F457255

General Info

Members Datasets Scaffolds Average Seq Length
511 300 491 168

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100555915|Ga0068853_1005559152
Length 178
Sequence MQITMHDTLVPTANRMLGNLSNFLDKAAAFAEAKKFDAAVLLSARLAPDMFTLTRQVQIACDMTKGAAARLSGTEIPKFEDNETTVAELKARIAKTLAFVNSIDAAKFANSEERDIVLQARAGELRLKGLNYLRDYVLPNVYFHVTTTYAILRHNGVNIGKRDYLGTLSLRDPSSLPS

Samples

Sample ID Description Type Environment
1 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
2 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
3 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
4 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
5 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
6 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
7 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
8 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
9 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
10 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
11 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
12 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
13 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
14 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
15 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
16 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
17 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
18 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
23 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
154 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
155 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
158 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
179 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
187 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
197 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
198 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
199 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
203 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
210 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
230 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
268 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
272 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
273 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
274 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
275 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
276 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
277 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
278 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
279 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
280 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
281 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
282 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
283 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
284 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
285 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
286 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
287 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
288 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
289 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
290 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
291 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
292 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
293 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
294 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
295 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
299 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
300 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.09
Metatranscriptomes 0
Isolates 3.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.98
Nodule 1.17
Rhizoplane 2.35
Rhizosphere 79.06
Stem 0
Stem Tuber 0
Unclassified 7.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000079 3300002987 Bacteria 46703
2 JGI25151J46595_10093221 3300003187 Bacteria 832
3 JGI25165J46597_1002799 3300003214 Bacteria 5052
4 JGI25160J50197_1000109 3300003354 Bacteria 77318
5 JGI25160J50197_1024500 3300003354 Bacteria 1711
6 JGI25161J50226_1000011 3300003374 Bacteria 210140
7 Ga0055539_1008173 3300003752 Bacteria 1314
8 Ga0055543_1000071 3300004625 Bacteria 91797
9 Ga0065165_1000135 3300005262 Bacteria 127785
10 Ga0070676_10102834 3300005328 Bacteria 1768
11 Ga0070690_100005626 3300005330 Bacteria 7051
12 Ga0070670_100263140 3300005331 Bacteria 1504
13 Ga0070670_100643581 3300005331 Bacteria 951
14 Ga0068869_100013493 3300005334 Bacteria 5436
15 Ga0068869_100042388 3300005334 Bacteria 3262
16 Ga0068869_100150220 3300005334 Bacteria 1806
17 Ga0068869_100309689 3300005334 Bacteria 1278
18 Ga0070666_10032921 3300005335 Bacteria 3427
19 Ga0070666_10694770 3300005335 Bacteria 746
20 Ga0068868_100023104 3300005338 Bacteria 4703
21 Ga0068868_100386720 3300005338 Bacteria 1205
22 Ga0068868_101220984 3300005338 Bacteria 696
23 Ga0070689_100078057 3300005340 Bacteria 2596
24 Ga0070689_100236166 3300005340 Bacteria 1504
25 Ga0070689_100462620 3300005340 Bacteria 1081
26 Ga0070687_100016832 3300005343 Bacteria 3346
27 Ga0070687_100919099 3300005343 Bacteria 629
28 Ga0070661_100006922 3300005344 Bacteria 7825
29 Ga0070668_100290905 3300005347 Bacteria 1367
30 Ga0070668_100538748 3300005347 Bacteria 1015
31 Ga0070668_100744857 3300005347 Bacteria 867
32 Ga0070668_101250136 3300005347 Bacteria 674
33 Ga0070669_100010865 3300005353 Bacteria 6462
34 Ga0070669_100634824 3300005353 Bacteria 897
35 Ga0070675_100111057 3300005354 Bacteria 2319
36 Ga0070675_100331779 3300005354 Bacteria 1346
37 Ga0070674_100803355 3300005356 Bacteria 812
38 Ga0070688_100073303 3300005365 Bacteria 2196
39 Ga0070688_100262871 3300005365 Bacteria 1233
40 Ga0070659_100001414 3300005366 Bacteria 17309
41 Ga0070659_101235393 3300005366 Bacteria 661
42 Ga0070659_101411907 3300005366 Bacteria 619
43 Ga0070667_100020333 3300005367 Bacteria 5511
44 Ga0070667_100374231 3300005367 Bacteria 1293
45 Ga0070667_100805530 3300005367 Bacteria 872
46 Ga0070701_10111002 3300005438 Bacteria 1532
47 Ga0070711_100131735 3300005439 Bacteria 1863
48 Ga0070711_100905597 3300005439 Bacteria 753
49 Ga0070700_100178410 3300005441 Unclassified 1476
50 Ga0070700_100275961 3300005441 Bacteria 1217
51 Ga0070663_100009029 3300005455 Bacteria 6157
52 Ga0070663_100077697 3300005455 Bacteria 2431
53 Ga0070678_100005765 3300005456 Bacteria 7204
54 Ga0070678_100826381 3300005456 Bacteria 843
55 Ga0068867_100014208 3300005459 Bacteria 5639
56 Ga0068867_100461397 3300005459 Bacteria 1085
57 Ga0070685_10169716 3300005466 Bacteria 1397
58 Ga0070685_10741785 3300005466 Bacteria 719
59 Ga0070698_100726091 3300005471 Bacteria 936
60 Ga0068853_100151962 3300005539 Bacteria 2084
61 Ga0068853_100555915 3300005539 Bacteria 1087
62 Ga0070672_100191491 3300005543 Bacteria 1708
63 Ga0070672_100551552 3300005543 Bacteria 1001
64 Ga0070686_100458736 3300005544 Unclassified 981
65 Ga0070686_100760408 3300005544 Bacteria 778
66 Ga0070686_100872307 3300005544 Unclassified 730
67 Ga0070693_100291388 3300005547 Bacteria 1097
68 Ga0070693_100767348 3300005547 Bacteria 712
69 Ga0070665_100010410 3300005548 Bacteria 9411
70 Ga0070665_100583315 3300005548 Bacteria 1131
71 Ga0068855_100010049 3300005563 Bacteria 11406
72 Ga0068855_101139220 3300005563 Bacteria 814
73 Ga0070664_100001442 3300005564 Bacteria 18959
74 Ga0068854_100132700 3300005578 Bacteria 1903
75 Ga0068856_100004162 3300005614 Bacteria 14450
76 Ga0068856_100098437 3300005614 Bacteria 2915
77 Ga0070702_100044578 3300005615 Bacteria 2505
78 Ga0070702_100589697 3300005615 Bacteria 831
79 Ga0068852_100088156 3300005616 Bacteria 2771
80 Ga0068852_100300284 3300005616 Bacteria 1554
81 Ga0068852_100461137 3300005616 Bacteria 1260
82 Ga0068859_100462661 3300005617 Bacteria 1364
83 Ga0068859_100747323 3300005617 Bacteria 1067
84 Ga0068864_100009948 3300005618 Bacteria 7846
85 Ga0068864_100211617 3300005618 Bacteria 1786
86 Ga0068864_100652546 3300005618 Bacteria 1025
87 Ga0068864_101868306 3300005618 Unclassified 606
88 Ga0068866_11085375 3300005718 Unclassified 573
89 Ga0068861_100283912 3300005719 Bacteria 1427
90 Ga0068861_100649522 3300005719 Bacteria 974
91 Ga0068851_10125736 3300005834 Bacteria 1382
92 Ga0068863_100012522 3300005841 Bacteria 8185
93 Ga0068863_100071994 3300005841 Bacteria 3270
94 Ga0068863_100211385 3300005841 Bacteria 1868
95 Ga0068863_100509515 3300005841 Bacteria 1185
96 Ga0068862_100417640 3300005844 Bacteria 1258
97 Ga0068862_100569180 3300005844 Bacteria 1084
98 Ga0081455_10001158 3300005937 Bacteria 33051
99 Ga0081455_10149821 3300005937 Bacteria 1800
100 Ga0070717_10031635 3300006028 Bacteria 4258
101 Ga0075363_100259728 3300006048 Bacteria 1002
102 Ga0075367_10339672 3300006178 Bacteria 947
103 Ga0097621_100005144 3300006237 Bacteria 9191
104 Ga0097621_100106214 3300006237 Bacteria 2368
105 Ga0097621_100628097 3300006237 Bacteria 984
106 Ga0097621_101079040 3300006237 Unclassified 753
107 Ga0075370_10174524 3300006353 Bacteria 1264
108 Ga0068871_100005657 3300006358 Bacteria 8767
109 Ga0068871_100041761 3300006358 Bacteria 3679
110 Ga0068871_100042229 3300006358 Unclassified 3660
111 Ga0068871_100623350 3300006358 Bacteria 982
112 Ga0068865_100001445 3300006881 Bacteria 13823
113 Ga0068865_100029975 3300006881 Bacteria 3615
114 Ga0068865_100044012 3300006881 Bacteria 3053
115 Ga0097620_100462632 3300006931 Bacteria 1364
116 Ga0097620_100747388 3300006931 Bacteria 1067
117 Ga0105240_10000013 3300009093 Bacteria 483458
118 Ga0105240_10011701 3300009093 Bacteria 12192
119 Ga0105240_10066165 3300009093 Bacteria 4484
120 Ga0111539_10288326 3300009094 Bacteria 1910
121 Ga0111539_10369555 3300009094 Bacteria 1669
122 Ga0105245_10027980 3300009098 Bacteria 4968
123 Ga0105245_10909675 3300009098 Bacteria 922
124 Ga0105247_10231706 3300009101 Bacteria 1254
125 Ga0105241_10017593 3300009174 Bacteria 5256
126 Ga0105242_10000545 3300009176 Bacteria 29854
127 Ga0105242_10702896 3300009176 Bacteria 989
128 Ga0105248_10130794 3300009177 Bacteria 2832
129 Ga0105248_10724257 3300009177 Bacteria 1122
130 Ga0105237_10004144 3300009545 Bacteria 16891
131 Ga0105237_10179924 3300009545 Bacteria 2115
132 Ga0105237_10693392 3300009545 Bacteria 1025
133 Ga0105238_10019625 3300009551 Bacteria 6883
134 Ga0105249_10010965 3300009553 Bacteria 7965
135 Ga0105249_10653388 3300009553 Bacteria 1109
136 Ga0105239_10006528 3300010375 Bacteria 13515
137 Ga0105239_10613253 3300010375 Bacteria 1242
138 Ga0105246_10104611 3300011119 Bacteria 2068
139 Ga0105246_10333190 3300011119 Bacteria 1238
140 Ga0157337_1006862 3300012483 Bacteria 800
141 Ga0157370_10000836 3300013104 Bacteria 39048
142 Ga0157370_10404376 3300013104 Bacteria 1256
143 Ga0157369_10000028 3300013105 Bacteria 213910
144 Ga0157369_10222169 3300013105 Bacteria 1977
145 Ga0157374_10111568 3300013296 Bacteria 2631
146 Ga0157378_10528214 3300013297 Bacteria 1182
147 Ga0157378_10604513 3300013297 Bacteria 1108
148 Ga0163162_10008430 3300013306 Bacteria 10050
149 Ga0163162_10026670 3300013306 Bacteria 5712
150 Ga0163162_10064510 3300013306 Bacteria 3707
151 Ga0157372_10080562 3300013307 Bacteria 3685
152 Ga0157375_10053778 3300013308 Bacteria 3963
153 Ga0157375_10096597 3300013308 Bacteria 3028
154 Ga0157375_10372082 3300013308 Bacteria 1595
155 Ga0157375_10901841 3300013308 Bacteria 1028
156 Ga0163163_10005444 3300014325 Bacteria 11007
157 Ga0163163_10043339 3300014325 Bacteria 4411
158 Ga0163163_10926413 3300014325 Bacteria 935
159 Ga0157380_10678703 3300014326 Bacteria 1032
160 Ga0157380_10858738 3300014326 Bacteria 930
161 Ga0157376_10001641 3300014969 Bacteria 14846
162 Ga0157376_10002363 3300014969 Bacteria 12736
163 Ga0157376_10015699 3300014969 Bacteria 5729
164 Ga0157376_10221690 3300014969 Bacteria 1752
165 Ga0182007_10001753 3300015262 Bacteria 11410
166 Ga0182005_1003219 3300015265 Bacteria 5585
167 Ga0163161_10129963 3300017792 Bacteria 1899
168 Ga0213876_10029072 3300021384 Bacteria 2915
169 Ga0209677_100682 3300025253 Bacteria 17454
170 Ga0209233_1000388 3300025261 Bacteria 37536
171 Ga0209673_1002880 3300025273 Bacteria 10927
172 Ga0209130_1000058 3300025284 Bacteria 210250
173 Ga0207426_1000131 3300025302 Bacteria 210250
174 Ga0207426_1001967 3300025302 Bacteria 14592
175 Ga0209051_1005526 3300025303 Bacteria 7367
176 Ga0207710_10118201 3300025900 Bacteria 1264
177 Ga0207647_10140439 3300025904 Bacteria 1416
178 Ga0207654_10011956 3300025911 Bacteria 4438
179 Ga0207695_10000044 3300025913 Bacteria 440819
180 Ga0207695_10007286 3300025913 Bacteria 14128
181 Ga0207695_10016243 3300025913 Bacteria 8724
182 Ga0207671_10002002 3300025914 Bacteria 22452
183 Ga0207663_10614154 3300025916 Bacteria 855
184 Ga0207662_10151723 3300025918 Bacteria 1474
185 Ga0207662_10725055 3300025918 Bacteria 698
186 Ga0207649_10000814 3300025920 Bacteria 20063
187 Ga0207681_10070241 3300025923 Bacteria 2438
188 Ga0207681_10514145 3300025923 Bacteria 982
189 Ga0207681_10648232 3300025923 Bacteria 875
190 Ga0207694_10010448 3300025924 Bacteria 7001
191 Ga0207650_10079115 3300025925 Bacteria 2489
192 Ga0207650_10153069 3300025925 Bacteria 1821
193 Ga0207659_10368009 3300025926 Bacteria 1196
194 Ga0207659_11414211 3300025926 Bacteria 596
195 Ga0207687_10169102 3300025927 Bacteria 1684
196 Ga0207700_10515916 3300025928 Bacteria 1059
197 Ga0207644_10955084 3300025931 Unclassified 719
198 Ga0207690_10000712 3300025932 Bacteria 21429
199 Ga0207686_10010773 3300025934 Bacteria 4983
200 Ga0207686_10406007 3300025934 Bacteria 1039
201 Ga0207670_10040098 3300025936 Bacteria 3071
202 Ga0207670_10084529 3300025936 Bacteria 2228
203 Ga0207670_10269091 3300025936 Bacteria 1324
204 Ga0207670_10375094 3300025936 Bacteria 1132
205 Ga0207669_11206890 3300025937 Bacteria 641
206 Ga0207704_10000952 3300025938 Bacteria 12799
207 Ga0207704_10021331 3300025938 Bacteria 3448
208 Ga0207704_10160459 3300025938 Bacteria 1599
209 Ga0207704_10980194 3300025938 Unclassified 714
210 Ga0207691_10188811 3300025940 Bacteria 1798
211 Ga0207711_10143613 3300025941 Bacteria 2149
212 Ga0207711_10949024 3300025941 Bacteria 799
213 Ga0207689_10011449 3300025942 Bacteria 7601
214 Ga0207689_10030966 3300025942 Bacteria 4457
215 Ga0207689_10165976 3300025942 Bacteria 1819
216 Ga0207679_10000430 3300025945 Bacteria 29840
217 Ga0207667_10031702 3300025949 Bacteria 5704
218 Ga0207667_10185754 3300025949 Bacteria 2134
219 Ga0207667_10672252 3300025949 Bacteria 1040
220 Ga0207651_10128420 3300025960 Bacteria 1936
221 Ga0207712_10030071 3300025961 Bacteria 3649
222 Ga0207712_10243847 3300025961 Bacteria 1449
223 Ga0207712_10371463 3300025961 Bacteria 1194
224 Ga0207668_10629492 3300025972 Bacteria 937
225 Ga0207668_10864087 3300025972 Bacteria 804
226 Ga0207658_11427766 3300025986 Bacteria 633
227 Ga0207677_10244836 3300026023 Bacteria 1453
228 Ga0207677_10455251 3300026023 Bacteria 1097
229 Ga0207677_10567638 3300026023 Bacteria 991
230 Ga0207639_10538381 3300026041 Bacteria 1071
231 Ga0207639_11182755 3300026041 Bacteria 718
232 Ga0207678_10041050 3300026067 Bacteria 4011
233 Ga0207678_10312898 3300026067 Bacteria 1350
234 Ga0207708_10039518 3300026075 Bacteria 3595
235 Ga0207708_10211451 3300026075 Unclassified 1551
236 Ga0207702_10015497 3300026078 Bacteria 6312
237 Ga0207641_10004578 3300026088 Bacteria 11951
238 Ga0207641_10048240 3300026088 Bacteria 3594
239 Ga0207641_10635885 3300026088 Bacteria 1047
240 Ga0207648_10027506 3300026089 Bacteria 5048
241 Ga0207648_10571379 3300026089 Bacteria 1040
242 Ga0207676_10069861 3300026095 Bacteria 2814
243 Ga0207676_10075404 3300026095 Bacteria 2721
244 Ga0207676_10406583 3300026095 Bacteria 1273
245 Ga0207675_100012134 3300026118 Bacteria 8051
246 Ga0207675_100449516 3300026118 Bacteria 1277
247 Ga0207683_10015085 3300026121 Bacteria 6576
248 Ga0207683_10027254 3300026121 Bacteria 4937
249 Ga0207683_10136398 3300026121 Bacteria 2209
250 Ga0207683_10278426 3300026121 Bacteria 1529
251 Ga0207683_10386117 3300026121 Bacteria 1287
252 Ga0207698_10195899 3300026142 Bacteria 1805
253 Ga0207698_10212922 3300026142 Bacteria 1740
254 Ga0207698_10298654 3300026142 Bacteria 1498
255 Ga0207698_11315576 3300026142 Bacteria 737
256 Ga0207428_10287920 3300027907 Bacteria 1218
257 Ga0268266_10008439 3300028379 Bacteria 9159
258 Ga0268266_10045063 3300028379 Bacteria 3772
259 Ga0268266_10081528 3300028379 Bacteria 2821
260 Ga0268266_10526247 3300028379 Bacteria 1131
261 Ga0268266_10736272 3300028379 Bacteria 951
262 Ga0268265_10492995 3300028380 Bacteria 1153
263 Ga0265319_1000203 3300028563 Bacteria 44998
264 Ga0265334_10011154 3300028573 Bacteria 3788
265 Ga0265334_10083055 3300028573 Bacteria 1178
266 Ga0265318_10000627 3300028577 Bacteria 24402
267 Ga0265318_10014623 3300028577 Bacteria 3290
268 Ga0307517_10095970 3300028786 Bacteria 2380
269 Ga0265338_10156941 3300028800 Bacteria 1761
270 Ga0265338_10293763 3300028800 Bacteria 1183
271 Ga0265330_10001200 3300031235 Bacteria 15356
272 Ga0265330_10032454 3300031235 Bacteria 2340
273 Ga0265332_10002974 3300031238 Bacteria 8311
274 Ga0265332_10065942 3300031238 Bacteria 1545
275 Ga0265320_10000541 3300031240 Bacteria 29187
276 Ga0265320_10002031 3300031240 Bacteria 14270
277 Ga0265320_10020535 3300031240 Bacteria 3577
278 Ga0265325_10000229 3300031241 Bacteria 39809
279 Ga0265325_10002178 3300031241 Bacteria 13330
280 Ga0265325_10102402 3300031241 Unclassified 1400
281 Ga0265329_10000717 3300031242 Bacteria 16827
282 Ga0265340_10011423 3300031247 Bacteria 4717
283 Ga0265339_10036715 3300031249 Bacteria 2740
284 Ga0265331_10001478 3300031250 Bacteria 17328
285 Ga0265331_10148918 3300031250 Bacteria 1063
286 Ga0265316_10000254 3300031344 Bacteria 60899
287 Ga0265316_10004326 3300031344 Bacteria 14160
288 Ga0307513_10261277 3300031456 Bacteria 1521
289 Ga0307509_10000754 3300031507 Bacteria 55284
290 Ga0307509_10049125 3300031507 Bacteria 4526
291 Ga0265313_10000227 3300031595 Bacteria 60770
292 Ga0265313_10004787 3300031595 Bacteria 10199
293 Ga0307508_10043705 3300031616 Bacteria 4013
294 Ga0307508_10242866 3300031616 Bacteria 1398
295 Ga0307508_10520808 3300031616 Unclassified 785
296 Ga0265314_10000325 3300031711 Bacteria 67234
297 Ga0265314_10178846 3300031711 Bacteria 1273
298 Ga0265342_10003669 3300031712 Bacteria 12466
299 Ga0265342_10023882 3300031712 Bacteria 3864
300 Ga0307516_10216111 3300031730 Bacteria 1629
301 Ga0373939_0123530 3300035114 Bacteria 916
302 Ga0373941_0000346 3300035115 Bacteria 9108
303 Ga0373954_0157034 3300035118 Bacteria 1112
304 Ga0373955_0019096 3300035172 Bacteria 3420
305 Ga0373961_0000079 3300035241 Bacteria 52109
306 Ga0373962_0237890 3300035242 Bacteria 628
307 Ga0373933_0582535 3300035724 Bacteria 734
308 Ga0373937_0006742 3300036401 Bacteria 9908
309 Ga0373937_0062259 3300036401 Bacteria 3430
310 Ga0373937_1570075 3300036401 Bacteria 605
311 Ga0436365_0946034 3300039437 Bacteria 9968
312 Ga0436362_0329320 3300039453 Bacteria 1776
313 Ga0451802_0695588 3300041460 Unclassified 952
314 Ga0451807_0488547 3300041486 Bacteria 2420
315 Ga0451807_1431385 3300041486 Bacteria 597
316 Ga0451807_1483411 3300041486 Bacteria 695
317 Ga0451841_0843771 3300041498 Unclassified 753
318 Ga0451849_1129366 3300041505 Bacteria 1394
319 Ga0451853_0260437 3300041512 Bacteria 3157
320 Ga0451853_2265290 3300041512 Bacteria 578
321 Ga0466960_0006804 3300044901 Bacteria 4606
322 Ga0495590_0074954 3300046457 Unclassified 1190
323 Ga0495638_0000634 3300046460 Bacteria 38683
324 Ga0495651_0920592 3300046462 Bacteria 534
325 Ga0495580_0217975 3300046472 Bacteria 1312
326 Ga0495582_0042998 3300046473 Bacteria 2488
327 Ga0495639_0223429 3300046475 Bacteria 926
328 Ga0495585_0246750 3300046492 Bacteria 892
329 Ga0495607_0287027 3300046501 Bacteria 779
330 Ga0495583_0019978 3300046506 Bacteria 3483
331 Ga0495616_0228974 3300046513 Bacteria 806
332 Ga0495632_0000347 3300046519 Bacteria 44084
333 Ga0495643_0152819 3300046522 Bacteria 1141
334 Ga0495642_0332867 3300046528 Bacteria 667
335 Ga0495654_0326915 3300046530 Bacteria 621
336 Ga0495609_0235385 3300046538 Bacteria 757
337 Ga0495645_0513459 3300046543 Bacteria 747
338 Ga0495625_0030748 3300046660 Bacteria 4002
339 Ga0495647_0165260 3300046681 Bacteria 956
340 Ga0495658_0078440 3300046683 Bacteria 1933
341 Ga0495649_0383803 3300046694 Bacteria 707
342 Ga0495660_0276743 3300046810 Bacteria 769
343 Ga0495604_0228143 3300047317 Bacteria 1279
344 Ga0495674_0858737 3300047319 Bacteria 703
345 Ga0495672_0291009 3300047320 Bacteria 777
346 Ga0495680_0286953 3300047322 Unclassified 1159
347 Ga0495680_0499459 3300047322 Bacteria 826
348 Ga0495687_161984 3300047443 Bacteria 751
349 Ga0496100_0016330 3300048903 Bacteria 4358
350 Ga0496100_0294283 3300048903 Bacteria 1213
351 Ga0496102_0020129 3300048905 Bacteria 5891
352 Ga0496103_0033028 3300048906 Bacteria 3160
353 Ga0496104_0000020 3300048907 Bacteria 247296
354 Ga0496105_0000015 3300048908 Bacteria 218758
355 Ga0496106_1343151 3300048909 Bacteria 554
356 Ga0496107_0414744 3300048910 Bacteria 1001
357 Ga0496116_0050926 3300048919 Bacteria 2754
358 Ga0496116_0322053 3300048919 Unclassified 723
359 Ga0496117_0002721 3300048920 Bacteria 21729
360 Ga0496118_0005053 3300048921 Bacteria 15209
361 Ga0496118_0386130 3300048921 Bacteria 733
362 Ga0496119_0093750 3300048922 Bacteria 1700
363 Ga0496119_0174755 3300048922 Unclassified 1131
364 Ga0496119_0177009 3300048922 Bacteria 1121
365 Ga0496120_0054270 3300048923 Bacteria 2272
366 Ga0496120_0075944 3300048923 Bacteria 1832
367 Ga0496121_0003679 3300048924 Bacteria 21530
368 Ga0496121_0074567 3300048924 Bacteria 2713
369 Ga0496122_0027733 3300048925 Bacteria 4831
370 Ga0496123_0018502 3300048926 Bacteria 5538
371 Ga0496124_0019542 3300048927 Bacteria 6298
372 Ga0496125_0094322 3300048928 Bacteria 2230
373 Ga0496125_0134814 3300048928 Bacteria 1729
374 Ga0496126_0001965 3300048929 Bacteria 29124
375 Ga0496126_0283133 3300048929 Bacteria 1372
376 Ga0501031_0201963 3300049568 Bacteria 1297
377 Ga0501032_0025247 3300049569 Bacteria 4097
378 Ga0501032_0066113 3300049569 Bacteria 2416
379 Ga0501032_0402907 3300049569 Bacteria 879
380 Ga0501033_0084803 3300049570 Bacteria 2321
381 Ga0501033_0752887 3300049570 Bacteria 660
382 Ga0501034_0000286 3300049571 Bacteria 90126
383 Ga0501034_0045816 3300049571 Bacteria 4418
384 Ga0501034_0133325 3300049571 Bacteria 2466
385 Ga0501034_0236608 3300049571 Bacteria 1773
386 Ga0501036_0021316 3300049572 Bacteria 5445
387 Ga0501036_0057571 3300049572 Bacteria 3292
388 Ga0501037_0102555 3300049573 Bacteria 2063
389 Ga0501037_0161586 3300049573 Bacteria 1596
390 Ga0501038_0124206 3300049574 Bacteria 2125
391 Ga0501038_0137419 3300049574 Bacteria 2001
392 Ga0501039_0075146 3300049575 Bacteria 2626
393 Ga0501039_0111906 3300049575 Bacteria 2134
394 Ga0501039_0477293 3300049575 Bacteria 979
395 Ga0501042_0108119 3300049578 Bacteria 2002
396 Ga0501042_0206858 3300049578 Bacteria 1415
397 Ga0501043_0015351 3300049579 Bacteria 5999
398 Ga0501043_0057823 3300049579 Bacteria 3044
399 Ga0501043_0080954 3300049579 Bacteria 2551
400 Ga0501046_0079402 3300049580 Bacteria 2536
401 Ga0501046_0135117 3300049580 Bacteria 1868
402 Ga0501047_0129450 3300049581 Bacteria 2404
403 Ga0501047_0146243 3300049581 Bacteria 2240
404 Ga0501047_0372545 3300049581 Bacteria 1263
405 Ga0501047_0401512 3300049581 Bacteria 1203
406 Ga0501048_0095727 3300049582 Bacteria 2094
407 Ga0501048_0337918 3300049582 Bacteria 1073
408 Ga0501067_0114872 3300049583 Bacteria 1497
409 Ga0501067_0244513 3300049583 Unclassified 998
410 Ga0501068_0027907 3300049584 Bacteria 3336
411 Ga0501068_0093398 3300049584 Bacteria 1858
412 Ga0501068_0266844 3300049584 Bacteria 1092
413 Ga0501069_0219467 3300049585 Bacteria 1104
414 Ga0501070_0032885 3300049586 Bacteria 4338
415 Ga0501070_0056026 3300049586 Bacteria 3267
416 Ga0501070_0072003 3300049586 Bacteria 2861
417 Ga0501070_0117882 3300049586 Bacteria 2193
418 Ga0501070_0127105 3300049586 Bacteria 2106
419 Ga0501071_0008806 3300049587 Bacteria 6686
420 Ga0501072_0045272 3300049588 Bacteria 3459
421 Ga0501072_0875474 3300049588 Unclassified 702
422 Ga0501073_0044435 3300049589 Bacteria 3131
423 Ga0501073_0153581 3300049589 Bacteria 1595
424 Ga0501073_0155024 3300049589 Bacteria 1587
425 Ga0501073_0171761 3300049589 Bacteria 1500
426 Ga0501074_0050369 3300049590 Bacteria 3006
427 Ga0501074_0150892 3300049590 Bacteria 1661
428 Ga0501075_0183383 3300049591 Bacteria 1597
429 Ga0501076_0779479 3300049592 Unclassified 789
430 Ga0501077_0196584 3300049593 Bacteria 1281
431 Ga0501235_033940 3300049669 Bacteria 1157
432 Ga0501080_0104001 3300049742 Bacteria 2633
433 Ga0501080_0230878 3300049742 Bacteria 1691
434 Ga0501080_0273392 3300049742 Bacteria 1537
435 Ga0501081_0187737 3300049743 Bacteria 1496
436 Ga0501083_0013191 3300049744 Bacteria 5775
437 Ga0501083_0047995 3300049744 Bacteria 2883
438 Ga0501083_0053994 3300049744 Bacteria 2697
439 Ga0501083_0065931 3300049744 Bacteria 2411
440 Ga0501035_0001276 3300049822 Bacteria 26011
441 Ga0501035_0096122 3300049822 Bacteria 2603
442 Ga0501035_0114747 3300049822 Bacteria 2358
443 Ga0501035_0165039 3300049822 Bacteria 1915
444 Ga0501035_0233761 3300049822 Bacteria 1566
445 Ga0501044_0023519 3300049823 Bacteria 6554
446 Ga0501044_0055202 3300049823 Bacteria 4080
447 Ga0501044_0230855 3300049823 Bacteria 1798
448 Ga0501044_0317829 3300049823 Bacteria 1482
449 Ga0501045_0074948 3300049824 Bacteria 2492
450 nmdc:mga08y16_1048117_c1 3300050511 Bacteria 793
451 nmdc:mga08y16_97519_c1 3300050511 Bacteria 3061
452 nmdc:mga0n895_293795_c1 3300050512 Bacteria 1647
453 Ga0500610_0016585 3300053079 Bacteria 3516
454 Ga0500635_0006052 3300053080 Bacteria 3214
455 Ga0495595_0239353 3300053084 Bacteria 908
456 Ga0495619_0081200 3300053085 Bacteria 2183
457 Ga0500578_0584892 3300053086 Bacteria 616
458 Ga0500646_0009008 3300053090 Bacteria 2555
459 Ga0500647_0243991 3300053091 Unclassified 793
460 Ga0500566_0000429 3300053094 Bacteria 23395
461 Ga0500566_0002776 3300053094 Bacteria 10440
462 Ga0500566_0152723 3300053094 Bacteria 1212
463 Ga0500640_004512 3300053095 Bacteria 5066
464 Ga0500650_0106395 3300053098 Unclassified 1311
465 Ga0500554_000259 3300053102 Bacteria 11452
466 Ga0500562_049332 3300053108 Bacteria 1125
467 Ga0500569_014069 3300053109 Bacteria 1974
468 Ga0500572_003673 3300053111 Bacteria 3486
469 Ga0500594_0006596 3300053118 Bacteria 2612
470 Ga0500595_000356 3300053119 Bacteria 29768
471 Ga0500614_000285 3300053123 Bacteria 13153
472 Ga0500614_078554 3300053123 Unclassified 919
473 Ga0500614_247715 3300053123 Bacteria 555
474 Ga0500617_079775 3300053124 Unclassified 1420
475 Ga0500618_007011 3300053125 Bacteria 3252
476 Ga0500618_055691 3300053125 Bacteria 891
477 Ga0500559_0012709 3300053136 Bacteria 3574
478 Ga0500568_0000543 3300053139 Bacteria 27846
479 Ga0500573_0258914 3300053140 Bacteria 892
480 Ga0500603_000989 3300053150 Bacteria 6695
481 Ga0500616_0003759 3300053153 Bacteria 11303
482 Ga0500622_0436698 3300053156 Bacteria 524
483 Ga0500636_0147230 3300053177 Bacteria 1297
484 Ga0500637_0339892 3300053178 Unclassified 803
485 Ga0500645_063268 3300053730 Bacteria 1068
486 Ga0500596_008097 3300053735 Bacteria 1687
487 Ga0501084_0254464 3300054114 Bacteria 1482
488 Ga0501084_1068498 3300054114 Bacteria 678
489 Ga0501082_0135876 3300060353 Bacteria 2133
490 Ga0501082_0273478 3300060353 Bacteria 1470
491 Ga0501082_0430358 3300060353 Bacteria 1152

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025303 Ga0209051_1005526 Ga0209051_10055266 151
2 3300005353 Ga0070669_100634824 Ga0070669_1006348241 152
3 3300025923 Ga0207681_10648232 Ga0207681_106482321 152
4 3300025928 Ga0207700_10515916 Ga0207700_105159162 152
5 3300046528 Ga0495642_0332867 Ga0495642_0332867_188_649 153
6 3300003354 JGI25160J50197_1024500 JGI25160J50197_10245002 155
7 3300025273 Ga0209673_1002880 Ga0209673_10028806 155
8 3300025302 Ga0207426_1001967 Ga0207426_100196714 155
9 3300041460 Ga0451802_0695588 Ga0451802_0695588_384_866 156
10 3300041498 Ga0451841_0843771 Ga0451841_0843771_248_730 156
11 3300041505 Ga0451849_1129366 Ga0451849_1129366_45_527 156
12 3300041512 Ga0451853_0260437 Ga0451853_0260437_141_623 156
13 3300005367 Ga0070667_100805530 Ga0070667_1008055302 157
14 3300005441 Ga0070700_100178410 Ga0070700_1001784102 157
15 3300005455 Ga0070663_100009029 Ga0070663_1000090292 157
16 3300006237 Ga0097621_101079040 Ga0097621_1010790401 157
17 3300014325 Ga0163163_10043339 Ga0163163_100433392 157
18 3300026067 Ga0207678_10041050 Ga0207678_100410501 157
19 3300026075 Ga0207708_10211451 Ga0207708_102114511 157
20 3300053156 Ga0500622_0436698 Ga0500622_0436698_19_495 158
21 3300044901 Ga0466960_0006804 Ga0466960_0006804_66_569 163
22 3300049588 Ga0501072_0875474 Ga0501072_0875474_162_665 163
23 iso_pu_bacteria 3005409236 3005415897 163
24 3300005334 Ga0068869_100042388 Ga0068869_1000423884 164
25 3300005340 Ga0070689_100078057 Ga0070689_1000780573 164
26 3300005340 Ga0070689_100236166 Ga0070689_1002361662 164
27 3300005343 Ga0070687_100016832 Ga0070687_1000168322 164
28 3300005347 Ga0070668_100290905 Ga0070668_1002909052 164
29 3300005347 Ga0070668_101250136 Ga0070668_1012501361 164
30 3300005365 Ga0070688_100262871 Ga0070688_1002628712 164
31 3300005438 Ga0070701_10111002 Ga0070701_101110022 164
32 3300005466 Ga0070685_10169716 Ga0070685_101697162 164
33 3300005471 Ga0070698_100726091 Ga0070698_1007260912 164
34 3300005544 Ga0070686_100458736 Ga0070686_1004587362 164
35 3300005544 Ga0070686_100872307 Ga0070686_1008723072 164
36 3300005547 Ga0070693_100767348 Ga0070693_1007673481 164
37 3300005563 Ga0068855_100010049 Ga0068855_1000100492 164
38 3300005614 Ga0068856_100004162 Ga0068856_1000041623 164
39 3300005614 Ga0068856_100098437 Ga0068856_1000984373 164
40 3300005615 Ga0070702_100044578 Ga0070702_1000445782 164
41 3300005615 Ga0070702_100589697 Ga0070702_1005896971 164
42 3300005617 Ga0068859_100462661 Ga0068859_1004626612 164
43 3300005618 Ga0068864_100009948 Ga0068864_1000099486 164
44 3300005718 Ga0068866_11085375 Ga0068866_110853751 164
45 3300005719 Ga0068861_100283912 Ga0068861_1002839122 164
46 3300005844 Ga0068862_100417640 Ga0068862_1004176402 164
47 3300005937 Ga0081455_10149821 Ga0081455_101498211 164
48 3300006028 Ga0070717_10031635 Ga0070717_100316352 164
49 3300006358 Ga0068871_100042229 Ga0068871_1000422293 164
50 3300006931 Ga0097620_100462632 Ga0097620_1004626322 164
51 3300009094 Ga0111539_10288326 Ga0111539_102883262 164
52 3300013297 Ga0157378_10604513 Ga0157378_106045132 164
53 3300013308 Ga0157375_10901841 Ga0157375_109018412 164
54 3300014326 Ga0157380_10678703 Ga0157380_106787032 164
55 3300014326 Ga0157380_10858738 Ga0157380_108587382 164
56 3300014969 Ga0157376_10221690 Ga0157376_102216902 164
57 3300025918 Ga0207662_10151723 Ga0207662_101517232 164
58 3300025923 Ga0207681_10514145 Ga0207681_105141452 164
59 3300025936 Ga0207670_10040098 Ga0207670_100400982 164
60 3300025936 Ga0207670_10084529 Ga0207670_100845293 164
61 3300025936 Ga0207670_10375094 Ga0207670_103750942 164
62 3300025942 Ga0207689_10030966 Ga0207689_100309662 164
63 3300025949 Ga0207667_10031702 Ga0207667_100317025 164
64 3300025961 Ga0207712_10243847 Ga0207712_102438471 164
65 3300025972 Ga0207668_10864087 Ga0207668_108640872 164
66 3300026078 Ga0207702_10015497 Ga0207702_100154972 164
67 3300026095 Ga0207676_10075404 Ga0207676_100754041 164
68 3300026118 Ga0207675_100012134 Ga0207675_1000121342 164
69 3300026121 Ga0207683_10386117 Ga0207683_103861172 164
70 3300028379 Ga0268266_10045063 Ga0268266_100450633 164
71 3300028563 Ga0265319_1000203 Ga0265319_100020338 164
72 3300028573 Ga0265334_10083055 Ga0265334_100830551 164
73 3300028577 Ga0265318_10000627 Ga0265318_1000062711 164
74 3300028577 Ga0265318_10014623 Ga0265318_100146232 164
75 3300028786 Ga0307517_10095970 Ga0307517_100959701 164
76 3300028800 Ga0265338_10293763 Ga0265338_102937631 164
77 3300031235 Ga0265330_10001200 Ga0265330_100012008 164
78 3300031235 Ga0265330_10032454 Ga0265330_100324542 164
79 3300031238 Ga0265332_10002974 Ga0265332_100029742 164
80 3300031238 Ga0265332_10065942 Ga0265332_100659421 164
81 3300031240 Ga0265320_10000541 Ga0265320_100005413 164
82 3300031240 Ga0265320_10002031 Ga0265320_1000203110 164
83 3300031240 Ga0265320_10020535 Ga0265320_100205352 164
84 3300031241 Ga0265325_10002178 Ga0265325_100021785 164
85 3300031241 Ga0265325_10102402 Ga0265325_101024021 164
86 3300031242 Ga0265329_10000717 Ga0265329_100007177 164
87 3300031247 Ga0265340_10011423 Ga0265340_100114235 164
88 3300031250 Ga0265331_10001478 Ga0265331_100014783 164
89 3300031250 Ga0265331_10148918 Ga0265331_101489182 164
90 3300031344 Ga0265316_10000254 Ga0265316_1000025440 164
91 3300031344 Ga0265316_10004326 Ga0265316_100043269 164
92 3300031507 Ga0307509_10000754 Ga0307509_1000075437 164
93 3300031507 Ga0307509_10049125 Ga0307509_100491254 164
94 3300031595 Ga0265313_10004787 Ga0265313_100047875 164
95 3300031616 Ga0307508_10043705 Ga0307508_100437052 164
96 3300031616 Ga0307508_10242866 Ga0307508_102428662 164
97 3300031711 Ga0265314_10000325 Ga0265314_1000032553 164
98 3300031711 Ga0265314_10178846 Ga0265314_101788462 164
99 3300031712 Ga0265342_10003669 Ga0265342_100036699 164
100 3300031712 Ga0265342_10023882 Ga0265342_100238824 164
101 3300035114 Ga0373939_0123530 Ga0373939_0123530_264_770 164
102 3300035172 Ga0373955_0019096 Ga0373955_0019096_806_1312 164
103 3300035242 Ga0373962_0237890 Ga0373962_0237890_79_585 164
104 3300035724 Ga0373933_0582535 Ga0373933_0582535_211_717 164
105 3300036401 Ga0373937_0006742 Ga0373937_0006742_3627_4139 164
106 3300036401 Ga0373937_0062259 Ga0373937_0062259_325_831 164
107 3300041486 Ga0451807_0488547 Ga0451807_0488547_605_1114 164
108 3300041486 Ga0451807_1431385 Ga0451807_1431385_79_585 164
109 3300041486 Ga0451807_1483411 Ga0451807_1483411_159_665 164
110 3300046457 Ga0495590_0074954 Ga0495590_0074954_257_763 164
111 3300046475 Ga0495639_0223429 Ga0495639_0223429_293_799 164
112 3300047317 Ga0495604_0228143 Ga0495604_0228143_352_867 164
113 3300047322 Ga0495680_0286953 Ga0495680_0286953_190_702 164
114 3300048903 Ga0496100_0016330 Ga0496100_0016330_2420_2926 164
115 3300048909 Ga0496106_1343151 Ga0496106_1343151_25_531 164
116 3300048919 Ga0496116_0322053 Ga0496116_0322053_152_667 164
117 3300048922 Ga0496119_0174755 Ga0496119_0174755_39_554 164
118 3300048929 Ga0496126_0001965 Ga0496126_0001965_9119_9619 164
119 3300049589 Ga0501073_0155024 Ga0501073_0155024_607_1116 164
120 3300049593 Ga0501077_0196584 Ga0501077_0196584_749_1258 164
121 3300049669 Ga0501235_033940 Ga0501235_033940_152_658 164
122 3300050511 nmdc:mga08y16_1048117_c1 nmdc:mga08y16_1048117_c1_28_540 164
123 3300053080 Ga0500635_0006052 Ga0500635_0006052_1929_2435 164
124 3300053090 Ga0500646_0009008 Ga0500646_0009008_1126_1632 164
125 3300053091 Ga0500647_0243991 Ga0500647_0243991_56_562 164
126 3300053094 Ga0500566_0000429 Ga0500566_0000429_21426_21932 164
127 3300053094 Ga0500566_0002776 Ga0500566_0002776_4141_4647 164
128 3300053095 Ga0500640_004512 Ga0500640_004512_831_1337 164
129 3300053098 Ga0500650_0106395 Ga0500650_0106395_154_660 164
130 3300053102 Ga0500554_000259 Ga0500554_000259_753_1259 164
131 3300053108 Ga0500562_049332 Ga0500562_049332_255_761 164
132 3300053111 Ga0500572_003673 Ga0500572_003673_2005_2511 164
133 3300053119 Ga0500595_000356 Ga0500595_000356_20509_21015 164
134 3300053123 Ga0500614_000285 Ga0500614_000285_4330_4836 164
135 3300053124 Ga0500617_079775 Ga0500617_079775_898_1404 164
136 3300053136 Ga0500559_0012709 Ga0500559_0012709_1531_2037 164
137 3300053150 Ga0500603_000989 Ga0500603_000989_3273_3779 164
138 iso_pu_bacteria 2510917022 2511134309 164
139 iso_pu_bacteria 2524023209 2524458697 164
140 iso_pu_bacteria 2582581307 2585271939 164
141 iso_pu_bacteria 2582581315 2585327553 164
142 iso_pu_bacteria 2582581316 2585333904 164
143 iso_pu_bacteria 2585427531 2585563517 164
144 iso_pu_bacteria 2585427608 2585897090 164
145 iso_pu_bacteria 2585427609 2585908978 164
146 iso_pu_bacteria 2585428125 2587984392 164
147 iso_pu_bacteria 2775507266 2778179119 164
148 iso_pu_bacteria 2842298080 2842300040 164
149 iso_pu_bacteria 2842357229 2842358951 164
150 iso_pu_bacteria 2842509118 2842511466 164
151 iso_pu_bacteria 2852387548 2852391995 164
152 iso_pu_bacteria 8046767195 8046767482 164
153 iso_pu_bacteria 8057575449 8057581873 164
154 3300005334 Ga0068869_100150220 Ga0068869_1001502202 165
155 3300005841 Ga0068863_100012522 Ga0068863_1000125223 165
156 3300009093 Ga0105240_10000013 Ga0105240_10000013442 165
157 3300009101 Ga0105247_10231706 Ga0105247_102317061 165
158 3300009177 Ga0105248_10724257 Ga0105248_107242572 165
159 3300009545 Ga0105237_10004144 Ga0105237_100041444 165
160 3300010375 Ga0105239_10006528 Ga0105239_1000652813 165
161 3300011119 Ga0105246_10333190 Ga0105246_103331902 165
162 3300013104 Ga0157370_10000836 Ga0157370_1000083613 165
163 3300013105 Ga0157369_10222169 Ga0157369_102221692 165
164 3300013297 Ga0157378_10528214 Ga0157378_105282143 165
165 3300015262 Ga0182007_10001753 Ga0182007_100017538 165
166 3300015265 Ga0182005_1003219 Ga0182005_10032194 165
167 3300025942 Ga0207689_10165976 Ga0207689_101659762 165
168 3300026088 Ga0207641_10004578 Ga0207641_100045787 165
169 3300028800 Ga0265338_10156941 Ga0265338_101569413 165
170 3300039437 Ga0436365_0946034 Ga0436365_0946034_1943_2452 165
171 3300039453 Ga0436362_0329320 Ga0436362_0329320_1133_1642 165
172 3300046460 Ga0495638_0000634 Ga0495638_0000634_25851_26348 165
173 3300046492 Ga0495585_0246750 Ga0495585_0246750_121_618 165
174 3300046501 Ga0495607_0287027 Ga0495607_0287027_133_630 165
175 3300046506 Ga0495583_0019978 Ga0495583_0019978_2556_3053 165
176 3300046513 Ga0495616_0228974 Ga0495616_0228974_135_632 165
177 3300046522 Ga0495643_0152819 Ga0495643_0152819_277_774 165
178 3300046530 Ga0495654_0326915 Ga0495654_0326915_107_604 165
179 3300046538 Ga0495609_0235385 Ga0495609_0235385_71_568 165
180 3300046660 Ga0495625_0030748 Ga0495625_0030748_135_632 165
181 3300046694 Ga0495649_0383803 Ga0495649_0383803_128_625 165
182 3300046810 Ga0495660_0276743 Ga0495660_0276743_239_736 165
183 3300047320 Ga0495672_0291009 Ga0495672_0291009_247_744 165
184 3300047443 Ga0495687_161984 Ga0495687_161984_116_613 165
185 3300048903 Ga0496100_0294283 Ga0496100_0294283_475_972 165
186 3300048905 Ga0496102_0020129 Ga0496102_0020129_4591_5088 165
187 3300048906 Ga0496103_0033028 Ga0496103_0033028_2060_2557 165
188 3300048910 Ga0496107_0414744 Ga0496107_0414744_297_794 165
189 3300048919 Ga0496116_0050926 Ga0496116_0050926_787_1284 165
190 3300048920 Ga0496117_0002721 Ga0496117_0002721_13817_14314 165
191 3300048921 Ga0496118_0005053 Ga0496118_0005053_13817_14314 165
192 3300048921 Ga0496118_0386130 Ga0496118_0386130_159_656 165
193 3300048922 Ga0496119_0093750 Ga0496119_0093750_916_1413 165
194 3300048922 Ga0496119_0177009 Ga0496119_0177009_444_941 165
195 3300048923 Ga0496120_0054270 Ga0496120_0054270_1479_1976 165
196 3300048923 Ga0496120_0075944 Ga0496120_0075944_444_941 165
197 3300048924 Ga0496121_0003679 Ga0496121_0003679_13806_14303 165
198 3300048924 Ga0496121_0074567 Ga0496121_0074567_832_1329 165
199 3300048925 Ga0496122_0027733 Ga0496122_0027733_3612_4109 165
200 3300048926 Ga0496123_0018502 Ga0496123_0018502_815_1312 165
201 3300048928 Ga0496125_0094322 Ga0496125_0094322_624_1121 165
202 3300048928 Ga0496125_0134814 Ga0496125_0134814_708_1205 165
203 3300048929 Ga0496126_0283133 Ga0496126_0283133_423_920 165
204 3300049568 Ga0501031_0201963 Ga0501031_0201963_345_854 165
205 3300049569 Ga0501032_0025247 Ga0501032_0025247_2498_3007 165
206 3300049571 Ga0501034_0236608 Ga0501034_0236608_957_1466 165
207 3300049572 Ga0501036_0057571 Ga0501036_0057571_1259_1768 165
208 3300049573 Ga0501037_0102555 Ga0501037_0102555_1247_1756 165
209 3300049574 Ga0501038_0137419 Ga0501038_0137419_319_828 165
210 3300049578 Ga0501042_0206858 Ga0501042_0206858_690_1199 165
211 3300049579 Ga0501043_0080954 Ga0501043_0080954_1524_2033 165
212 3300049580 Ga0501046_0079402 Ga0501046_0079402_1807_2316 165
213 3300049580 Ga0501046_0135117 Ga0501046_0135117_525_1034 165
214 3300049581 Ga0501047_0129450 Ga0501047_0129450_543_1052 165
215 3300049582 Ga0501048_0095727 Ga0501048_0095727_1486_1995 165
216 3300049582 Ga0501048_0337918 Ga0501048_0337918_339_848 165
217 3300049584 Ga0501068_0266844 Ga0501068_0266844_394_903 165
218 3300049589 Ga0501073_0044435 Ga0501073_0044435_1237_1746 165
219 3300049742 Ga0501080_0104001 Ga0501080_0104001_613_1122 165
220 3300049822 Ga0501035_0096122 Ga0501035_0096122_364_873 165
221 3300049823 Ga0501044_0055202 Ga0501044_0055202_2677_3186 165
222 3300049824 Ga0501045_0074948 Ga0501045_0074948_436_945 165
223 3300053079 Ga0500610_0016585 Ga0500610_0016585_501_998 165
224 3300053086 Ga0500578_0584892 Ga0500578_0584892_13_510 165
225 3300053109 Ga0500569_014069 Ga0500569_014069_895_1392 165
226 3300053118 Ga0500594_0006596 Ga0500594_0006596_1133_1630 165
227 3300053125 Ga0500618_007011 Ga0500618_007011_1971_2468 165
228 3300053125 Ga0500618_055691 Ga0500618_055691_254_751 165
229 3300053139 Ga0500568_0000543 Ga0500568_0000543_11428_11925 165
230 3300053140 Ga0500573_0258914 Ga0500573_0258914_71_568 165
231 3300053153 Ga0500616_0003759 Ga0500616_0003759_9356_9853 165
232 3300053730 Ga0500645_063268 Ga0500645_063268_422_919 165
233 3300053735 Ga0500596_008097 Ga0500596_008097_600_1097 165
234 3300060353 Ga0501082_0135876 Ga0501082_0135876_525_1034 165
235 3300060353 Ga0501082_0273478 Ga0501082_0273478_432_941 165
236 iso_pu_bacteria 2643221643 2644240357 165
237 iso_pu_bacteria 3005452660 3005456098 165
238 iso_pu_bacteria 8005542996 8005546834 165
239 3300005338 Ga0068868_100386720 Ga0068868_1003867202 166
240 3300005366 Ga0070659_101411907 Ga0070659_1014119071 166
241 3300005466 Ga0070685_10741785 Ga0070685_107417851 166
242 3300005616 Ga0068852_100300284 Ga0068852_1003002842 166
243 3300006048 Ga0075363_100259728 Ga0075363_1002597282 166
244 3300006353 Ga0075370_10174524 Ga0075370_101745243 166
245 3300006881 Ga0068865_100001445 Ga0068865_1000014457 166
246 3300009098 Ga0105245_10027980 Ga0105245_100279805 166
247 3300009176 Ga0105242_10000545 Ga0105242_100005453 166
248 3300009545 Ga0105237_10693392 Ga0105237_106933922 166
249 3300013306 Ga0163162_10026670 Ga0163162_100266701 166
250 3300013306 Ga0163162_10064510 Ga0163162_100645103 166
251 3300013308 Ga0157375_10053778 Ga0157375_100537784 166
252 3300014969 Ga0157376_10001641 Ga0157376_1000164116 166
253 3300021384 Ga0213876_10029072 Ga0213876_100290721 166
254 3300025927 Ga0207687_10169102 Ga0207687_101691022 166
255 3300025934 Ga0207686_10010773 Ga0207686_100107733 166
256 3300025938 Ga0207704_10000952 Ga0207704_100009524 166
257 3300025986 Ga0207658_11427766 Ga0207658_114277661 166
258 3300026023 Ga0207677_10244836 Ga0207677_102448362 166
259 3300026142 Ga0207698_10212922 Ga0207698_102129222 166
260 3300028379 Ga0268266_10736272 Ga0268266_107362721 166
261 3300035115 Ga0373941_0000346 Ga0373941_0000346_5636_6151 166
262 3300035118 Ga0373954_0157034 Ga0373954_0157034_563_1078 166
263 3300035241 Ga0373961_0000079 Ga0373961_0000079_9537_10052 166
264 3300036401 Ga0373937_1570075 Ga0373937_1570075_67_570 166
265 3300046462 Ga0495651_0920592 Ga0495651_0920592_11_514 166
266 3300046472 Ga0495580_0217975 Ga0495580_0217975_168_671 166
267 3300046473 Ga0495582_0042998 Ga0495582_0042998_407_910 166
268 3300046543 Ga0495645_0513459 Ga0495645_0513459_24_527 166
269 3300046683 Ga0495658_0078440 Ga0495658_0078440_1250_1753 166
270 3300047319 Ga0495674_0858737 Ga0495674_0858737_76_579 166
271 3300048907 Ga0496104_0000020 Ga0496104_0000020_9920_10423 166
272 3300048908 Ga0496105_0000015 Ga0496105_0000015_50112_50615 166
273 3300049569 Ga0501032_0066113 Ga0501032_0066113_61_576 166
274 3300049569 Ga0501032_0402907 Ga0501032_0402907_81_596 166
275 3300049570 Ga0501033_0084803 Ga0501033_0084803_1345_1860 166
276 3300049570 Ga0501033_0752887 Ga0501033_0752887_110_625 166
277 3300049571 Ga0501034_0000286 Ga0501034_0000286_56911_57426 166
278 3300049571 Ga0501034_0045816 Ga0501034_0045816_2454_2969 166
279 3300049571 Ga0501034_0133325 Ga0501034_0133325_110_625 166
280 3300049572 Ga0501036_0021316 Ga0501036_0021316_4767_5282 166
281 3300049573 Ga0501037_0161586 Ga0501037_0161586_164_679 166
282 3300049574 Ga0501038_0124206 Ga0501038_0124206_799_1314 166
283 3300049575 Ga0501039_0075146 Ga0501039_0075146_281_796 166
284 3300049575 Ga0501039_0111906 Ga0501039_0111906_1074_1589 166
285 3300049575 Ga0501039_0477293 Ga0501039_0477293_134_649 166
286 3300049578 Ga0501042_0108119 Ga0501042_0108119_1263_1778 166
287 3300049579 Ga0501043_0015351 Ga0501043_0015351_4666_5181 166
288 3300049579 Ga0501043_0057823 Ga0501043_0057823_1587_2102 166
289 3300049581 Ga0501047_0146243 Ga0501047_0146243_882_1397 166
290 3300049581 Ga0501047_0372545 Ga0501047_0372545_632_1147 166
291 3300049581 Ga0501047_0401512 Ga0501047_0401512_558_1073 166
292 3300049583 Ga0501067_0114872 Ga0501067_0114872_163_678 166
293 3300049583 Ga0501067_0244513 Ga0501067_0244513_34_549 166
294 3300049584 Ga0501068_0027907 Ga0501068_0027907_1801_2316 166
295 3300049584 Ga0501068_0093398 Ga0501068_0093398_1139_1654 166
296 3300049585 Ga0501069_0219467 Ga0501069_0219467_175_690 166
297 3300049586 Ga0501070_0032885 Ga0501070_0032885_1272_1787 166
298 3300049586 Ga0501070_0056026 Ga0501070_0056026_397_912 166
299 3300049586 Ga0501070_0072003 Ga0501070_0072003_2211_2726 166
300 3300049586 Ga0501070_0117882 Ga0501070_0117882_654_1169 166
301 3300049586 Ga0501070_0127105 Ga0501070_0127105_802_1317 166
302 3300049587 Ga0501071_0008806 Ga0501071_0008806_2439_2954 166
303 3300049588 Ga0501072_0045272 Ga0501072_0045272_1958_2473 166
304 3300049589 Ga0501073_0153581 Ga0501073_0153581_237_752 166
305 3300049589 Ga0501073_0171761 Ga0501073_0171761_529_1044 166
306 3300049590 Ga0501074_0050369 Ga0501074_0050369_162_677 166
307 3300049590 Ga0501074_0150892 Ga0501074_0150892_1043_1558 166
308 3300049591 Ga0501075_0183383 Ga0501075_0183383_145_660 166
309 3300049592 Ga0501076_0779479 Ga0501076_0779479_161_676 166
310 3300049742 Ga0501080_0230878 Ga0501080_0230878_301_816 166
311 3300049742 Ga0501080_0273392 Ga0501080_0273392_186_701 166
312 3300049743 Ga0501081_0187737 Ga0501081_0187737_361_876 166
313 3300049744 Ga0501083_0013191 Ga0501083_0013191_4368_4883 166
314 3300049744 Ga0501083_0047995 Ga0501083_0047995_1185_1700 166
315 3300049744 Ga0501083_0053994 Ga0501083_0053994_1057_1572 166
316 3300049744 Ga0501083_0065931 Ga0501083_0065931_416_931 166
317 3300049822 Ga0501035_0001276 Ga0501035_0001276_23970_24485 166
318 3300049822 Ga0501035_0114747 Ga0501035_0114747_1772_2287 166
319 3300049822 Ga0501035_0165039 Ga0501035_0165039_1270_1785 166
320 3300049822 Ga0501035_0233761 Ga0501035_0233761_411_926 166
321 3300049823 Ga0501044_0023519 Ga0501044_0023519_6004_6519 166
322 3300049823 Ga0501044_0230855 Ga0501044_0230855_324_839 166
323 3300049823 Ga0501044_0317829 Ga0501044_0317829_210_725 166
324 3300053094 Ga0500566_0152723 Ga0500566_0152723_573_1088 166
325 3300053123 Ga0500614_078554 Ga0500614_078554_263_778 166
326 3300053123 Ga0500614_247715 Ga0500614_247715_26_529 166
327 3300053177 Ga0500636_0147230 Ga0500636_0147230_162_677 166
328 3300053178 Ga0500637_0339892 Ga0500637_0339892_140_655 166
329 3300054114 Ga0501084_0254464 Ga0501084_0254464_710_1225 166
330 3300054114 Ga0501084_1068498 Ga0501084_1068498_82_597 166
331 3300060353 Ga0501082_0430358 Ga0501082_0430358_397_912 166
332 3300005328 Ga0070676_10102834 Ga0070676_101028341 167
333 3300005330 Ga0070690_100005626 Ga0070690_1000056266 167
334 3300005331 Ga0070670_100263140 Ga0070670_1002631402 167
335 3300005331 Ga0070670_100643581 Ga0070670_1006435812 167
336 3300005334 Ga0068869_100013493 Ga0068869_1000134934 167
337 3300005334 Ga0068869_100309689 Ga0068869_1003096891 167
338 3300005335 Ga0070666_10694770 Ga0070666_106947701 167
339 3300005338 Ga0068868_100023104 Ga0068868_1000231043 167
340 3300005338 Ga0068868_101220984 Ga0068868_1012209841 167
341 3300005340 Ga0070689_100462620 Ga0070689_1004626202 167
342 3300005347 Ga0070668_100538748 Ga0070668_1005387482 167
343 3300005353 Ga0070669_100010865 Ga0070669_1000108656 167
344 3300005354 Ga0070675_100111057 Ga0070675_1001110572 167
345 3300005354 Ga0070675_100331779 Ga0070675_1003317792 167
346 3300005356 Ga0070674_100803355 Ga0070674_1008033551 167
347 3300005365 Ga0070688_100073303 Ga0070688_1000733032 167
348 3300005366 Ga0070659_101235393 Ga0070659_1012353931 167
349 3300005367 Ga0070667_100020333 Ga0070667_1000203332 167
350 3300005367 Ga0070667_100374231 Ga0070667_1003742312 167
351 3300005439 Ga0070711_100131735 Ga0070711_1001317353 167
352 3300005439 Ga0070711_100905597 Ga0070711_1009055971 167
353 3300005456 Ga0070678_100005765 Ga0070678_1000057653 167
354 3300005456 Ga0070678_100826381 Ga0070678_1008263811 167
355 3300005459 Ga0068867_100014208 Ga0068867_1000142085 167
356 3300005459 Ga0068867_100461397 Ga0068867_1004613971 167
357 3300005539 Ga0068853_100151962 Ga0068853_1001519621 167
358 3300005543 Ga0070672_100191491 Ga0070672_1001914913 167
359 3300005544 Ga0070686_100760408 Ga0070686_1007604081 167
360 3300005547 Ga0070693_100291388 Ga0070693_1002913883 167
361 3300005548 Ga0070665_100583315 Ga0070665_1005833152 167
362 3300005563 Ga0068855_101139220 Ga0068855_1011392202 167
363 3300005616 Ga0068852_100461137 Ga0068852_1004611372 167
364 3300005617 Ga0068859_100747323 Ga0068859_1007473232 167
365 3300005618 Ga0068864_100211617 Ga0068864_1002116173 167
366 3300005618 Ga0068864_101868306 Ga0068864_1018683061 167
367 3300005719 Ga0068861_100649522 Ga0068861_1006495221 167
368 3300005841 Ga0068863_100071994 Ga0068863_1000719942 167
369 3300005841 Ga0068863_100211385 Ga0068863_1002113852 167
370 3300005841 Ga0068863_100509515 Ga0068863_1005095152 167
371 3300005844 Ga0068862_100569180 Ga0068862_1005691802 167
372 3300005937 Ga0081455_10001158 Ga0081455_1000115819 167
373 3300006237 Ga0097621_100005144 Ga0097621_1000051444 167
374 3300006237 Ga0097621_100106214 Ga0097621_1001062142 167
375 3300006237 Ga0097621_100628097 Ga0097621_1006280971 167
376 3300006358 Ga0068871_100005657 Ga0068871_1000056574 167
377 3300006358 Ga0068871_100041761 Ga0068871_1000417614 167
378 3300006358 Ga0068871_100623350 Ga0068871_1006233502 167
379 3300006881 Ga0068865_100029975 Ga0068865_1000299753 167
380 3300006881 Ga0068865_100044012 Ga0068865_1000440124 167
381 3300006931 Ga0097620_100747388 Ga0097620_1007473881 167
382 3300009093 Ga0105240_10011701 Ga0105240_100117013 167
383 3300009093 Ga0105240_10066165 Ga0105240_100661653 167
384 3300009098 Ga0105245_10909675 Ga0105245_109096751 167
385 3300009174 Ga0105241_10017593 Ga0105241_100175934 167
386 3300009176 Ga0105242_10702896 Ga0105242_107028962 167
387 3300009177 Ga0105248_10130794 Ga0105248_101307943 167
388 3300009545 Ga0105237_10179924 Ga0105237_101799242 167
389 3300009551 Ga0105238_10019625 Ga0105238_100196253 167
390 3300009553 Ga0105249_10010965 Ga0105249_1001096511 167
391 3300009553 Ga0105249_10653388 Ga0105249_106533882 167
392 3300010375 Ga0105239_10613253 Ga0105239_106132531 167
393 3300011119 Ga0105246_10104611 Ga0105246_101046113 167
394 3300012483 Ga0157337_1006862 Ga0157337_10068621 167
395 3300013104 Ga0157370_10404376 Ga0157370_104043763 167
396 3300013105 Ga0157369_10000028 Ga0157369_1000002898 167
397 3300013296 Ga0157374_10111568 Ga0157374_101115682 167
398 3300013306 Ga0163162_10008430 Ga0163162_100084304 167
399 3300013307 Ga0157372_10080562 Ga0157372_100805622 167
400 3300013308 Ga0157375_10096597 Ga0157375_100965972 167
401 3300013308 Ga0157375_10372082 Ga0157375_103720821 167
402 3300014325 Ga0163163_10005444 Ga0163163_100054448 167
403 3300014325 Ga0163163_10926413 Ga0163163_109264131 167
404 3300014969 Ga0157376_10002363 Ga0157376_100023634 167
405 3300014969 Ga0157376_10015699 Ga0157376_100156994 167
406 3300017792 Ga0163161_10129963 Ga0163161_101299631 167
407 3300025911 Ga0207654_10011956 Ga0207654_100119562 167
408 3300025913 Ga0207695_10007286 Ga0207695_1000728613 167
409 3300025913 Ga0207695_10016243 Ga0207695_100162437 167
410 3300025914 Ga0207671_10002002 Ga0207671_100020024 167
411 3300025916 Ga0207663_10614154 Ga0207663_106141541 167
412 3300025923 Ga0207681_10070241 Ga0207681_100702412 167
413 3300025924 Ga0207694_10010448 Ga0207694_100104483 167
414 3300025925 Ga0207650_10079115 Ga0207650_100791151 167
415 3300025925 Ga0207650_10153069 Ga0207650_101530692 167
416 3300025926 Ga0207659_10368009 Ga0207659_103680092 167
417 3300025926 Ga0207659_11414211 Ga0207659_114142111 167
418 3300025931 Ga0207644_10955084 Ga0207644_109550841 167
419 3300025934 Ga0207686_10406007 Ga0207686_104060072 167
420 3300025936 Ga0207670_10269091 Ga0207670_102690912 167
421 3300025937 Ga0207669_11206890 Ga0207669_112068901 167
422 3300025938 Ga0207704_10021331 Ga0207704_100213312 167
423 3300025938 Ga0207704_10160459 Ga0207704_101604592 167
424 3300025938 Ga0207704_10980194 Ga0207704_109801941 167
425 3300025940 Ga0207691_10188811 Ga0207691_101888112 167
426 3300025941 Ga0207711_10143613 Ga0207711_101436132 167
427 3300025942 Ga0207689_10011449 Ga0207689_100114492 167
428 3300025949 Ga0207667_10672252 Ga0207667_106722522 167
429 3300025960 Ga0207651_10128420 Ga0207651_101284201 167
430 3300025961 Ga0207712_10030071 Ga0207712_100300715 167
431 3300025961 Ga0207712_10371463 Ga0207712_103714632 167
432 3300025972 Ga0207668_10629492 Ga0207668_106294921 167
433 3300026023 Ga0207677_10455251 Ga0207677_104552512 167
434 3300026023 Ga0207677_10567638 Ga0207677_105676382 167
435 3300026041 Ga0207639_10538381 Ga0207639_105383811 167
436 3300026041 Ga0207639_11182755 Ga0207639_111827551 167
437 3300026088 Ga0207641_10048240 Ga0207641_100482404 167
438 3300026088 Ga0207641_10635885 Ga0207641_106358851 167
439 3300026089 Ga0207648_10027506 Ga0207648_100275064 167
440 3300026089 Ga0207648_10571379 Ga0207648_105713791 167
441 3300026095 Ga0207676_10069861 Ga0207676_100698611 167
442 3300026095 Ga0207676_10406583 Ga0207676_104065831 167
443 3300026118 Ga0207675_100449516 Ga0207675_1004495163 167
444 3300026121 Ga0207683_10015085 Ga0207683_100150853 167
445 3300026121 Ga0207683_10027254 Ga0207683_100272542 167
446 3300026121 Ga0207683_10136398 Ga0207683_101363982 167
447 3300026121 Ga0207683_10278426 Ga0207683_102784262 167
448 3300026142 Ga0207698_10195899 Ga0207698_101958992 167
449 3300026142 Ga0207698_11315576 Ga0207698_113155761 167
450 3300028379 Ga0268266_10081528 Ga0268266_100815282 167
451 3300028379 Ga0268266_10526247 Ga0268266_105262472 167
452 3300028380 Ga0268265_10492995 Ga0268265_104929952 167
453 3300028573 Ga0265334_10011154 Ga0265334_100111542 167
454 3300031249 Ga0265339_10036715 Ga0265339_100367151 167
455 3300031456 Ga0307513_10261277 Ga0307513_102612772 167
456 3300031616 Ga0307508_10520808 Ga0307508_105208082 167
457 3300031730 Ga0307516_10216111 Ga0307516_102161112 167
458 3300041512 Ga0451853_2265290 Ga0451853_2265290_25_531 167
459 3300046681 Ga0495647_0165260 Ga0495647_0165260_63_569 167
460 3300047322 Ga0495680_0499459 Ga0495680_0499459_97_615 167
461 3300053084 Ga0495595_0239353 Ga0495595_0239353_337_843 167
462 3300002987 JGI25159J45721_1000079 JGI25159J45721_100007932 168
463 3300003187 JGI25151J46595_10093221 JGI25151J46595_100932212 168
464 3300003214 JGI25165J46597_1002799 JGI25165J46597_10027993 168
465 3300003354 JGI25160J50197_1000109 JGI25160J50197_100010933 168
466 3300003374 JGI25161J50226_1000011 JGI25161J50226_100001133 168
467 3300003752 Ga0055539_1008173 Ga0055539_10081731 168
468 3300004625 Ga0055543_1000071 Ga0055543_100007157 168
469 3300005262 Ga0065165_1000135 Ga0065165_100013533 168
470 3300005335 Ga0070666_10032921 Ga0070666_100329211 168
471 3300005343 Ga0070687_100919099 Ga0070687_1009190991 168
472 3300005344 Ga0070661_100006922 Ga0070661_1000069225 168
473 3300005347 Ga0070668_100744857 Ga0070668_1007448572 168
474 3300005366 Ga0070659_100001414 Ga0070659_10000141412 168
475 3300005441 Ga0070700_100275961 Ga0070700_1002759612 168
476 3300005455 Ga0070663_100077697 Ga0070663_1000776971 168
477 3300005539 Ga0068853_100555915 Ga0068853_1005559152 168
478 3300005543 Ga0070672_100551552 Ga0070672_1005515521 168
479 3300005548 Ga0070665_100010410 Ga0070665_1000104102 168
480 3300005564 Ga0070664_100001442 Ga0070664_10000144210 168
481 3300005578 Ga0068854_100132700 Ga0068854_1001327004 168
482 3300005616 Ga0068852_100088156 Ga0068852_1000881564 168
483 3300005618 Ga0068864_100652546 Ga0068864_1006525462 168
484 3300005834 Ga0068851_10125736 Ga0068851_101257363 168
485 3300006178 Ga0075367_10339672 Ga0075367_103396722 168
486 3300009094 Ga0111539_10369555 Ga0111539_103695552 168
487 3300025253 Ga0209677_100682 Ga0209677_10068213 168
488 3300025261 Ga0209233_1000388 Ga0209233_100038813 168
489 3300025284 Ga0209130_1000058 Ga0209130_1000058158 168
490 3300025302 Ga0207426_1000131 Ga0207426_1000131158 168
491 3300025900 Ga0207710_10118201 Ga0207710_101182012 168
492 3300025904 Ga0207647_10140439 Ga0207647_101404392 168
493 3300025913 Ga0207695_10000044 Ga0207695_10000044399 168
494 3300025918 Ga0207662_10725055 Ga0207662_107250551 168
495 3300025920 Ga0207649_10000814 Ga0207649_1000081412 168
496 3300025932 Ga0207690_10000712 Ga0207690_1000071217 168
497 3300025941 Ga0207711_10949024 Ga0207711_109490241 168
498 3300025945 Ga0207679_10000430 Ga0207679_1000043012 168
499 3300025949 Ga0207667_10185754 Ga0207667_101857542 168
500 3300026067 Ga0207678_10312898 Ga0207678_103128982 168
501 3300026075 Ga0207708_10039518 Ga0207708_100395181 168
502 3300026142 Ga0207698_10298654 Ga0207698_102986543 168
503 3300027907 Ga0207428_10287920 Ga0207428_102879202 168
504 3300028379 Ga0268266_10008439 Ga0268266_100084392 168
505 3300031241 Ga0265325_10000229 Ga0265325_100002295 168
506 3300031595 Ga0265313_10000227 Ga0265313_1000022764 168
507 3300046519 Ga0495632_0000347 Ga0495632_0000347_38563_39072 168
508 3300048927 Ga0496124_0019542 Ga0496124_0019542_5515_6024 168
509 3300050511 nmdc:mga08y16_97519_c1 nmdc:mga08y16_97519_c1_1508_2017 168
510 3300050512 nmdc:mga0n895_293795_c1 nmdc:mga0n895_293795_c1_917_1426 168
511 3300053085 Ga0495619_0081200 Ga0495619_0081200_1105_1629 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09351

DUF1993

Domain of unknown function (DUF1993)

5

165

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oqm-assembly2.cif.gz_D crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution 0.9435 4 167
2oqm-assembly2.cif.gz_D crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution 0.9173 4 167
3qth-assembly1.cif.gz_B crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.8794 5 168
3qth-assembly1.cif.gz_A crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.8634 5 168
3qth-assembly1.cif.gz_A crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.8165 5 168
ID Description Score Start End Superfamily
2oqmC01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9509 5 165 1.20.120.450
2oqmC01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9067 5 165 1.20.120.450
3qthB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8752 5 168 1.20.120.450
3qthB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8033 5 168 1.20.120.450
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6707 1 166 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A4Q7S1V9-F1-model_v4 deleted 0.9855 1 168
AF-A0A2L1D599-F1-model_v4 deleted 0.9831 1 165
AF-A0A4Q7S1V9-F1-model_v4 deleted 0.9797 1 168
AF-A0A2U2DRV8-F1-model_v4 DUF1993 domain-containing protein 0.9784 1 168
AF-A0A4Q3H477-F1-model_v4 deleted 0.9774 61 165

Feature Viewer

pLDDT pTM Quality
95.33 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map