F457303

General Info

Members Datasets Scaffolds Average Seq Length
511 188 511 128

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10107873|Ga0265760_101078732
Length 145
Sequence MPGLPPHGRNGTLKYMYEDFHVTDRWSGEDLHCRWKGTIVAIATRHADAVDIRFDVNGRPMWIALPCTARIEQKKRTGKVITDQLAAQVAGRYLKQMVEEGYDSRREICTMTAAEVMDHLDAVVAEVKTLGEMPALPVGPSQLAT

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
127 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300030886 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
188 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 2.74
Rhizosphere 96.48
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10259217 3300003320 Bacteria 3253
2 Ga0070658_10038607 3300005327 Bacteria 3850
3 Ga0070658_10068767 3300005327 Bacteria 2896
4 Ga0070658_10168156 3300005327 Bacteria 1841
5 Ga0070658_10335837 3300005327 Unclassified 1292
6 Ga0070683_100003661 3300005329 Bacteria 12527
7 Ga0070683_100023173 3300005329 Bacteria 5552
8 Ga0070683_100082023 3300005329 Bacteria 3020
9 Ga0070683_100318617 3300005329 Unclassified 1480
10 Ga0070683_100668300 3300005329 Bacteria 995
11 Ga0070670_100011436 3300005331 Bacteria 7591
12 Ga0068869_100003216 3300005334 Bacteria 9983
13 Ga0068869_100231122 3300005334 Bacteria 1469
14 Ga0070666_10085013 3300005335 Bacteria 2166
15 Ga0070666_10197581 3300005335 Bacteria 1414
16 Ga0070680_100138835 3300005336 Bacteria 2037
17 Ga0070682_101117474 3300005337 Unclassified 661
18 Ga0068868_100004466 3300005338 Bacteria 9814
19 Ga0068868_100073799 3300005338 Bacteria 2724
20 Ga0068868_100107424 3300005338 Bacteria 2265
21 Ga0068868_100191325 3300005338 Bacteria 1702
22 Ga0070660_100020527 3300005339 Bacteria 4856
23 Ga0070660_100549114 3300005339 Unclassified 964
24 Ga0070661_100002519 3300005344 Bacteria 12543
25 Ga0070661_100154192 3300005344 Unclassified 1737
26 Ga0070661_100215761 3300005344 Bacteria 1470
27 Ga0070668_100142494 3300005347 Bacteria 1932
28 Ga0070669_101333603 3300005353 Unclassified 622
29 Ga0070675_100072927 3300005354 Bacteria 2850
30 Ga0070671_100009025 3300005355 Bacteria 8001
31 Ga0070671_100039285 3300005355 Bacteria 3928
32 Ga0070671_100353683 3300005355 Bacteria 1254
33 Ga0070673_100019733 3300005364 Unclassified 4845
34 Ga0070667_100006069 3300005367 Bacteria 10032
35 Ga0070667_100236908 3300005367 Bacteria 1628
36 Ga0070709_10341318 3300005434 Unclassified 1104
37 Ga0070714_100177077 3300005435 Bacteria 1938
38 Ga0070714_100465770 3300005435 Unclassified 1202
39 Ga0070713_100177736 3300005436 Bacteria 1911
40 Ga0070713_100278194 3300005436 Unclassified 1535
41 Ga0070713_101772984 3300005436 Unclassified 599
42 Ga0070711_100019101 3300005439 Unclassified 4391
43 Ga0070711_101569846 3300005439 Unclassified 575
44 Ga0070678_100142197 3300005456 Bacteria 1921
45 Ga0070662_100027879 3300005457 Unclassified 3927
46 Ga0070681_10019326 3300005458 Bacteria 6819
47 Ga0070681_10137763 3300005458 Unclassified 2371
48 Ga0068867_100130243 3300005459 Bacteria 1954
49 Ga0070685_10921262 3300005466 Bacteria 651
50 Ga0070679_100032485 3300005530 Bacteria 5163
51 Ga0070684_100003842 3300005535 Bacteria 11359
52 Ga0070684_100160896 3300005535 Unclassified 2037
53 Ga0070684_100247222 3300005535 Bacteria 1630
54 Ga0070684_100622855 3300005535 Bacteria 1004
55 Ga0068853_100022945 3300005539 Bacteria 5218
56 Ga0068853_100030968 3300005539 Unclassified 4522
57 Ga0068853_100031341 3300005539 Bacteria 4497
58 Ga0068853_100319351 3300005539 Bacteria 1439
59 Ga0068853_100664135 3300005539 Unclassified 993
60 Ga0068853_100746356 3300005539 Unclassified 935
61 Ga0070693_101149761 3300005547 Unclassified 594
62 Ga0070665_100126242 3300005548 Bacteria 2561
63 Ga0070665_101149255 3300005548 Unclassified 787
64 Ga0070665_101550821 3300005548 Unclassified 670
65 Ga0068855_100002968 3300005563 Bacteria 20742
66 Ga0068855_100035738 3300005563 Bacteria 5918
67 Ga0068855_100045474 3300005563 Bacteria 5193
68 Ga0068855_100047658 3300005563 Bacteria 5062
69 Ga0068855_100107739 3300005563 Bacteria 3201
70 Ga0068855_100161894 3300005563 Bacteria 2539
71 Ga0068855_100298203 3300005563 Bacteria 1785
72 Ga0068855_100328805 3300005563 Bacteria 1688
73 Ga0070664_100096410 3300005564 Unclassified 2567
74 Ga0070664_100168478 3300005564 Bacteria 1942
75 Ga0070664_100647868 3300005564 Unclassified 982
76 Ga0068857_100116876 3300005577 Bacteria 2400
77 Ga0068857_100655077 3300005577 Bacteria 995
78 Ga0068857_100659866 3300005577 Bacteria 992
79 Ga0068857_101124895 3300005577 Unclassified 759
80 Ga0068854_100034049 3300005578 Bacteria 3555
81 Ga0068854_100034137 3300005578 Unclassified 3551
82 Ga0068854_101299955 3300005578 Bacteria 655
83 Ga0068856_100007441 3300005614 Bacteria 10687
84 Ga0068856_100012724 3300005614 Bacteria 8147
85 Ga0068856_100019296 3300005614 Bacteria 6618
86 Ga0068856_100021487 3300005614 Bacteria 6272
87 Ga0068856_100061204 3300005614 Unclassified 3718
88 Ga0068856_100132768 3300005614 Bacteria 2495
89 Ga0068856_100363217 3300005614 Bacteria 1466
90 Ga0068856_100560084 3300005614 Bacteria 1164
91 Ga0068852_100000008 3300005616 Bacteria 154351
92 Ga0068852_100031931 3300005616 Unclassified 4354
93 Ga0068852_100055821 3300005616 Bacteria 3410
94 Ga0068852_100057683 3300005616 Bacteria 3360
95 Ga0068852_100525205 3300005616 Bacteria 1181
96 Ga0068852_100534806 3300005616 Unclassified 1171
97 Ga0068852_100540423 3300005616 Bacteria 1165
98 Ga0068852_100824308 3300005616 Unclassified 943
99 Ga0068859_100013030 3300005617 Bacteria 8354
100 Ga0068859_100186686 3300005617 Bacteria 2157
101 Ga0068859_100439384 3300005617 Bacteria 1401
102 Ga0068864_100003655 3300005618 Bacteria 12715
103 Ga0068864_100066418 3300005618 Bacteria 3131
104 Ga0068851_10015368 3300005834 Unclassified 3647
105 Ga0068851_10023459 3300005834 Unclassified 3016
106 Ga0068851_10031901 3300005834 Bacteria 2619
107 Ga0068863_100006990 3300005841 Bacteria 11064
108 Ga0068863_100677739 3300005841 Bacteria 1024
109 Ga0068858_100011675 3300005842 Bacteria 8283
110 Ga0068860_100008207 3300005843 Bacteria 10394
111 Ga0068860_100373389 3300005843 Bacteria 1407
112 Ga0070717_10259320 3300006028 Unclassified 1538
113 Ga0070717_10348851 3300006028 Bacteria 1323
114 Ga0070712_101286605 3300006175 Unclassified 637
115 Ga0097621_100011540 3300006237 Bacteria 6511
116 Ga0097621_100078216 3300006237 Bacteria 2748
117 Ga0097621_100274712 3300006237 Unclassified 1482
118 Ga0068871_100014319 3300006358 Bacteria 5909
119 Ga0068871_100019727 3300006358 Bacteria 5152
120 Ga0068871_100234523 3300006358 Unclassified 1594
121 Ga0068871_101186388 3300006358 Bacteria 716
122 Ga0068865_100086041 3300006881 Bacteria 2269
123 Ga0097620_100013030 3300006931 Bacteria 8354
124 Ga0097620_100186676 3300006931 Bacteria 2157
125 Ga0097620_100439380 3300006931 Bacteria 1401
126 Ga0105240_10000038 3300009093 Bacteria 270341
127 Ga0105240_10004578 3300009093 Bacteria 20971
128 Ga0105240_10006252 3300009093 Bacteria 17518
129 Ga0105240_10014758 3300009093 Bacteria 10653
130 Ga0105240_10015263 3300009093 Bacteria 10452
131 Ga0105240_10044350 3300009093 Bacteria 5651
132 Ga0105240_10139228 3300009093 Bacteria 2903
133 Ga0105240_10207492 3300009093 Bacteria 2292
134 Ga0105240_10374164 3300009093 Bacteria 1610
135 Ga0105240_11204664 3300009093 Unclassified 802
136 Ga0105245_10007487 3300009098 Bacteria 9566
137 Ga0105245_10010388 3300009098 Bacteria 8108
138 Ga0105247_10002658 3300009101 Bacteria 12031
139 Ga0105247_11095661 3300009101 Unclassified 628
140 Ga0105243_11576459 3300009148 Unclassified 682
141 Ga0105241_10000665 3300009174 Bacteria 25833
142 Ga0105241_10000681 3300009174 Bacteria 25610
143 Ga0105241_10001076 3300009174 Bacteria 20821
144 Ga0105241_10019873 3300009174 Unclassified 4957
145 Ga0105241_10020166 3300009174 Bacteria 4924
146 Ga0105241_10058170 3300009174 Bacteria 2968
147 Ga0105241_10200417 3300009174 Bacteria 1667
148 Ga0105242_10073052 3300009176 Bacteria 2851
149 Ga0105248_10000002 3300009177 Bacteria 1054120
150 Ga0105248_10010400 3300009177 Bacteria 10248
151 Ga0105248_10035969 3300009177 Bacteria 5539
152 Ga0105248_10146215 3300009177 Unclassified 2667
153 Ga0105248_10173779 3300009177 Bacteria 2428
154 Ga0105248_10629174 3300009177 Unclassified 1211
155 Ga0105237_10010929 3300009545 Bacteria 9631
156 Ga0105237_10040238 3300009545 Unclassified 4714
157 Ga0105237_10746641 3300009545 Unclassified 985
158 Ga0105238_10001545 3300009551 Bacteria 23074
159 Ga0105238_10008433 3300009551 Bacteria 10316
160 Ga0105238_10014811 3300009551 Bacteria 7888
161 Ga0105238_10037668 3300009551 Unclassified 4915
162 Ga0105238_10052925 3300009551 Bacteria 4081
163 Ga0105238_10131254 3300009551 Unclassified 2483
164 Ga0105238_10198613 3300009551 Unclassified 1981
165 Ga0105238_10239634 3300009551 Bacteria 1791
166 Ga0105238_10464206 3300009551 Unclassified 1264
167 Ga0105249_10030705 3300009553 Bacteria 4858
168 Ga0105239_10014728 3300010375 Bacteria 8673
169 Ga0105239_10019723 3300010375 Bacteria 7442
170 Ga0105239_10184093 3300010375 Unclassified 2337
171 Ga0105239_10408997 3300010375 Bacteria 1536
172 Ga0105239_10876656 3300010375 Unclassified 1030
173 Ga0105239_10882047 3300010375 Bacteria 1027
174 Ga0105239_13563295 3300010375 Unclassified 506
175 Ga0105246_10001968 3300011119 Bacteria 12387
176 Ga0105246_11907065 3300011119 Unclassified 571
177 Ga0157373_10567442 3300013100 Bacteria 824
178 Ga0157371_10153190 3300013102 Bacteria 1644
179 Ga0157371_10205993 3300013102 Bacteria 1411
180 Ga0157370_10000130 3300013104 Bacteria 89817
181 Ga0157370_10015998 3300013104 Bacteria 7609
182 Ga0157370_10425868 3300013104 Bacteria 1221
183 Ga0157370_10750753 3300013104 Bacteria 889
184 Ga0157369_10000058 3300013105 Bacteria 154342
185 Ga0157369_10012152 3300013105 Bacteria 9773
186 Ga0157369_10064147 3300013105 Unclassified 3956
187 Ga0157369_10064896 3300013105 Bacteria 3931
188 Ga0157369_10099530 3300013105 Bacteria 3099
189 Ga0157369_10189432 3300013105 Bacteria 2162
190 Ga0157369_10200004 3300013105 Bacteria 2098
191 Ga0157369_10268912 3300013105 Bacteria 1777
192 Ga0157369_10713385 3300013105 Bacteria 1032
193 Ga0157369_10980432 3300013105 Bacteria 866
194 Ga0157369_11872557 3300013105 Unclassified 609
195 Ga0157374_10023480 3300013296 Bacteria 5516
196 Ga0157374_10027506 3300013296 Bacteria 5132
197 Ga0157374_10032060 3300013296 Unclassified 4782
198 Ga0157374_10043855 3300013296 Unclassified 4133
199 Ga0157374_10145485 3300013296 Bacteria 2302
200 Ga0157374_10623665 3300013296 Bacteria 1089
201 Ga0157374_11147104 3300013296 Unclassified 798
202 Ga0157374_12255117 3300013296 Unclassified 572
203 Ga0157378_10008138 3300013297 Bacteria 9152
204 Ga0157378_10015620 3300013297 Bacteria 6649
205 Ga0157378_10036668 3300013297 Bacteria 4339
206 Ga0157378_10086253 3300013297 Bacteria 2846
207 Ga0163162_10085169 3300013306 Bacteria 3237
208 Ga0163162_12781073 3300013306 Bacteria 563
209 Ga0157372_10000163 3300013307 Bacteria 73216
210 Ga0157372_10011258 3300013307 Bacteria 9513
211 Ga0157372_10012805 3300013307 Bacteria 8938
212 Ga0157372_10012883 3300013307 Bacteria 8916
213 Ga0157372_10019408 3300013307 Bacteria 7328
214 Ga0157372_10021732 3300013307 Bacteria 6935
215 Ga0157372_10089695 3300013307 Unclassified 3494
216 Ga0157372_10177782 3300013307 Unclassified 2463
217 Ga0157372_10200319 3300013307 Bacteria 2312
218 Ga0157372_10224636 3300013307 Bacteria 2177
219 Ga0157372_10797782 3300013307 Bacteria 1097
220 Ga0157372_12365407 3300013307 Unclassified 610
221 Ga0157375_10007951 3300013308 Bacteria 9286
222 Ga0157375_10013466 3300013308 Bacteria 7281
223 Ga0157375_10157575 3300013308 Bacteria 2410
224 Ga0157375_12750287 3300013308 Unclassified 588
225 Ga0163163_10025668 3300014325 Bacteria 5618
226 Ga0157379_10007000 3300014968 Bacteria 9749
227 Ga0157379_10489113 3300014968 Bacteria 1139
228 Ga0157379_10807002 3300014968 Unclassified 886
229 Ga0157376_10015967 3300014969 Bacteria 5690
230 Ga0157376_10047177 3300014969 Bacteria 3555
231 Ga0157376_10149816 3300014969 Bacteria 2103
232 Ga0157376_10152097 3300014969 Unclassified 2088
233 Ga0157376_10635544 3300014969 Bacteria 1066
234 Ga0157376_11161798 3300014969 Bacteria 799
235 Ga0163161_10040911 3300017792 Bacteria 3330
236 Ga0213872_10001792 3300021361 Bacteria 13393
237 Ga0213872_10002841 3300021361 Bacteria 9899
238 Ga0213872_10079404 3300021361 Bacteria 1475
239 Ga0207656_10005299 3300025321 Bacteria 4551
240 Ga0207656_10008759 3300025321 Bacteria 3739
241 Ga0207656_10011154 3300025321 Unclassified 3388
242 Ga0207656_10038051 3300025321 Bacteria 2028
243 Ga0207656_10193778 3300025321 Bacteria 979
244 Ga0207710_10002857 3300025900 Bacteria 7862
245 Ga0207680_10041900 3300025903 Bacteria 2675
246 Ga0207699_10271367 3300025906 Unclassified 1176
247 Ga0207705_10028165 3300025909 Bacteria 4006
248 Ga0207705_10083942 3300025909 Bacteria 2325
249 Ga0207705_10220592 3300025909 Bacteria 1440
250 Ga0207705_10460611 3300025909 Bacteria 986
251 Ga0207654_10000017 3300025911 Bacteria 201589
252 Ga0207654_10000082 3300025911 Bacteria 62524
253 Ga0207654_10000895 3300025911 Bacteria 16506
254 Ga0207654_10147320 3300025911 Bacteria 1508
255 Ga0207654_10316105 3300025911 Unclassified 1066
256 Ga0207707_10074397 3300025912 Bacteria 2963
257 Ga0207707_10110329 3300025912 Bacteria 2404
258 Ga0207707_10229093 3300025912 Bacteria 1617
259 Ga0207695_10000070 3300025913 Bacteria 318111
260 Ga0207695_10000174 3300025913 Bacteria 189006
261 Ga0207695_10003923 3300025913 Bacteria 20590
262 Ga0207695_10037092 3300025913 Bacteria 5262
263 Ga0207695_10134911 3300025913 Bacteria 2422
264 Ga0207695_10156609 3300025913 Bacteria 2212
265 Ga0207695_10235764 3300025913 Bacteria 1732
266 Ga0207695_11175126 3300025913 Unclassified 647
267 Ga0207671_10001928 3300025914 Bacteria 23011
268 Ga0207671_10040556 3300025914 Unclassified 3447
269 Ga0207671_10460123 3300025914 Unclassified 1014
270 Ga0207671_10697158 3300025914 Bacteria 808
271 Ga0207663_10032410 3300025916 Unclassified 3102
272 Ga0207660_10013847 3300025917 Bacteria 5293
273 Ga0207660_10096672 3300025917 Bacteria 2199
274 Ga0207657_10024765 3300025919 Bacteria 5548
275 Ga0207649_10030086 3300025920 Unclassified 3213
276 Ga0207649_10171970 3300025920 Bacteria 1510
277 Ga0207649_10771448 3300025920 Bacteria 749
278 Ga0207649_10930996 3300025920 Unclassified 682
279 Ga0207652_10022004 3300025921 Bacteria 5268
280 Ga0207694_10000659 3300025924 Bacteria 31111
281 Ga0207694_10001331 3300025924 Bacteria 21248
282 Ga0207694_10016801 3300025924 Bacteria 5529
283 Ga0207694_10211632 3300025924 Bacteria 1579
284 Ga0207694_10400945 3300025924 Bacteria 1140
285 Ga0207650_10001748 3300025925 Bacteria 15441
286 Ga0207650_10154330 3300025925 Bacteria 1814
287 Ga0207659_10056623 3300025926 Unclassified 2809
288 Ga0207687_10036015 3300025927 Bacteria 3369
289 Ga0207687_10071575 3300025927 Unclassified 2478
290 Ga0207687_10198829 3300025927 Bacteria 1565
291 Ga0207700_10229392 3300025928 Unclassified 1578
292 Ga0207700_10342768 3300025928 Unclassified 1300
293 Ga0207700_11704447 3300025928 Unclassified 556
294 Ga0207664_10003577 3300025929 Bacteria 10388
295 Ga0207644_10009194 3300025931 Bacteria 6481
296 Ga0207644_11241567 3300025931 Unclassified 626
297 Ga0207706_10008241 3300025933 Bacteria 9618
298 Ga0207686_10455769 3300025934 Bacteria 985
299 Ga0207686_10624897 3300025934 Unclassified 850
300 Ga0207704_11913313 3300025938 Unclassified 510
301 Ga0207711_10000052 3300025941 Bacteria 138437
302 Ga0207711_10024143 3300025941 Bacteria 5089
303 Ga0207711_10040684 3300025941 Unclassified 3955
304 Ga0207711_10119110 3300025941 Bacteria 2355
305 Ga0207711_10130375 3300025941 Bacteria 2254
306 Ga0207689_10006930 3300025942 Bacteria 9966
307 Ga0207689_10049062 3300025942 Unclassified 3483
308 Ga0207661_10017167 3300025944 Bacteria 5351
309 Ga0207661_10166306 3300025944 Unclassified 1917
310 Ga0207679_10081207 3300025945 Unclassified 2478
311 Ga0207679_10235354 3300025945 Unclassified 1549
312 Ga0207679_10383307 3300025945 Bacteria 1233
313 Ga0207667_10002340 3300025949 Bacteria 23738
314 Ga0207667_10073640 3300025949 Unclassified 3549
315 Ga0207667_10110297 3300025949 Unclassified 2839
316 Ga0207667_10174463 3300025949 Unclassified 2209
317 Ga0207667_10177453 3300025949 Bacteria 2188
318 Ga0207667_10223351 3300025949 Unclassified 1930
319 Ga0207667_10241333 3300025949 Bacteria 1849
320 Ga0207667_11643308 3300025949 Unclassified 610
321 Ga0207712_10083027 3300025961 Bacteria 2337
322 Ga0207668_10535709 3300025972 Unclassified 1012
323 Ga0207640_10070022 3300025981 Unclassified 2357
324 Ga0207640_10697852 3300025981 Bacteria 870
325 Ga0207658_10004337 3300025986 Bacteria 9871
326 Ga0207658_10311151 3300025986 Bacteria 1360
327 Ga0207677_10001151 3300026023 Bacteria 14443
328 Ga0207677_10154089 3300026023 Bacteria 1777
329 Ga0207677_10305316 3300026023 Viruses 1316
330 Ga0207677_11377397 3300026023 Bacteria 649
331 Ga0207703_10009852 3300026035 Bacteria 7496
332 Ga0207703_10572713 3300026035 Unclassified 1066
333 Ga0207639_10000321 3300026041 Bacteria 33491
334 Ga0207678_10128855 3300026067 Unclassified 2158
335 Ga0207678_10183060 3300026067 Unclassified 1789
336 Ga0207702_10012838 3300026078 Bacteria 6970
337 Ga0207702_10013154 3300026078 Bacteria 6881
338 Ga0207702_10150668 3300026078 Unclassified 2115
339 Ga0207702_10468038 3300026078 Bacteria 1225
340 Ga0207641_10192421 3300026088 Bacteria 1875
341 Ga0207648_10432785 3300026089 Bacteria 1196
342 Ga0207676_10007155 3300026095 Bacteria 7904
343 Ga0207676_11057674 3300026095 Unclassified 801
344 Ga0207674_10005713 3300026116 Bacteria 14745
345 Ga0207674_10016243 3300026116 Bacteria 8155
346 Ga0207674_10230376 3300026116 Bacteria 1800
347 Ga0207674_10797893 3300026116 Bacteria 911
348 Ga0207683_10000420 3300026121 Bacteria 39141
349 Ga0207698_10000010 3300026142 Bacteria 270583
350 Ga0207698_10054660 3300026142 Unclassified 3073
351 Ga0207698_10117170 3300026142 Unclassified 2246
352 Ga0207698_10152841 3300026142 Bacteria 2006
353 Ga0207698_10235648 3300026142 Bacteria 1664
354 Ga0207698_10260228 3300026142 Bacteria 1594
355 Ga0207698_10374624 3300026142 Bacteria 1352
356 Ga0207698_10732940 3300026142 Bacteria 986
357 Ga0207698_11954250 3300026142 Unclassified 601
358 Ga0268266_10005831 3300028379 Bacteria 11396
359 Ga0268266_10045442 3300028379 Bacteria 3757
360 Ga0268266_10094874 3300028379 Bacteria 2620
361 Ga0268264_10002796 3300028381 Bacteria 15247
362 Ga0268264_11155306 3300028381 Unclassified 783
363 Ga0265326_10049309 3300028558 Bacteria 1193
364 Ga0265334_10035315 3300028573 Bacteria 1979
365 Ga0265336_10007088 3300028666 Bacteria 4004
366 Ga0265336_10012533 3300028666 Bacteria 2851
367 Ga0265338_10006247 3300028800 Bacteria 15251
368 Ga0265338_10019942 3300028800 Bacteria 7079
369 Ga0265338_10021824 3300028800 Bacteria 6655
370 Ga0265338_10088737 3300028800 Bacteria 2564
371 Ga0265338_10097447 3300028800 Bacteria 2409
372 Ga0265338_10142208 3300028800 Bacteria 1878
373 Ga0265338_10204910 3300028800 Bacteria 1485
374 Ga0265324_10012090 3300029957 Bacteria 3267
375 Ga0265770_1029432 3300030878 Unclassified 912
376 Ga0265772_106806 3300030886 Bacteria 530
377 Ga0265760_10021362 3300031090 Bacteria 1873
378 Ga0265760_10107873 3300031090 Bacteria 885
379 Ga0265330_10000172 3300031235 Bacteria 50542
380 Ga0265330_10001580 3300031235 Bacteria 13073
381 Ga0265330_10031365 3300031235 Bacteria 2382
382 Ga0265330_10067153 3300031235 Bacteria 1554
383 Ga0265330_10101184 3300031235 Bacteria 1234
384 Ga0265330_10282509 3300031235 Unclassified 699
385 Ga0265332_10010081 3300031238 Bacteria 4207
386 Ga0265332_10092042 3300031238 Bacteria 1282
387 Ga0265328_10008887 3300031239 Unclassified 4119
388 Ga0265328_10012131 3300031239 Bacteria 3432
389 Ga0265328_10013120 3300031239 Bacteria 3287
390 Ga0265328_10048554 3300031239 Bacteria 1559
391 Ga0265320_10051420 3300031240 Bacteria 1999
392 Ga0265325_10003754 3300031241 Bacteria 9811
393 Ga0265325_10004411 3300031241 Bacteria 8898
394 Ga0265325_10018680 3300031241 Unclassified 3844
395 Ga0265325_10019364 3300031241 Unclassified 3763
396 Ga0265325_10124953 3300031241 Bacteria 1237
397 Ga0265325_10165150 3300031241 Unclassified 1039
398 Ga0265325_10284126 3300031241 Bacteria 741
399 Ga0265329_10011322 3300031242 Bacteria 3244
400 Ga0265340_10003518 3300031247 Bacteria 8815
401 Ga0265340_10026746 3300031247 Unclassified 2914
402 Ga0265340_10032012 3300031247 Bacteria 2627
403 Ga0265340_10032473 3300031247 Bacteria 2606
404 Ga0265340_10051931 3300031247 Bacteria 1984
405 Ga0265339_10000031 3300031249 Bacteria 133838
406 Ga0265339_10005934 3300031249 Bacteria 8077
407 Ga0265339_10007287 3300031249 Bacteria 7166
408 Ga0265339_10023453 3300031249 Bacteria 3566
409 Ga0265339_10027679 3300031249 Bacteria 3230
410 Ga0265339_10058400 3300031249 Unclassified 2083
411 Ga0265339_10068832 3300031249 Unclassified 1890
412 Ga0265339_10330589 3300031249 Bacteria 721
413 Ga0265331_10042194 3300031250 Bacteria 2214
414 Ga0265331_10180222 3300031250 Bacteria 954
415 Ga0265331_10336113 3300031250 Unclassified 676
416 Ga0265316_10001478 3300031344 Bacteria 25174
417 Ga0265316_10001571 3300031344 Bacteria 24414
418 Ga0265316_10013991 3300031344 Bacteria 7095
419 Ga0265316_10015528 3300031344 Bacteria 6654
420 Ga0265316_10018238 3300031344 Bacteria 6036
421 Ga0265316_10063695 3300031344 Unclassified 2858
422 Ga0265316_10066135 3300031344 Unclassified 2798
423 Ga0265316_10155951 3300031344 Bacteria 1709
424 Ga0265316_10185688 3300031344 Bacteria 1547
425 Ga0265316_10214995 3300031344 Bacteria 1420
426 Ga0265316_10215954 3300031344 Unclassified 1417
427 Ga0265316_10308416 3300031344 Unclassified 1152
428 Ga0265316_10534448 3300031344 Unclassified 835
429 Ga0265313_10011588 3300031595 Bacteria 5468
430 Ga0265313_10076917 3300031595 Bacteria 1524
431 Ga0265313_10198748 3300031595 Bacteria 835
432 Ga0265314_10005019 3300031711 Bacteria 12060
433 Ga0265314_10083504 3300031711 Bacteria 2099
434 Ga0265314_10454931 3300031711 Bacteria 681
435 Ga0265342_10000067 3300031712 Bacteria 111040
436 Ga0265342_10003291 3300031712 Bacteria 13373
437 Ga0265342_10004816 3300031712 Bacteria 10471
438 Ga0265342_10038259 3300031712 Bacteria 2922
439 Ga0265342_10068504 3300031712 Bacteria 2074
440 Ga0265342_10087277 3300031712 Bacteria 1792
441 Ga0265342_10106858 3300031712 Bacteria 1588
442 Ga0265342_10588379 3300031712 Bacteria 562
443 Ga0265342_10679540 3300031712 Bacteria 515
444 Ga0373954_0024368 3300035118 Bacteria 2759
445 Ga0373933_0383634 3300035724 Bacteria 915
446 Ga0373937_0037339 3300036401 Bacteria 4427
447 Ga0373937_0073358 3300036401 Bacteria 3157
448 Ga0373925_0733731 3300037068 Unclassified 814
449 Ga0395900_0453530 3300037418 Bacteria 1238
450 Ga0395898_0291623 3300037466 Unclassified 1556
451 Ga0395898_0823569 3300037466 Unclassified 868
452 Ga0395901_0189068 3300038443 Bacteria 2160
453 Ga0395901_0957844 3300038443 Unclassified 834
454 Ga0436360_0149301 3300039438 Unclassified 1097
455 Ga0436360_0252798 3300039438 Unclassified 657
456 Ga0436360_0518538 3300039438 Bacteria 5286
457 Ga0436360_0855957 3300039438 Unclassified 693
458 Ga0436361_0127301 3300039447 Bacteria 1234
459 Ga0436361_0434405 3300039447 Unclassified 1026
460 Ga0436361_0608363 3300039447 Bacteria 743
461 Ga0436361_0634970 3300039447 Bacteria 2949
462 Ga0436361_0823786 3300039447 Bacteria 33073
463 Ga0436361_0962335 3300039447 Bacteria 31232
464 Ga0436363_1691084 3300039450 Bacteria 1688
465 Ga0466966_0175612 3300044684 Bacteria 1301
466 Ga0466966_0491383 3300044684 Bacteria 738
467 Ga0466963_0010850 3300044694 Bacteria 5531
468 Ga0466971_0495462 3300044719 Unclassified 603
469 Ga0466970_0692829 3300044765 Bacteria 594
470 Ga0466957_0886649 3300044842 Bacteria 637
471 Ga0466958_0359267 3300045836 Unclassified 938
472 Ga0466967_0005035 3300045976 Bacteria 9056
473 Ga0466967_1798047 3300045976 Unclassified 610
474 Ga0495629_0548099 3300046459 Bacteria 776
475 Ga0495651_0561661 3300046462 Unclassified 724
476 Ga0495582_0093089 3300046473 Unclassified 1682
477 Ga0495662_0216177 3300046476 Unclassified 945
478 Ga0495664_0572380 3300046477 Unclassified 672
479 Ga0495618_0388718 3300046514 Bacteria 855
480 Ga0495665_0030323 3300046531 Unclassified 2894
481 Ga0495587_0282424 3300046536 Unclassified 930
482 Ga0495587_0789588 3300046536 Bacteria 519
483 Ga0495645_0061355 3300046543 Unclassified 2724
484 Ga0495667_0113227 3300046559 Unclassified 1753
485 Ga0495634_0380656 3300046642 Bacteria 841
486 Ga0495634_0568388 3300046642 Bacteria 660
487 Ga0495623_0535393 3300046679 Unclassified 615
488 Ga0495646_0365682 3300046680 Unclassified 754
489 Ga0495613_0304244 3300046689 Bacteria 1103
490 Ga0495581_0113851 3300047315 Bacteria 1573
491 Ga0495604_0466661 3300047317 Unclassified 823
492 Ga0495684_0615767 3300047471 Bacteria 731
493 Ga0496100_0236520 3300048903 Unclassified 1346
494 Ga0496101_0297117 3300048904 Bacteria 1264
495 Ga0496104_0010869 3300048907 Bacteria 8142
496 Ga0496104_1205034 3300048907 Bacteria 660
497 Ga0496105_0008026 3300048908 Bacteria 8201
498 Ga0496105_0111242 3300048908 Bacteria 2261
499 Ga0496105_0129307 3300048908 Unclassified 2083
500 Ga0496112_0384269 3300048915 Bacteria 1345
501 Ga0496114_0278101 3300048917 Bacteria 1475
502 Ga0496115_0092721 3300048918 Bacteria 2469
503 Ga0496115_0105514 3300048918 Bacteria 2313
504 Ga0496115_0138465 3300048918 Bacteria 2007
505 Ga0496115_0183773 3300048918 Bacteria 1728
506 Ga0496115_0212375 3300048918 Unclassified 1598
507 Ga0496126_0990515 3300048929 Unclassified 631
508 Ga0501070_0673370 3300049586 Bacteria 820
509 Ga0495601_0237863 3300053077 Unclassified 1189
510 Ga0500595_025306 3300053119 Bacteria 2059
511 Ga0587128_054338 3300059630 Bacteria 740

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031344 Ga0265316_10155951 Ga0265316_101559513 122
2 3300031712 Ga0265342_10588379 Ga0265342_105883792 122
3 3300005548 Ga0070665_101149255 Ga0070665_1011492552 124
4 3300005548 Ga0070665_101550821 Ga0070665_1015508211 124
5 3300005563 Ga0068855_100161894 Ga0068855_1001618942 124
6 3300013104 Ga0157370_10425868 Ga0157370_104258682 124
7 3300013296 Ga0157374_10623665 Ga0157374_106236652 124
8 3300013307 Ga0157372_10012805 Ga0157372_100128055 124
9 3300014969 Ga0157376_10635544 Ga0157376_106355441 124
10 3300021361 Ga0213872_10001792 Ga0213872_1000179211 124
11 3300021361 Ga0213872_10002841 Ga0213872_100028414 124
12 3300021361 Ga0213872_10079404 Ga0213872_100794043 124
13 3300025929 Ga0207664_10003577 Ga0207664_1000357710 124
14 3300025949 Ga0207667_10241333 Ga0207667_102413331 124
15 3300028379 Ga0268266_10045442 Ga0268266_100454422 124
16 3300031344 Ga0265316_10308416 Ga0265316_103084161 124
17 3300037466 Ga0395898_0291623 Ga0395898_0291623_1070_1465 124
18 3300037466 Ga0395898_0823569 Ga0395898_0823569_55_450 124
19 3300038443 Ga0395901_0189068 Ga0395901_0189068_169_564 124
20 3300039438 Ga0436360_0149301 Ga0436360_0149301_605_1000 124
21 3300039438 Ga0436360_0252798 Ga0436360_0252798_31_426 124
22 3300039438 Ga0436360_0518538 Ga0436360_0518538_2706_3101 124
23 3300039438 Ga0436360_0855957 Ga0436360_0855957_127_522 124
24 3300039447 Ga0436361_0434405 Ga0436361_0434405_123_518 124
25 3300039447 Ga0436361_0608363 Ga0436361_0608363_77_472 124
26 3300039447 Ga0436361_0634970 Ga0436361_0634970_890_1285 124
27 3300039447 Ga0436361_0823786 Ga0436361_0823786_24584_24979 124
28 3300039447 Ga0436361_0962335 Ga0436361_0962335_20612_21007 124
29 3300044684 Ga0466966_0175612 Ga0466966_0175612_857_1252 124
30 3300044684 Ga0466966_0491383 Ga0466966_0491383_101_496 124
31 3300044719 Ga0466971_0495462 Ga0466971_0495462_25_420 124
32 3300044765 Ga0466970_0692829 Ga0466970_0692829_20_415 124
33 3300044842 Ga0466957_0886649 Ga0466957_0886649_209_604 124
34 3300045836 Ga0466958_0359267 Ga0466958_0359267_219_614 124
35 3300048918 Ga0496115_0183773 Ga0496115_0183773_118_492 124
36 3300049586 Ga0501070_0673370 Ga0501070_0673370_303_707 124
37 3300005327 Ga0070658_10038607 Ga0070658_100386074 125
38 3300005327 Ga0070658_10068767 Ga0070658_100687674 125
39 3300005327 Ga0070658_10168156 Ga0070658_101681563 125
40 3300005327 Ga0070658_10335837 Ga0070658_103358372 125
41 3300005329 Ga0070683_100003661 Ga0070683_1000036615 125
42 3300005329 Ga0070683_100023173 Ga0070683_1000231735 125
43 3300005329 Ga0070683_100082023 Ga0070683_1000820234 125
44 3300005329 Ga0070683_100318617 Ga0070683_1003186173 125
45 3300005329 Ga0070683_100668300 Ga0070683_1006683002 125
46 3300005331 Ga0070670_100011436 Ga0070670_1000114363 125
47 3300005334 Ga0068869_100003216 Ga0068869_1000032164 125
48 3300005334 Ga0068869_100231122 Ga0068869_1002311222 125
49 3300005335 Ga0070666_10085013 Ga0070666_100850133 125
50 3300005335 Ga0070666_10197581 Ga0070666_101975812 125
51 3300005336 Ga0070680_100138835 Ga0070680_1001388352 125
52 3300005337 Ga0070682_101117474 Ga0070682_1011174742 125
53 3300005338 Ga0068868_100004466 Ga0068868_1000044664 125
54 3300005338 Ga0068868_100073799 Ga0068868_1000737992 125
55 3300005338 Ga0068868_100107424 Ga0068868_1001074242 125
56 3300005338 Ga0068868_100191325 Ga0068868_1001913252 125
57 3300005339 Ga0070660_100020527 Ga0070660_1000205276 125
58 3300005339 Ga0070660_100549114 Ga0070660_1005491141 125
59 3300005344 Ga0070661_100002519 Ga0070661_10000251916 125
60 3300005344 Ga0070661_100154192 Ga0070661_1001541921 125
61 3300005344 Ga0070661_100215761 Ga0070661_1002157611 125
62 3300005347 Ga0070668_100142494 Ga0070668_1001424942 125
63 3300005353 Ga0070669_101333603 Ga0070669_1013336031 125
64 3300005354 Ga0070675_100072927 Ga0070675_1000729272 125
65 3300005355 Ga0070671_100009025 Ga0070671_10000902511 125
66 3300005355 Ga0070671_100039285 Ga0070671_1000392854 125
67 3300005355 Ga0070671_100353683 Ga0070671_1003536832 125
68 3300005364 Ga0070673_100019733 Ga0070673_1000197331 125
69 3300005367 Ga0070667_100006069 Ga0070667_1000060696 125
70 3300005367 Ga0070667_100236908 Ga0070667_1002369082 125
71 3300005434 Ga0070709_10341318 Ga0070709_103413182 125
72 3300005435 Ga0070714_100177077 Ga0070714_1001770772 125
73 3300005435 Ga0070714_100465770 Ga0070714_1004657702 125
74 3300005436 Ga0070713_100177736 Ga0070713_1001777362 125
75 3300005436 Ga0070713_100278194 Ga0070713_1002781942 125
76 3300005436 Ga0070713_101772984 Ga0070713_1017729841 125
77 3300005439 Ga0070711_100019101 Ga0070711_1000191014 125
78 3300005439 Ga0070711_101569846 Ga0070711_1015698461 125
79 3300005456 Ga0070678_100142197 Ga0070678_1001421972 125
80 3300005457 Ga0070662_100027879 Ga0070662_1000278794 125
81 3300005458 Ga0070681_10019326 Ga0070681_100193269 125
82 3300005458 Ga0070681_10137763 Ga0070681_101377632 125
83 3300005459 Ga0068867_100130243 Ga0068867_1001302432 125
84 3300005466 Ga0070685_10921262 Ga0070685_109212621 125
85 3300005530 Ga0070679_100032485 Ga0070679_1000324856 125
86 3300005535 Ga0070684_100003842 Ga0070684_10000384211 125
87 3300005535 Ga0070684_100160896 Ga0070684_1001608962 125
88 3300005535 Ga0070684_100247222 Ga0070684_1002472222 125
89 3300005535 Ga0070684_100622855 Ga0070684_1006228551 125
90 3300005539 Ga0068853_100022945 Ga0068853_1000229456 125
91 3300005539 Ga0068853_100030968 Ga0068853_1000309682 125
92 3300005539 Ga0068853_100031341 Ga0068853_1000313417 125
93 3300005539 Ga0068853_100319351 Ga0068853_1003193512 125
94 3300005539 Ga0068853_100664135 Ga0068853_1006641351 125
95 3300005539 Ga0068853_100746356 Ga0068853_1007463562 125
96 3300005547 Ga0070693_101149761 Ga0070693_1011497611 125
97 3300005548 Ga0070665_100126242 Ga0070665_1001262422 125
98 3300005563 Ga0068855_100002968 Ga0068855_10000296821 125
99 3300005563 Ga0068855_100035738 Ga0068855_1000357389 125
100 3300005563 Ga0068855_100045474 Ga0068855_1000454744 125
101 3300005563 Ga0068855_100047658 Ga0068855_1000476583 125
102 3300005563 Ga0068855_100107739 Ga0068855_1001077395 125
103 3300005563 Ga0068855_100298203 Ga0068855_1002982032 125
104 3300005563 Ga0068855_100328805 Ga0068855_1003288052 125
105 3300005564 Ga0070664_100096410 Ga0070664_1000964106 125
106 3300005564 Ga0070664_100168478 Ga0070664_1001684782 125
107 3300005564 Ga0070664_100647868 Ga0070664_1006478682 125
108 3300005577 Ga0068857_100116876 Ga0068857_1001168762 125
109 3300005577 Ga0068857_100655077 Ga0068857_1006550771 125
110 3300005577 Ga0068857_100659866 Ga0068857_1006598662 125
111 3300005577 Ga0068857_101124895 Ga0068857_1011248952 125
112 3300005578 Ga0068854_100034049 Ga0068854_1000340494 125
113 3300005578 Ga0068854_100034137 Ga0068854_1000341373 125
114 3300005578 Ga0068854_101299955 Ga0068854_1012999552 125
115 3300005614 Ga0068856_100007441 Ga0068856_1000074412 125
116 3300005614 Ga0068856_100012724 Ga0068856_1000127242 125
117 3300005614 Ga0068856_100019296 Ga0068856_1000192965 125
118 3300005614 Ga0068856_100021487 Ga0068856_1000214872 125
119 3300005614 Ga0068856_100061204 Ga0068856_1000612044 125
120 3300005614 Ga0068856_100132768 Ga0068856_1001327681 125
121 3300005614 Ga0068856_100363217 Ga0068856_1003632172 125
122 3300005614 Ga0068856_100560084 Ga0068856_1005600842 125
123 3300005616 Ga0068852_100000008 Ga0068852_100000008124 125
124 3300005616 Ga0068852_100031931 Ga0068852_1000319314 125
125 3300005616 Ga0068852_100055821 Ga0068852_1000558213 125
126 3300005616 Ga0068852_100057683 Ga0068852_1000576832 125
127 3300005616 Ga0068852_100525205 Ga0068852_1005252052 125
128 3300005616 Ga0068852_100534806 Ga0068852_1005348061 125
129 3300005616 Ga0068852_100540423 Ga0068852_1005404232 125
130 3300005616 Ga0068852_100824308 Ga0068852_1008243082 125
131 3300005617 Ga0068859_100013030 Ga0068859_1000130306 125
132 3300005617 Ga0068859_100186686 Ga0068859_1001866862 125
133 3300005617 Ga0068859_100439384 Ga0068859_1004393842 125
134 3300005618 Ga0068864_100003655 Ga0068864_1000036556 125
135 3300005618 Ga0068864_100066418 Ga0068864_1000664182 125
136 3300005834 Ga0068851_10015368 Ga0068851_100153686 125
137 3300005834 Ga0068851_10023459 Ga0068851_100234594 125
138 3300005834 Ga0068851_10031901 Ga0068851_100319013 125
139 3300005841 Ga0068863_100006990 Ga0068863_1000069906 125
140 3300005841 Ga0068863_100677739 Ga0068863_1006777392 125
141 3300005842 Ga0068858_100011675 Ga0068858_1000116756 125
142 3300005843 Ga0068860_100008207 Ga0068860_1000082078 125
143 3300005843 Ga0068860_100373389 Ga0068860_1003733892 125
144 3300006028 Ga0070717_10259320 Ga0070717_102593202 125
145 3300006028 Ga0070717_10348851 Ga0070717_103488512 125
146 3300006175 Ga0070712_101286605 Ga0070712_1012866051 125
147 3300006237 Ga0097621_100011540 Ga0097621_1000115405 125
148 3300006237 Ga0097621_100078216 Ga0097621_1000782162 125
149 3300006237 Ga0097621_100274712 Ga0097621_1002747122 125
150 3300006358 Ga0068871_100014319 Ga0068871_1000143192 125
151 3300006358 Ga0068871_100019727 Ga0068871_1000197273 125
152 3300006358 Ga0068871_100234523 Ga0068871_1002345233 125
153 3300006358 Ga0068871_101186388 Ga0068871_1011863881 125
154 3300006881 Ga0068865_100086041 Ga0068865_1000860412 125
155 3300006931 Ga0097620_100013030 Ga0097620_1000130306 125
156 3300006931 Ga0097620_100186676 Ga0097620_1001866762 125
157 3300006931 Ga0097620_100439380 Ga0097620_1004393802 125
158 3300009093 Ga0105240_10000038 Ga0105240_1000003811 125
159 3300009093 Ga0105240_10004578 Ga0105240_1000457811 125
160 3300009093 Ga0105240_10006252 Ga0105240_100062528 125
161 3300009093 Ga0105240_10014758 Ga0105240_100147585 125
162 3300009093 Ga0105240_10015263 Ga0105240_1001526315 125
163 3300009093 Ga0105240_10044350 Ga0105240_100443503 125
164 3300009093 Ga0105240_10139228 Ga0105240_101392282 125
165 3300009093 Ga0105240_10207492 Ga0105240_102074922 125
166 3300009093 Ga0105240_10374164 Ga0105240_103741642 125
167 3300009098 Ga0105245_10007487 Ga0105245_100074878 125
168 3300009098 Ga0105245_10010388 Ga0105245_100103882 125
169 3300009101 Ga0105247_10002658 Ga0105247_100026584 125
170 3300009101 Ga0105247_11095661 Ga0105247_110956611 125
171 3300009148 Ga0105243_11576459 Ga0105243_115764591 125
172 3300009174 Ga0105241_10000665 Ga0105241_1000066516 125
173 3300009174 Ga0105241_10000681 Ga0105241_100006813 125
174 3300009174 Ga0105241_10001076 Ga0105241_100010769 125
175 3300009174 Ga0105241_10019873 Ga0105241_100198732 125
176 3300009174 Ga0105241_10020166 Ga0105241_100201662 125
177 3300009174 Ga0105241_10058170 Ga0105241_100581702 125
178 3300009174 Ga0105241_10200417 Ga0105241_102004172 125
179 3300009176 Ga0105242_10073052 Ga0105242_100730524 125
180 3300009177 Ga0105248_10010400 Ga0105248_100104003 125
181 3300009177 Ga0105248_10146215 Ga0105248_101462152 125
182 3300009177 Ga0105248_10173779 Ga0105248_101737792 125
183 3300009177 Ga0105248_10629174 Ga0105248_106291741 125
184 3300009545 Ga0105237_10010929 Ga0105237_100109299 125
185 3300009545 Ga0105237_10040238 Ga0105237_100402382 125
186 3300009545 Ga0105237_10746641 Ga0105237_107466412 125
187 3300009551 Ga0105238_10001545 Ga0105238_100015452 125
188 3300009551 Ga0105238_10008433 Ga0105238_100084337 125
189 3300009551 Ga0105238_10014811 Ga0105238_1001481111 125
190 3300009551 Ga0105238_10037668 Ga0105238_100376686 125
191 3300009551 Ga0105238_10052925 Ga0105238_100529256 125
192 3300009551 Ga0105238_10131254 Ga0105238_101312542 125
193 3300009551 Ga0105238_10198613 Ga0105238_101986133 125
194 3300009551 Ga0105238_10239634 Ga0105238_102396342 125
195 3300009551 Ga0105238_10464206 Ga0105238_104642061 125
196 3300009553 Ga0105249_10030705 Ga0105249_100307052 125
197 3300010375 Ga0105239_10014728 Ga0105239_100147284 125
198 3300010375 Ga0105239_10019723 Ga0105239_100197234 125
199 3300010375 Ga0105239_10184093 Ga0105239_101840932 125
200 3300010375 Ga0105239_10408997 Ga0105239_104089972 125
201 3300010375 Ga0105239_10876656 Ga0105239_108766561 125
202 3300010375 Ga0105239_10882047 Ga0105239_108820471 125
203 3300010375 Ga0105239_13563295 Ga0105239_135632951 125
204 3300011119 Ga0105246_10001968 Ga0105246_1000196810 125
205 3300011119 Ga0105246_11907065 Ga0105246_119070652 125
206 3300013100 Ga0157373_10567442 Ga0157373_105674422 125
207 3300013102 Ga0157371_10153190 Ga0157371_101531902 125
208 3300013102 Ga0157371_10205993 Ga0157371_102059932 125
209 3300013104 Ga0157370_10000130 Ga0157370_1000013065 125
210 3300013104 Ga0157370_10015998 Ga0157370_100159983 125
211 3300013104 Ga0157370_10750753 Ga0157370_107507532 125
212 3300013105 Ga0157369_10000058 Ga0157369_10000058126 125
213 3300013105 Ga0157369_10012152 Ga0157369_100121524 125
214 3300013105 Ga0157369_10064147 Ga0157369_100641476 125
215 3300013105 Ga0157369_10064896 Ga0157369_100648962 125
216 3300013105 Ga0157369_10099530 Ga0157369_100995302 125
217 3300013105 Ga0157369_10189432 Ga0157369_101894323 125
218 3300013105 Ga0157369_10200004 Ga0157369_102000042 125
219 3300013105 Ga0157369_10268912 Ga0157369_102689122 125
220 3300013105 Ga0157369_10713385 Ga0157369_107133852 125
221 3300013105 Ga0157369_10980432 Ga0157369_109804321 125
222 3300013105 Ga0157369_11872557 Ga0157369_118725571 125
223 3300013296 Ga0157374_10023480 Ga0157374_100234809 125
224 3300013296 Ga0157374_10027506 Ga0157374_100275062 125
225 3300013296 Ga0157374_10032060 Ga0157374_100320602 125
226 3300013296 Ga0157374_10043855 Ga0157374_100438551 125
227 3300013296 Ga0157374_10145485 Ga0157374_101454853 125
228 3300013296 Ga0157374_11147104 Ga0157374_111471041 125
229 3300013296 Ga0157374_12255117 Ga0157374_122551172 125
230 3300013297 Ga0157378_10008138 Ga0157378_100081388 125
231 3300013297 Ga0157378_10015620 Ga0157378_100156207 125
232 3300013297 Ga0157378_10036668 Ga0157378_100366682 125
233 3300013297 Ga0157378_10086253 Ga0157378_100862532 125
234 3300013306 Ga0163162_10085169 Ga0163162_100851692 125
235 3300013307 Ga0157372_10000163 Ga0157372_100001636 125
236 3300013307 Ga0157372_10011258 Ga0157372_100112583 125
237 3300013307 Ga0157372_10012883 Ga0157372_100128837 125
238 3300013307 Ga0157372_10019408 Ga0157372_100194084 125
239 3300013307 Ga0157372_10021732 Ga0157372_100217328 125
240 3300013307 Ga0157372_10089695 Ga0157372_100896952 125
241 3300013307 Ga0157372_10177782 Ga0157372_101777822 125
242 3300013307 Ga0157372_10200319 Ga0157372_102003191 125
243 3300013307 Ga0157372_10224636 Ga0157372_102246362 125
244 3300013307 Ga0157372_10797782 Ga0157372_107977822 125
245 3300013307 Ga0157372_12365407 Ga0157372_123654071 125
246 3300013308 Ga0157375_10007951 Ga0157375_100079516 125
247 3300013308 Ga0157375_10013466 Ga0157375_100134662 125
248 3300013308 Ga0157375_10157575 Ga0157375_101575752 125
249 3300013308 Ga0157375_12750287 Ga0157375_127502871 125
250 3300014325 Ga0163163_10025668 Ga0163163_100256682 125
251 3300014968 Ga0157379_10007000 Ga0157379_100070004 125
252 3300014968 Ga0157379_10489113 Ga0157379_104891132 125
253 3300014968 Ga0157379_10807002 Ga0157379_108070021 125
254 3300014969 Ga0157376_10015967 Ga0157376_100159672 125
255 3300014969 Ga0157376_10047177 Ga0157376_100471773 125
256 3300014969 Ga0157376_10149816 Ga0157376_101498162 125
257 3300014969 Ga0157376_10152097 Ga0157376_101520972 125
258 3300014969 Ga0157376_11161798 Ga0157376_111617981 125
259 3300017792 Ga0163161_10040911 Ga0163161_100409113 125
260 3300025321 Ga0207656_10005299 Ga0207656_100052998 125
261 3300025321 Ga0207656_10008759 Ga0207656_100087593 125
262 3300025321 Ga0207656_10011154 Ga0207656_100111542 125
263 3300025321 Ga0207656_10038051 Ga0207656_100380513 125
264 3300025321 Ga0207656_10193778 Ga0207656_101937782 125
265 3300025900 Ga0207710_10002857 Ga0207710_100028572 125
266 3300025903 Ga0207680_10041900 Ga0207680_100419002 125
267 3300025906 Ga0207699_10271367 Ga0207699_102713672 125
268 3300025909 Ga0207705_10028165 Ga0207705_100281653 125
269 3300025909 Ga0207705_10083942 Ga0207705_100839422 125
270 3300025909 Ga0207705_10220592 Ga0207705_102205921 125
271 3300025909 Ga0207705_10460611 Ga0207705_104606111 125
272 3300025911 Ga0207654_10000017 Ga0207654_10000017168 125
273 3300025911 Ga0207654_10000082 Ga0207654_100000822 125
274 3300025911 Ga0207654_10000895 Ga0207654_100008956 125
275 3300025911 Ga0207654_10147320 Ga0207654_101473202 125
276 3300025911 Ga0207654_10316105 Ga0207654_103161051 125
277 3300025912 Ga0207707_10074397 Ga0207707_100743975 125
278 3300025912 Ga0207707_10110329 Ga0207707_101103292 125
279 3300025912 Ga0207707_10229093 Ga0207707_102290932 125
280 3300025913 Ga0207695_10000070 Ga0207695_1000007014 125
281 3300025913 Ga0207695_10000174 Ga0207695_1000017412 125
282 3300025913 Ga0207695_10003923 Ga0207695_1000392310 125
283 3300025913 Ga0207695_10037092 Ga0207695_100370925 125
284 3300025913 Ga0207695_10134911 Ga0207695_101349112 125
285 3300025913 Ga0207695_10156609 Ga0207695_101566093 125
286 3300025913 Ga0207695_10235764 Ga0207695_102357641 125
287 3300025914 Ga0207671_10001928 Ga0207671_1000192812 125
288 3300025914 Ga0207671_10040556 Ga0207671_100405562 125
289 3300025914 Ga0207671_10460123 Ga0207671_104601232 125
290 3300025914 Ga0207671_10697158 Ga0207671_106971582 125
291 3300025916 Ga0207663_10032410 Ga0207663_100324102 125
292 3300025917 Ga0207660_10013847 Ga0207660_100138474 125
293 3300025917 Ga0207660_10096672 Ga0207660_100966722 125
294 3300025919 Ga0207657_10024765 Ga0207657_100247653 125
295 3300025920 Ga0207649_10030086 Ga0207649_100300864 125
296 3300025920 Ga0207649_10171970 Ga0207649_101719702 125
297 3300025920 Ga0207649_10771448 Ga0207649_107714481 125
298 3300025920 Ga0207649_10930996 Ga0207649_109309962 125
299 3300025921 Ga0207652_10022004 Ga0207652_100220046 125
300 3300025924 Ga0207694_10000659 Ga0207694_100006593 125
301 3300025924 Ga0207694_10001331 Ga0207694_1000133113 125
302 3300025924 Ga0207694_10016801 Ga0207694_100168012 125
303 3300025924 Ga0207694_10211632 Ga0207694_102116322 125
304 3300025924 Ga0207694_10400945 Ga0207694_104009451 125
305 3300025925 Ga0207650_10001748 Ga0207650_100017489 125
306 3300025925 Ga0207650_10154330 Ga0207650_101543302 125
307 3300025926 Ga0207659_10056623 Ga0207659_100566232 125
308 3300025927 Ga0207687_10036015 Ga0207687_100360154 125
309 3300025927 Ga0207687_10071575 Ga0207687_100715753 125
310 3300025927 Ga0207687_10198829 Ga0207687_101988292 125
311 3300025928 Ga0207700_10229392 Ga0207700_102293922 125
312 3300025928 Ga0207700_10342768 Ga0207700_103427682 125
313 3300025928 Ga0207700_11704447 Ga0207700_117044471 125
314 3300025931 Ga0207644_10009194 Ga0207644_100091944 125
315 3300025931 Ga0207644_11241567 Ga0207644_112415672 125
316 3300025933 Ga0207706_10008241 Ga0207706_100082412 125
317 3300025934 Ga0207686_10455769 Ga0207686_104557692 125
318 3300025934 Ga0207686_10624897 Ga0207686_106248972 125
319 3300025938 Ga0207704_11913313 Ga0207704_119133131 125
320 3300025941 Ga0207711_10040684 Ga0207711_100406846 125
321 3300025941 Ga0207711_10119110 Ga0207711_101191102 125
322 3300025941 Ga0207711_10130375 Ga0207711_101303752 125
323 3300025942 Ga0207689_10006930 Ga0207689_100069304 125
324 3300025942 Ga0207689_10049062 Ga0207689_100490625 125
325 3300025944 Ga0207661_10017167 Ga0207661_100171672 125
326 3300025944 Ga0207661_10166306 Ga0207661_101663061 125
327 3300025945 Ga0207679_10081207 Ga0207679_100812073 125
328 3300025945 Ga0207679_10235354 Ga0207679_102353541 125
329 3300025945 Ga0207679_10383307 Ga0207679_103833071 125
330 3300025949 Ga0207667_10002340 Ga0207667_100023403 125
331 3300025949 Ga0207667_10073640 Ga0207667_100736402 125
332 3300025949 Ga0207667_10110297 Ga0207667_101102974 125
333 3300025949 Ga0207667_10174463 Ga0207667_101744632 125
334 3300025949 Ga0207667_10177453 Ga0207667_101774532 125
335 3300025949 Ga0207667_10223351 Ga0207667_102233512 125
336 3300025949 Ga0207667_11643308 Ga0207667_116433081 125
337 3300025961 Ga0207712_10083027 Ga0207712_100830272 125
338 3300025972 Ga0207668_10535709 Ga0207668_105357092 125
339 3300025981 Ga0207640_10070022 Ga0207640_100700223 125
340 3300025981 Ga0207640_10697852 Ga0207640_106978521 125
341 3300025986 Ga0207658_10004337 Ga0207658_100043376 125
342 3300025986 Ga0207658_10311151 Ga0207658_103111512 125
343 3300026023 Ga0207677_10001151 Ga0207677_100011518 125
344 3300026023 Ga0207677_10154089 Ga0207677_101540892 125
345 3300026023 Ga0207677_10305316 Ga0207677_103053162 125
346 3300026023 Ga0207677_11377397 Ga0207677_113773971 125
347 3300026035 Ga0207703_10009852 Ga0207703_100098523 125
348 3300026035 Ga0207703_10572713 Ga0207703_105727132 125
349 3300026041 Ga0207639_10000321 Ga0207639_1000032127 125
350 3300026067 Ga0207678_10128855 Ga0207678_101288552 125
351 3300026067 Ga0207678_10183060 Ga0207678_101830601 125
352 3300026078 Ga0207702_10012838 Ga0207702_100128384 125
353 3300026078 Ga0207702_10013154 Ga0207702_100131542 125
354 3300026078 Ga0207702_10150668 Ga0207702_101506682 125
355 3300026078 Ga0207702_10468038 Ga0207702_104680382 125
356 3300026088 Ga0207641_10192421 Ga0207641_101924212 125
357 3300026089 Ga0207648_10432785 Ga0207648_104327852 125
358 3300026095 Ga0207676_10007155 Ga0207676_100071553 125
359 3300026095 Ga0207676_11057674 Ga0207676_110576741 125
360 3300026116 Ga0207674_10005713 Ga0207674_1000571311 125
361 3300026116 Ga0207674_10016243 Ga0207674_1001624310 125
362 3300026116 Ga0207674_10230376 Ga0207674_102303762 125
363 3300026116 Ga0207674_10797893 Ga0207674_107978932 125
364 3300026121 Ga0207683_10000420 Ga0207683_100004207 125
365 3300026142 Ga0207698_10000010 Ga0207698_1000001012 125
366 3300026142 Ga0207698_10054660 Ga0207698_100546604 125
367 3300026142 Ga0207698_10117170 Ga0207698_101171702 125
368 3300026142 Ga0207698_10152841 Ga0207698_101528412 125
369 3300026142 Ga0207698_10235648 Ga0207698_102356482 125
370 3300026142 Ga0207698_10260228 Ga0207698_102602282 125
371 3300026142 Ga0207698_10374624 Ga0207698_103746242 125
372 3300026142 Ga0207698_10732940 Ga0207698_107329402 125
373 3300026142 Ga0207698_11954250 Ga0207698_119542501 125
374 3300028379 Ga0268266_10005831 Ga0268266_100058317 125
375 3300028379 Ga0268266_10094874 Ga0268266_100948742 125
376 3300028381 Ga0268264_10002796 Ga0268264_1000279614 125
377 3300028381 Ga0268264_11155306 Ga0268264_111553062 125
378 3300028558 Ga0265326_10049309 Ga0265326_100493092 125
379 3300028573 Ga0265334_10035315 Ga0265334_100353152 125
380 3300028666 Ga0265336_10007088 Ga0265336_100070884 125
381 3300028666 Ga0265336_10012533 Ga0265336_100125334 125
382 3300028800 Ga0265338_10006247 Ga0265338_100062473 125
383 3300028800 Ga0265338_10019942 Ga0265338_100199424 125
384 3300028800 Ga0265338_10021824 Ga0265338_100218242 125
385 3300028800 Ga0265338_10088737 Ga0265338_100887373 125
386 3300028800 Ga0265338_10097447 Ga0265338_100974473 125
387 3300028800 Ga0265338_10142208 Ga0265338_101422082 125
388 3300028800 Ga0265338_10204910 Ga0265338_102049102 125
389 3300029957 Ga0265324_10012090 Ga0265324_100120901 125
390 3300030878 Ga0265770_1029432 Ga0265770_10294322 125
391 3300030886 Ga0265772_106806 Ga0265772_1068061 125
392 3300031090 Ga0265760_10021362 Ga0265760_100213622 125
393 3300031090 Ga0265760_10107873 Ga0265760_101078732 125
394 3300031235 Ga0265330_10000172 Ga0265330_100001723 125
395 3300031235 Ga0265330_10001580 Ga0265330_100015808 125
396 3300031235 Ga0265330_10031365 Ga0265330_100313652 125
397 3300031235 Ga0265330_10067153 Ga0265330_100671532 125
398 3300031235 Ga0265330_10101184 Ga0265330_101011841 125
399 3300031235 Ga0265330_10282509 Ga0265330_102825091 125
400 3300031238 Ga0265332_10010081 Ga0265332_100100816 125
401 3300031239 Ga0265328_10008887 Ga0265328_100088874 125
402 3300031239 Ga0265328_10012131 Ga0265328_100121315 125
403 3300031239 Ga0265328_10013120 Ga0265328_100131202 125
404 3300031239 Ga0265328_10048554 Ga0265328_100485543 125
405 3300031240 Ga0265320_10051420 Ga0265320_100514203 125
406 3300031241 Ga0265325_10003754 Ga0265325_1000375412 125
407 3300031241 Ga0265325_10004411 Ga0265325_100044114 125
408 3300031241 Ga0265325_10018680 Ga0265325_100186802 125
409 3300031241 Ga0265325_10019364 Ga0265325_100193643 125
410 3300031241 Ga0265325_10124953 Ga0265325_101249532 125
411 3300031241 Ga0265325_10165150 Ga0265325_101651502 125
412 3300031241 Ga0265325_10284126 Ga0265325_102841261 125
413 3300031242 Ga0265329_10011322 Ga0265329_100113225 125
414 3300031247 Ga0265340_10003518 Ga0265340_1000351811 125
415 3300031247 Ga0265340_10026746 Ga0265340_100267464 125
416 3300031247 Ga0265340_10032012 Ga0265340_100320124 125
417 3300031247 Ga0265340_10032473 Ga0265340_100324733 125
418 3300031247 Ga0265340_10051931 Ga0265340_100519313 125
419 3300031249 Ga0265339_10000031 Ga0265339_100000315 125
420 3300031249 Ga0265339_10005934 Ga0265339_100059344 125
421 3300031249 Ga0265339_10007287 Ga0265339_1000728710 125
422 3300031249 Ga0265339_10023453 Ga0265339_100234531 125
423 3300031249 Ga0265339_10027679 Ga0265339_100276793 125
424 3300031249 Ga0265339_10058400 Ga0265339_100584003 125
425 3300031249 Ga0265339_10068832 Ga0265339_100688323 125
426 3300031249 Ga0265339_10330589 Ga0265339_103305892 125
427 3300031250 Ga0265331_10042194 Ga0265331_100421943 125
428 3300031250 Ga0265331_10180222 Ga0265331_101802222 125
429 3300031250 Ga0265331_10336113 Ga0265331_103361131 125
430 3300031344 Ga0265316_10001478 Ga0265316_100014789 125
431 3300031344 Ga0265316_10001571 Ga0265316_1000157125 125
432 3300031344 Ga0265316_10013991 Ga0265316_100139917 125
433 3300031344 Ga0265316_10015528 Ga0265316_100155282 125
434 3300031344 Ga0265316_10018238 Ga0265316_100182382 125
435 3300031344 Ga0265316_10063695 Ga0265316_100636954 125
436 3300031344 Ga0265316_10066135 Ga0265316_100661352 125
437 3300031344 Ga0265316_10185688 Ga0265316_101856882 125
438 3300031344 Ga0265316_10214995 Ga0265316_102149951 125
439 3300031344 Ga0265316_10215954 Ga0265316_102159541 125
440 3300031344 Ga0265316_10534448 Ga0265316_105344482 125
441 3300031595 Ga0265313_10011588 Ga0265313_100115886 125
442 3300031595 Ga0265313_10076917 Ga0265313_100769173 125
443 3300031595 Ga0265313_10198748 Ga0265313_101987481 125
444 3300031711 Ga0265314_10005019 Ga0265314_100050193 125
445 3300031711 Ga0265314_10083504 Ga0265314_100835042 125
446 3300031711 Ga0265314_10454931 Ga0265314_104549311 125
447 3300031712 Ga0265342_10000067 Ga0265342_1000006797 125
448 3300031712 Ga0265342_10003291 Ga0265342_1000329111 125
449 3300031712 Ga0265342_10004816 Ga0265342_100048162 125
450 3300031712 Ga0265342_10038259 Ga0265342_100382593 125
451 3300031712 Ga0265342_10068504 Ga0265342_100685041 125
452 3300031712 Ga0265342_10087277 Ga0265342_100872773 125
453 3300031712 Ga0265342_10106858 Ga0265342_101068582 125
454 3300031712 Ga0265342_10679540 Ga0265342_106795401 125
455 3300035118 Ga0373954_0024368 Ga0373954_0024368_294_683 125
456 3300035724 Ga0373933_0383634 Ga0373933_0383634_42_431 125
457 3300036401 Ga0373937_0037339 Ga0373937_0037339_954_1331 125
458 3300036401 Ga0373937_0073358 Ga0373937_0073358_2191_2580 125
459 3300037068 Ga0373925_0733731 Ga0373925_0733731_23_400 125
460 3300037418 Ga0395900_0453530 Ga0395900_0453530_468_845 125
461 3300038443 Ga0395901_0957844 Ga0395901_0957844_378_755 125
462 3300039447 Ga0436361_0127301 Ga0436361_0127301_714_1112 125
463 3300039450 Ga0436363_1691084 Ga0436363_1691084_589_978 125
464 3300044694 Ga0466963_0010850 Ga0466963_0010850_901_1290 125
465 3300045976 Ga0466967_0005035 Ga0466967_0005035_6520_6909 125
466 3300045976 Ga0466967_1798047 Ga0466967_1798047_14_403 125
467 3300046459 Ga0495629_0548099 Ga0495629_0548099_305_682 125
468 3300046462 Ga0495651_0561661 Ga0495651_0561661_195_572 125
469 3300046473 Ga0495582_0093089 Ga0495582_0093089_1275_1652 125
470 3300046476 Ga0495662_0216177 Ga0495662_0216177_404_781 125
471 3300046477 Ga0495664_0572380 Ga0495664_0572380_117_494 125
472 3300046514 Ga0495618_0388718 Ga0495618_0388718_258_647 125
473 3300046531 Ga0495665_0030323 Ga0495665_0030323_1104_1481 125
474 3300046536 Ga0495587_0282424 Ga0495587_0282424_354_731 125
475 3300046536 Ga0495587_0789588 Ga0495587_0789588_26_415 125
476 3300046543 Ga0495645_0061355 Ga0495645_0061355_356_733 125
477 3300046559 Ga0495667_0113227 Ga0495667_0113227_1301_1678 125
478 3300046642 Ga0495634_0380656 Ga0495634_0380656_341_718 125
479 3300046642 Ga0495634_0568388 Ga0495634_0568388_249_626 125
480 3300046679 Ga0495623_0535393 Ga0495623_0535393_79_468 125
481 3300046680 Ga0495646_0365682 Ga0495646_0365682_340_717 125
482 3300046689 Ga0495613_0304244 Ga0495613_0304244_185_562 125
483 3300047315 Ga0495581_0113851 Ga0495581_0113851_849_1226 125
484 3300047317 Ga0495604_0466661 Ga0495604_0466661_129_518 125
485 3300047471 Ga0495684_0615767 Ga0495684_0615767_148_525 125
486 3300048903 Ga0496100_0236520 Ga0496100_0236520_933_1310 125
487 3300048904 Ga0496101_0297117 Ga0496101_0297117_591_968 125
488 3300048907 Ga0496104_0010869 Ga0496104_0010869_7740_8117 125
489 3300048907 Ga0496104_1205034 Ga0496104_1205034_84_470 125
490 3300048908 Ga0496105_0008026 Ga0496105_0008026_1851_2228 125
491 3300048908 Ga0496105_0111242 Ga0496105_0111242_162_548 125
492 3300048908 Ga0496105_0129307 Ga0496105_0129307_681_1058 125
493 3300048915 Ga0496112_0384269 Ga0496112_0384269_63_440 125
494 3300048917 Ga0496114_0278101 Ga0496114_0278101_630_1007 125
495 3300048918 Ga0496115_0092721 Ga0496115_0092721_1947_2324 125
496 3300048918 Ga0496115_0105514 Ga0496115_0105514_1309_1695 125
497 3300048918 Ga0496115_0138465 Ga0496115_0138465_1054_1431 125
498 3300048918 Ga0496115_0212375 Ga0496115_0212375_792_1169 125
499 3300053077 Ga0495601_0237863 Ga0495601_0237863_159_536 125
500 3300059630 Ga0587128_054338 Ga0587128_054338_199_588 125
501 3300003320 rootH2_10259217 rootH2_102592174 126
502 3300009093 Ga0105240_11204664 Ga0105240_112046641 126
503 3300009177 Ga0105248_10000002 Ga0105248_10000002170 126
504 3300009177 Ga0105248_10035969 Ga0105248_100359693 126
505 3300013306 Ga0163162_12781073 Ga0163162_127810732 126
506 3300025913 Ga0207695_11175126 Ga0207695_111751262 126
507 3300025941 Ga0207711_10000052 Ga0207711_1000005237 126
508 3300025941 Ga0207711_10024143 Ga0207711_100241434 126
509 3300031238 Ga0265332_10092042 Ga0265332_100920422 126
510 3300048929 Ga0496126_0990515 Ga0496126_0990515_55_474 126
511 3300053119 Ga0500595_025306 Ga0500595_025306_906_1331 126

Structural Annotation

Top 5 Hits

ID Description Score Start End
4loc-assembly1.cif.gz_A structure of the carboxyl transferase domain from rhizobium etli pyruvate carboxylase with oxamate and biotin 0.7313 3 52
4jx6-assembly1.cif.gz_A structure of the carboxyl transferase domain y628a from rhizobium etli pyruvate carboxylase with pyruvate 0.73 3 52
4jx5-assembly1.cif.gz_C structure of the carboxyl transferase domain from rhizobium etli pyruvate carboxylase with pyruvate 0.7259 3 52
4jx6-assembly3.cif.gz_D structure of the carboxyl transferase domain y628a from rhizobium etli pyruvate carboxylase with pyruvate 0.7246 3 52
4mim-assembly1.cif.gz_B structure of the carboxyl transferase domain from rhizobium etli pyruvate carboxylase with 3-bromopyruvate 0.7088 3 52
ID Description Score Start End Superfamily
2qf7B04 Alpha Beta;Roll;pyruvate carboxylase f1077a mutant fold;pyruvate carboxylase f1077a mutant domain 0.7176 3 54 3.10.600.10
3tw6B02 Alpha Beta;Roll;pyruvate carboxylase f1077a mutant fold;pyruvate carboxylase f1077a mutant domain 0.7039 3 51 3.10.600.10
4jx5D01 Alpha Beta;Roll;pyruvate carboxylase f1077a mutant fold;pyruvate carboxylase f1077a mutant domain 0.6975 3 52 3.10.600.10
af_A0A1D8PLY4_1036_1099_3.10.600.10 Alpha Beta;Roll;pyruvate carboxylase f1077a mutant fold;pyruvate carboxylase f1077a mutant domain 0.6961 3 49 3.10.600.10
af_A0A0P0VNU6_285_398_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.6848 34 49 2.30.42.10
ID Description Score Start End GO Terms
AF-A0A177RD69-F1-model_v4 deleted 0.9519 1 113
AF-A0A7V1XWY8-F1-model_v4 Uncharacterized protein 0.9389 1 113
AF-A0A1F2S0V9-F1-model_v4 Uncharacterized protein 0.9093 2 110
AF-A0A7V4XSU2-F1-model_v4 Uncharacterized protein 0.9091 1 119
AF-A0A2V9JZ13-F1-model_v4 Uncharacterized protein 0.9078 4 110

Feature Viewer

pLDDT pTM Quality
86.34 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map