ga0068853_100006446 Ga0068853_1000064467 257
214 3300005539 Ga0068853_100159139 Ga0068853_1001591391 257
215 3300005543 Ga0070672_100067098 Ga0070672_1000670982 257
216 3300005544 Ga0070686_100071637 Ga0070686_1000716373 257
217 3300005545 Ga0070695_100023575 Ga0070695_1000235752 257
218 3300005546 Ga0070696_100020015 Ga0070696_1000200152 257
219 3300005548 Ga0070665_100002596 Ga0070665_10000259619 257
220 3300005548 Ga0070665_100003028 Ga0070665_1000030285 257
221 3300005548 Ga0070665_100068697 Ga0070665_1000686973 257
222 3300005549 Ga0070704_100019247 Ga0070704_1000192474 257
223 3300005563 Ga0068855_100025574 Ga0068855_1000255748 257
224 3300005564 Ga0070664_100499534 Ga0070664_1004995342 257
225 3300005578 Ga0068854_100000290 Ga0068854_10000029032 257
226 3300005578 Ga0068854_100190049 Ga0068854_1001900492 257
227 3300005614 Ga0068856_100645351 Ga0068856_1006453511 257
228 3300005615 Ga0070702_100001458 Ga0070702_10000145814 257
229 3300005615 Ga0070702_100091887 Ga0070702_1000918872 257
230 3300005615 Ga0070702_100097372 Ga0070702_1000973721 257
231 3300005616 Ga0068852_100089675 Ga0068852_1000896752 257
232 3300005616 Ga0068852_100166140 Ga0068852_1001661403 257
233 3300005617 Ga0068859_100007119 Ga0068859_10000711913 257
234 3300005617 Ga0068859_100070780 Ga0068859_1000707802 257
235 3300005618 Ga0068864_100055532 Ga0068864_1000555321 257
236 3300005618 Ga0068864_100149105 Ga0068864_1001491053 257
237 3300005618 Ga0068864_100269836 Ga0068864_1002698363 257
238 3300005718 Ga0068866_10000932 Ga0068866_100009322 257
239 3300005718 Ga0068866_10094818 Ga0068866_100948182 257
240 3300005719 Ga0068861_100000332 Ga0068861_10000033227 257
241 3300005719 Ga0068861_100427991 Ga0068861_1004279912 257
242 3300005841 Ga0068863_100000666 Ga0068863_10000066615 257
243 3300005842 Ga0068858_100000981 Ga0068858_10000098122 257
244 3300005842 Ga0068858_100118357 Ga0068858_1001183572 257
245 3300005843 Ga0068860_100000721 Ga0068860_10000072110 257
246 3300005844 Ga0068862_100001612 Ga0068862_1000016126 257
247 3300005981 Ga0081538_10066186 Ga0081538_100661862 257
248 3300006038 Ga0075365_10001321 Ga0075365_100013218 257
249 3300006038 Ga0075365_10018089 Ga0075365_100180892 257
250 3300006048 Ga0075363_100000957 Ga0075363_1000009577 257
251 3300006048 Ga0075363_100001438 Ga0075363_1000014383 257
252 3300006048 Ga0075363_100009446 Ga0075363_1000094464 257
253 3300006048 Ga0075363_100011815 Ga0075363_1000118154 257
254 3300006048 Ga0075363_100011977 Ga0075363_1000119773 257
255 3300006048 Ga0075363_100013668 Ga0075363_1000136682 257
256 3300006048 Ga0075363_100060193 Ga0075363_1000601932 257
257 3300006048 Ga0075363_100071328 Ga0075363_1000713283 257
258 3300006051 Ga0075364_10005065 Ga0075364_100050654 257
259 3300006051 Ga0075364_10016973 Ga0075364_100169732 257
260 3300006051 Ga0075364_10037541 Ga0075364_100375413 257
261 3300006163 Ga0070715_10014831 Ga0070715_100148311 257
262 3300006173 Ga0070716_100159833 Ga0070716_1001598332 257
263 3300006175 Ga0070712_100001695 Ga0070712_1000016953 257
264 3300006175 Ga0070712_100021645 Ga0070712_1000216454 257
265 3300006177 Ga0075362_10003997 Ga0075362_100039976 257
266 3300006178 Ga0075367_10122809 Ga0075367_101228092 257
267 3300006178 Ga0075367_10291522 Ga0075367_102915221 257
268 3300006186 Ga0075369_10000962 Ga0075369_100009622 257
269 3300006186 Ga0075369_10020687 Ga0075369_100206873 257
270 3300006186 Ga0075369_10031830 Ga0075369_100318303 257
271 3300006353 Ga0075370_10005284 Ga0075370_100052846 257
272 3300006353 Ga0075370_10026117 Ga0075370_100261173 257
273 3300006353 Ga0075370_10028988 Ga0075370_100289884 257
274 3300006844 Ga0075428_100010531 Ga0075428_1000105318 257
275 3300006844 Ga0075428_100777993 Ga0075428_1007779931 257
276 3300006846 Ga0075430_100071615 Ga0075430_1000716154 257
277 3300006847 Ga0075431_100092873 Ga0075431_1000928732 257
278 3300006881 Ga0068865_100000117 Ga0068865_10000011733 257
279 3300006881 Ga0068865_100388959 Ga0068865_1003889591 257
280 3300006931 Ga0097620_100007119 Ga0097620_1000071193 257
281 3300006931 Ga0097620_100070781 Ga0097620_1000707812 257
282 3300009092 Ga0105250_10015853 Ga0105250_100158532 257
283 3300009092 Ga0105250_10023977 Ga0105250_100239773 257
284 3300009098 Ga0105245_10007465 Ga0105245_1000746512 257
285 3300009101 Ga0105247_10000873 Ga0105247_1000087325 257
286 3300009147 Ga0114129_10118452 Ga0114129_101184524 257
287 3300009148 Ga0105243_10001802 Ga0105243_1000180222 257
288 3300009174 Ga0105241_10113831 Ga0105241_101138312 257
289 3300009176 Ga0105242_10000223 Ga0105242_1000022341 257
290 3300009177 Ga0105248_10043513 Ga0105248_100435132 257
291 3300009545 Ga0105237_10146760 Ga0105237_101467602 257
292 3300009551 Ga0105238_10098330 Ga0105238_100983304 257
293 3300009553 Ga0105249_10000191 Ga0105249_1000019128 257
294 3300009553 Ga0105249_10010189 Ga0105249_100101893 257
295 3300010375 Ga0105239_10000928 Ga0105239_100009286 257
296 3300010375 Ga0105239_10256848 Ga0105239_102568482 257
297 3300011119 Ga0105246_10106202 Ga0105246_101062022 257
298 3300011119 Ga0105246_10410776 Ga0105246_104107762 257
299 3300013102 Ga0157371_10099675 Ga0157371_100996752 257
300 3300013105 Ga0157369_10649448 Ga0157369_106494481 257
301 3300013296 Ga0157374_10043142 Ga0157374_100431424 257
302 3300013296 Ga0157374_10334348 Ga0157374_103343482 257
303 3300013297 Ga0157378_10000258 Ga0157378_1000025837 257
304 3300013297 Ga0157378_10582681 Ga0157378_105826811 257
305 3300013306 Ga0163162_10125884 Ga0163162_101258843 257
306 3300013306 Ga0163162_10267483 Ga0163162_102674832 257
307 3300013307 Ga0157372_10006212 Ga0157372_1000621215 257
308 3300013307 Ga0157372_10628019 Ga0157372_106280192 257
309 3300013308 Ga0157375_10006042 Ga0157375_100060422 257
310 3300013308 Ga0157375_10139935 Ga0157375_101399353 257
311 3300014325 Ga0163163_10075154 Ga0163163_100751546 257
312 3300014325 Ga0163163_10259363 Ga0163163_102593632 257
313 3300014325 Ga0163163_10264021 Ga0163163_102640212 257
314 3300014326 Ga0157380_10001005 Ga0157380_100010053 257
315 3300014968 Ga0157379_10002371 Ga0157379_1000237112 257
316 3300014968 Ga0157379_10053500 Ga0157379_100535003 257
317 3300014969 Ga0157376_10037392 Ga0157376_100373922 257
318 3300017792 Ga0163161_10007463 Ga0163161_100074634 257
319 3300021388 Ga0213875_10054829 Ga0213875_100548292 257
320 3300025898 Ga0207692_10119765 Ga0207692_101197651 257
321 3300025899 Ga0207642_10303554 Ga0207642_103035541 257
322 3300025900 Ga0207710_10028410 Ga0207710_100284102 257
323 3300025901 Ga0207688_10002939 Ga0207688_100029393 257
324 3300025901 Ga0207688_10011632 Ga0207688_100116325 257
325 3300025901 Ga0207688_10146903 Ga0207688_101469032 257
326 3300025903 Ga0207680_10059441 Ga0207680_100594412 257
327 3300025903 Ga0207680_10317021 Ga0207680_103170212 257
328 3300025904 Ga0207647_10136931 Ga0207647_101369312 257
329 3300025905 Ga0207685_10024415 Ga0207685_100244152 257
330 3300025905 Ga0207685_10052486 Ga0207685_100524862 257
331 3300025906 Ga0207699_10144399 Ga0207699_101443992 257
332 3300025908 Ga0207643_10113688 Ga0207643_101136882 257
333 3300025914 Ga0207671_10080746 Ga0207671_100807462 257
334 3300025915 Ga0207693_10000302 Ga0207693_1000030242 257
335 3300025915 Ga0207693_10006396 Ga0207693_100063965 257
336 3300025916 Ga0207663_10000841 Ga0207663_1000084117 257
337 3300025919 Ga0207657_10196293 Ga0207657_101962932 257
338 3300025923 Ga0207681_10034711 Ga0207681_100347114 257
339 3300025923 Ga0207681_10066163 Ga0207681_100661632 257
340 3300025926 Ga0207659_10016299 Ga0207659_100162992 257
341 3300025927 Ga0207687_10031648 Ga0207687_100316482 257
342 3300025927 Ga0207687_10043718 Ga0207687_100437182 257
343 3300025928 Ga0207700_10160861 Ga0207700_101608611 257
344 3300025931 Ga0207644_10014311 Ga0207644_100143115 257
345 3300025931 Ga0207644_10087037 Ga0207644_100870372 257
346 3300025933 Ga0207706_10006775 Ga0207706_100067758 257
347 3300025933 Ga0207706_10021060 Ga0207706_100210602 257
348 3300025934 Ga0207686_10003075 Ga0207686_1000307510 257
349 3300025936 Ga0207670_10279990 Ga0207670_102799902 257
350 3300025937 Ga0207669_10011917 Ga0207669_100119173 257
351 3300025938 Ga0207704_10001701 Ga0207704_1000170112 257
352 3300025938 Ga0207704_10629503 Ga0207704_106295031 257
353 3300025939 Ga0207665_10057964 Ga0207665_100579642 257
354 3300025939 Ga0207665_10063728 Ga0207665_100637282 257
355 3300025939 Ga0207665_10197313 Ga0207665_101973131 257
356 3300025940 Ga0207691_10084931 Ga0207691_100849312 257
357 3300025941 Ga0207711_10048955 Ga0207711_100489552 257
358 3300025942 Ga0207689_10012510 Ga0207689_100125105 257
359 3300025944 Ga0207661_10241422 Ga0207661_102414222 257
360 3300025949 Ga0207667_10126312 Ga0207667_101263122 257
361 3300025960 Ga0207651_10105993 Ga0207651_101059932 257
362 3300025972 Ga0207668_10078845 Ga0207668_100788453 257
363 3300025981 Ga0207640_10003005 Ga0207640_100030056 257
364 3300025986 Ga0207658_10006351 Ga0207658_100063518 257
365 3300025986 Ga0207658_10050868 Ga0207658_100508683 257
366 3300025986 Ga0207658_10112636 Ga0207658_101126362 257
367 3300026023 Ga0207677_10047190 Ga0207677_100471902 257
368 3300026023 Ga0207677_10099907 Ga0207677_100999072 257
369 3300026035 Ga0207703_10019039 Ga0207703_100190396 257
370 3300026035 Ga0207703_10022562 Ga0207703_100225624 257
371 3300026035 Ga0207703_10484046 Ga0207703_104840461 257
372 3300026075 Ga0207708_10000461 Ga0207708_1000046122 257
373 3300026075 Ga0207708_10016961 Ga0207708_100169614 257
374 3300026089 Ga0207648_10000139 Ga0207648_1000013945 257
375 3300026089 Ga0207648_10035314 Ga0207648_100353144 257
376 3300026095 Ga0207676_10034886 Ga0207676_100348861 257
377 3300026095 Ga0207676_10262064 Ga0207676_102620642 257
378 3300026095 Ga0207676_10398366 Ga0207676_103983662 257
379 3300026118 Ga0207675_100000106 Ga0207675_10000010638 257
380 3300026118 Ga0207675_100027749 Ga0207675_1000277493 257
381 3300026118 Ga0207675_100199477 Ga0207675_1001994772 257
382 3300026121 Ga0207683_10000296 Ga0207683_100002962 257
383 3300026121 Ga0207683_10099652 Ga0207683_100996523 257
384 3300026142 Ga0207698_10176763 Ga0207698_101767632 257
385 3300028379 Ga0268266_10013936 Ga0268266_100139363 257
386 3300028379 Ga0268266_10135231 Ga0268266_101352312 257
387 3300028379 Ga0268266_10146399 Ga0268266_101463992 257
388 3300028380 Ga0268265_10011081 Ga0268265_100110812 257
389 3300028381 Ga0268264_10387765 Ga0268264_103877652 257
390 3300031824 Ga0307413_10006449 Ga0307413_100064493 257
391 3300031903 Ga0307407_10048436 Ga0307407_100484363 257
392 3300031995 Ga0307409_100180547 Ga0307409_1001805471 257
393 3300032005 Ga0307411_10062615 Ga0307411_100626153 257
394 3300035691 Ga0373931_0038568 Ga0373931_0038568_1410_2216 257
395 3300035691 Ga0373931_0171069 Ga0373931_0171069_420_1193 257
396 3300039437 Ga0436365_1050442 Ga0436365_1050442_3688_4467 257
397 3300039437 Ga0436365_1377767 Ga0436365_1377767_39310_40107 257
398 3300039450 Ga0436363_0790803 Ga0436363_0790803_13_792 257
399 3300041411 Ga0439466_0020404 Ga0439466_0020404_856_1662 257
400 3300041413 Ga0439465_0001843 Ga0439465_0001843_1553_2359 257
401 3300041413 Ga0439465_0002890 Ga0439465_0002890_3478_4305 257
402 3300041997 Ga0439431_0024646 Ga0439431_0024646_349_1122 257
403 3300044656 Ga0466969_0018079 Ga0466969_0018079_1839_2621 257
404 3300044658 Ga0466972_0012005 Ga0466972_0012005_106_879 257
405 3300044658 Ga0466972_0016180 Ga0466972_0016180_687_1460 257
406 3300044658 Ga0466972_0174496 Ga0466972_0174496_163_963 257
407 3300044684 Ga0466966_0020709 Ga0466966_0020709_35_808 257
408 3300044684 Ga0466966_0070445 Ga0466966_0070445_29_811 257
409 3300044693 Ga0466961_0009448 Ga0466961_0009448_38_820 257
410 3300044735 Ga0466968_0021233 Ga0466968_0021233_1392_2213 257
411 3300044765 Ga0466970_0033006 Ga0466970_0033006_1009_1782 257
412 3300044842 Ga0466957_0002695 Ga0466957_0002695_2093_2875 257
413 3300044842 Ga0466957_0083465 Ga0466957_0083465_358_1131 257
414 3300044901 Ga0466960_0100927 Ga0466960_0100927_279_1079 257
415 3300045049 Ga0466959_0035736 Ga0466959_0035736_1776_2558 257
416 3300045049 Ga0466959_0083612 Ga0466959_0083612_532_1305 257
417 3300045836 Ga0466958_0033481 Ga0466958_0033481_812_1594 257
418 3300045976 Ga0466967_0119575 Ga0466967_0119575_925_1716 257
419 3300045976 Ga0466967_0238299 Ga0466967_0238299_679_1476 257
420 3300046460 Ga0495638_0015442 Ga0495638_0015442_2310_3092 257
421 3300046507 Ga0495606_0026524 Ga0495606_0026524_1667_2446 257
422 3300046519 Ga0495632_0197001 Ga0495632_0197001_48_848 257
423 3300046615 Ga0495656_0105524 Ga0495656_0105524_512_1288 257
424 3300046694 Ga0495649_0114587 Ga0495649_0114587_217_1023 257
425 3300047320 Ga0495672_0048999 Ga0495672_0048999_1604_2395 257
426 3300048903 Ga0496100_0000788 Ga0496100_0000788_4785_5591 257
427 3300048903 Ga0496100_0105500 Ga0496100_0105500_347_1120 257
428 3300048903 Ga0496100_0187614 Ga0496100_0187614_589_1428 257
429 3300048904 Ga0496101_0069852 Ga0496101_0069852_639_1445 257
430 3300048904 Ga0496101_0353803 Ga0496101_0353803_278_1051 257
431 3300048905 Ga0496102_0047276 Ga0496102_0047276_2905_3711 257
432 3300048905 Ga0496102_0064165 Ga0496102_0064165_2180_3019 257
433 3300048905 Ga0496102_0066284 Ga0496102_0066284_2464_3285 257
434 3300048905 Ga0496102_0088172 Ga0496102_0088172_163_936 257
435 3300048905 Ga0496102_0099586 Ga0496102_0099586_859_1632 257
436 3300048905 Ga0496102_0198766 Ga0496102_0198766_903_1718 257
437 3300048906 Ga0496103_0065198 Ga0496103_0065198_217_1023 257
438 3300048906 Ga0496103_0118133 Ga0496103_0118133_393_1166 257
439 3300048906 Ga0496103_0160707 Ga0496103_0160707_196_1002 257
440 3300048907 Ga0496104_0046621 Ga0496104_0046621_187_1026 257
441 3300048908 Ga0496105_0432418 Ga0496105_0432418_37_810 257
442 3300048909 Ga0496106_0024206 Ga0496106_0024206_359_1165 257
443 3300048909 Ga0496106_0235489 Ga0496106_0235489_575_1348 257
444 3300048909 Ga0496106_0460389 Ga0496106_0460389_130_909 257
445 3300048910 Ga0496107_0001768 Ga0496107_0001768_11353_12159 257
446 3300048911 Ga0496108_0000811 Ga0496108_0000811_20588_21361 257
447 3300048911 Ga0496108_0115551 Ga0496108_0115551_957_1757 257
448 3300048912 Ga0496109_0007888 Ga0496109_0007888_6192_6992 257
449 3300048912 Ga0496109_0010225 Ga0496109_0010225_2234_3007 257
450 3300048912 Ga0496109_0220549 Ga0496109_0220549_284_1075 257
451 3300048913 Ga0496110_0031326 Ga0496110_0031326_2803_3576 257
452 3300048914 Ga0496111_0054519 Ga0496111_0054519_523_1362 257
453 3300048914 Ga0496111_0155172 Ga0496111_0155172_631_1422 257
454 3300048915 Ga0496112_0075337 Ga0496112_0075337_1154_1954 257
455 3300048915 Ga0496112_0090257 Ga0496112_0090257_1170_1943 257
456 3300048915 Ga0496112_0152900 Ga0496112_0152900_294_1109 257
457 3300048915 Ga0496112_0370137 Ga0496112_0370137_153_944 257
458 3300048916 Ga0496113_0009461 Ga0496113_0009461_750_1541 257
459 3300048916 Ga0496113_0052282 Ga0496113_0052282_258_1049 257
460 3300048916 Ga0496113_0377342 Ga0496113_0377342_61_834 257
461 3300048916 Ga0496113_0584017 Ga0496113_0584017_39_818 257
462 3300048917 Ga0496114_0000374 Ga0496114_0000374_5463_6269 257
463 3300048918 Ga0496115_0000482 Ga0496115_0000482_30211_31017 257
464 3300048918 Ga0496115_0488247 Ga0496115_0488247_174_947 257
465 3300048920 Ga0496117_0161987 Ga0496117_0161987_170_991 257
466 3300048921 Ga0496118_0000652 Ga0496118_0000652_29153_29974 257
467 3300048921 Ga0496118_0061348 Ga0496118_0061348_473_1288 257
468 3300048928 Ga0496125_0091602 Ga0496125_0091602_208_999 257
469 3300048929 Ga0496126_0018862 Ga0496126_0018862_4236_5027 257
470 3300049570 Ga0501033_0090234 Ga0501033_0090234_321_1112 257
471 3300049571 Ga0501034_0004016 Ga0501034_0004016_14223_15014 257
472 3300049571 Ga0501034_0308515 Ga0501034_0308515_192_983 257
473 3300049572 Ga0501036_0223815 Ga0501036_0223815_569_1360 257
474 3300049574 Ga0501038_0060688 Ga0501038_0060688_652_1443 257
475 3300049579 Ga0501043_0088309 Ga0501043_0088309_634_1425 257
476 3300049581 Ga0501047_0002041 Ga0501047_0002041_15953_16744 257
477 3300049582 Ga0501048_0001321 Ga0501048_0001321_15682_16473 257
478 3300049586 Ga0501070_0005341 Ga0501070_0005341_5190_5981 257
479 3300049589 Ga0501073_0240811 Ga0501073_0240811_205_996 257
480 3300049822 Ga0501035_0007357 Ga0501035_0007357_5059_5850 257
481 3300049823 Ga0501044_0007519 Ga0501044_0007519_4957_5748 257
482 3300050489 nmdc:mga03683_35661_c1 nmdc:mga03683_35661_c1_238_1044 257
483 3300050490 nmdc:mga03n38_256388_c1 nmdc:mga03n38_256388_c1_55_828 257
484 3300050490 nmdc:mga03n38_53619_c1 nmdc:mga03n38_53619_c1_656_1456 257
485 3300050490 nmdc:mga03n38_54003_c1 nmdc:mga03n38_54003_c1_873_1646 257
486 3300050490 nmdc:mga03n38_666_c1 nmdc:mga03n38_666_c1_3473_4309 257
487 3300050490 nmdc:mga03n38_7842_c1 nmdc:mga03n38_7842_c1_1806_2606 257
488 3300050491 nmdc:mga00v17_31675_c1 nmdc:mga00v17_31675_c1_1469_2269 257
489 3300050491 nmdc:mga00v17_7243_c1 nmdc:mga00v17_7243_c1_4331_5167 257
490 3300050492 nmdc:mga0yw44_20026_c1 nmdc:mga0yw44_20026_c1_346_1146 257
491 3300050492 nmdc:mga0yw44_4232_c1 nmdc:mga0yw44_4232_c1_1748_2584 257
492 3300050492 nmdc:mga0yw44_6496_c1 nmdc:mga0yw44_6496_c1_1101_1883 257
493 3300050492 nmdc:mga0yw44_75354_c1 nmdc:mga0yw44_75354_c1_41_862 257
494 3300050494 nmdc:mga06z11_64822_c1 nmdc:mga06z11_64822_c1_112_948 257
495 3300050507 nmdc:mga05p37_74532_c1 nmdc:mga05p37_74532_c1_976_1749 257
496 3300050509 nmdc:mga0qj67_207019_c1 nmdc:mga0qj67_207019_c1_188_994 257
497 3300050510 nmdc:mga06r32_128115_c1 nmdc:mga06r32_128115_c1_1295_2068 257
498 3300050516 nmdc:mga0sz30_1396_c1 nmdc:mga0sz30_1396_c1_6759_7565 257
499 3300050516 nmdc:mga0sz30_17398_c1 nmdc:mga0sz30_17398_c1_826_1653 257
500 3300050516 nmdc:mga0sz30_7819_c1 nmdc:mga0sz30_7819_c1_2955_3755 257
501 3300053080 Ga0500635_0001043 Ga0500635_0001043_297_1073 257
502 3300053080 Ga0500635_0041949 Ga0500635_0041949_614_1396 257
503 3300053087 Ga0500643_012577 Ga0500643_012577_1154_1936 257
504 3300053109 Ga0500569_100450 Ga0500569_100450_127_900 257
505 3300053129 Ga0500628_022489 Ga0500628_022489_117_917 257
506 3300053131 Ga0500652_000103 Ga0500652_000103_7293_8069 257
507 3300053139 Ga0500568_0051479 Ga0500568_0051479_77_868 257
508 3300053158 Ga0500627_0008366 Ga0500627_0008366_711_1493 257
509 3300053730 Ga0500645_000071 Ga0500645_000071_38984_39775 257
510 3300061719 Ga0466962_0032133 Ga0466962_0032133_132_953 257
511 3300061719 Ga0466962_0058068 Ga0466962_0058068_750_1523 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

31

276

0.93

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

36

210

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qxi-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase echa1 from mycobacterium marinum 0.9951 8 257
3qxi-assembly1.cif.gz_C crystal structure of enoyl-coa hydratase echa1 from mycobacterium marinum 0.9937 7 257
5kjp-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis h37rv 0.9935 7 257
3qxi-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase echa1 from mycobacterium marinum 0.987 8 257
3qxi-assembly1.cif.gz_C crystal structure of enoyl-coa hydratase echa1 from mycobacterium marinum 0.9859 7 257
ID Description Score Start End Superfamily
af_P96404_205_262_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 1.011 200 257 1.10.12.10
3trrC02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 1.004 200 257 1.10.12.10
3trrB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 1.002 200 257 1.10.12.10
3qxiC02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9995 200 257 1.10.12.10
3qxiA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9994 200 257 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A329MGB1-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9977 10 257 GO:0004300
GO:0006631
AF-A0A3G8JKJ5-F1-model_v4 Carnitinyl-CoA dehydratase (EC 4.2.1.149) 0.9976 7 257 GO:0004300
GO:0006631
AF-A0A7G8PP55-F1-model_v4 Crotonase/enoyl-CoA hydratase family protein 0.9969 7 257 GO:0004300
GO:0006631
AF-A0A1X0ASQ8-F1-model_v4 Enoyl-CoA hydratase 0.9961 7 257 GO:0004300
GO:0006631
AF-A0A7J5X3V6-F1-model_v4 Carnitinyl-CoA dehydratase (EC 4.2.1.149) 0.996 7 257 GO:0004300
GO:0006631

Feature Viewer

pLDDT pTM Quality
95.37 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map