F457219

General Info

Members Datasets Scaffolds Average Seq Length
510 298 1020 244

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221715|2644636389
Length 261
Sequence GWEAGTVVAGADVRGRADGSTDARVALVTGASRGIGAEVARLLGGAGVHVLVNYREKAKRAAAVVDEIRAAGGQASAAGADVCDEAQVQALLVDIDEQFGALNMLVLNASGGLERGADPGYAMRLNRDAQLRLATLALPLMPPGARIVFVTSHQAHFFPAKPVPDGYEPIAQSKRAGEDALLSAKTVLNDSGIELKVVSGDMIDGTIIVRLLHRKDPEAVQARRGHAPLPTVEEFAAAIARAALHPDAPDTTYVGGADYLE

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
50 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
52 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
99 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
100 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
101 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
102 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
103 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
104 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
105 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
106 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
107 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
108 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
109 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
110 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
111 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
112 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
113 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
114 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
115 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
116 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
117 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
118 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
119 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
120 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
121 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
122 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
123 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
165 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
220 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
221 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
222 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
223 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
224 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
225 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
226 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
229 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
233 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
234 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
235 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
236 2643221692 Nocardia sp. Root136 Isolate Unclassified
237 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
238 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
239 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
240 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
241 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
242 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
243 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
244 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
245 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
246 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
247 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
248 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
249 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
250 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
251 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
252 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
253 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
254 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
255 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
256 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
257 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
258 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
259 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
260 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
261 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
262 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
263 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
264 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
265 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
266 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
267 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
268 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
269 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
270 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
271 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
272 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
273 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
274 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
275 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
276 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
277 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
278 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
279 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
280 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
281 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
282 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
283 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
284 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
285 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
286 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
287 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
288 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
289 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
290 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
291 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
292 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
293 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
294 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
295 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
296 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
297 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
298 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.12
Metatranscriptomes 2.75
Isolates 13.14

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 8.04
Nodule 0.2
Rhizoplane 7.84
Rhizosphere 71.76
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1001217 3300000549 Bacteria 3881
2 LJQas_1001668 3300000549 Bacteria 3263
3 JGI25152J39213_1000140 3300002773 Bacteria 49435
4 rootL2_10140888 3300003322 Bacteria 2418
5 Ga0055540_1000489 3300003792 Bacteria 30349
6 Ga0055540_1000565 3300003792 Bacteria 27246
7 Ga0055540_1009411 3300003792 Bacteria 3379
8 Ga0070670_100127516 3300005331 Bacteria 2196
9 Ga0070666_10160351 3300005335 Bacteria 1572
10 Ga0070668_100002242 3300005347 Bacteria 14228
11 Ga0070668_100169633 3300005347 Bacteria 1776
12 Ga0070669_100004157 3300005353 Bacteria 10491
13 Ga0070669_100021613 3300005353 Bacteria 4599
14 Ga0070675_100170556 3300005354 Bacteria 1876
15 Ga0070671_100474955 3300005355 Bacteria 1074
16 Ga0070673_100157299 3300005364 Bacteria 1930
17 Ga0070667_100000022 3300005367 Bacteria 204861
18 Ga0070667_100167390 3300005367 Bacteria 1939
19 Ga0070714_100919094 3300005435 Bacteria 850
20 Ga0070685_10383619 3300005466 Bacteria 969
21 Ga0068853_100131815 3300005539 Bacteria 2238
22 Ga0070672_100249214 3300005543 Bacteria 1495
23 Ga0070665_100010516 3300005548 Bacteria 9362
24 Ga0068859_100000329 3300005617 Bacteria 47329
25 Ga0068864_100682064 3300005618 Unclassified 1002
26 Ga0068863_100012815 3300005841 Bacteria 8086
27 Ga0068858_100001138 3300005842 Bacteria 27513
28 Ga0068858_100125242 3300005842 Bacteria 2405
29 Ga0068860_100000038 3300005843 Bacteria 232936
30 Ga0068862_100000084 3300005844 Bacteria 112100
31 Ga0075365_10020980 3300006038 Bacteria 4066
32 Ga0075365_10272421 3300006038 Bacteria 1191
33 Ga0075364_10004837 3300006051 Bacteria 7801
34 Ga0075364_10014160 3300006051 Bacteria 4923
35 Ga0075364_10197111 3300006051 Bacteria 1365
36 Ga0075364_10224383 3300006051 Bacteria 1276
37 Ga0075432_10017291 3300006058 Bacteria 2460
38 Ga0075369_10002885 3300006186 Bacteria 6200
39 Ga0097620_100000329 3300006931 Bacteria 47329
40 Ga0105244_10004227 3300009036 Bacteria 9982
41 Ga0105244_10006637 3300009036 Bacteria 7453
42 Ga0105244_10140427 3300009036 Bacteria 1162
43 Ga0105244_10142214 3300009036 Bacteria 1153
44 Ga0105240_10662982 3300009093 Bacteria 1142
45 Ga0111539_11441381 3300009094 Bacteria 799
46 Ga0105245_10205402 3300009098 Bacteria 1894
47 Ga0105245_10384629 3300009098 Bacteria 1398
48 Ga0105247_10000021 3300009101 Bacteria 229443
49 Ga0105247_10000065 3300009101 Bacteria 122503
50 Ga0105243_10157032 3300009148 Bacteria 1957
51 Ga0105248_10000130 3300009177 Bacteria 87417
52 Ga0105248_10300777 3300009177 Bacteria 1807
53 Ga0105237_10014427 3300009545 Bacteria 8264
54 Ga0105249_10000620 3300009553 Bacteria 32317
55 Ga0105246_10002276 3300011119 Bacteria 11577
56 Ga0105246_10019891 3300011119 Bacteria 4301
57 Ga0105246_10152017 3300011119 Bacteria 1753
58 Ga0105246_10188007 3300011119 Bacteria 1596
59 Ga0157371_10122610 3300013102 Bacteria 1848
60 Ga0157370_10020509 3300013104 Bacteria 6600
61 Ga0157369_10363898 3300013105 Bacteria 1501
62 Ga0157369_10498787 3300013105 Bacteria 1259
63 Ga0157374_10368873 3300013296 Bacteria 1429
64 Ga0157378_10343827 3300013297 Bacteria 1455
65 Ga0163162_10034522 3300013306 Bacteria 5033
66 Ga0163162_10094947 3300013306 Bacteria 3068
67 Ga0157375_10759246 3300013308 Bacteria 1121
68 Ga0163163_10023301 3300014325 Bacteria 5874
69 Ga0157379_10860216 3300014968 Unclassified 858
70 Ga0206354_11277054 3300020081 Bacteria 1061
71 Ga0207425_1002927 3300025245 Bacteria 5718
72 Ga0209148_1002761 3300025254 Bacteria 5534
73 Ga0209759_1019662 3300025256 Bacteria 1593
74 Ga0209129_1000067 3300025258 Bacteria 219974
75 Ga0209673_1061594 3300025273 Bacteria 934
76 Ga0209025_1001395 3300025294 Bacteria 32161
77 Ga0209051_1001145 3300025303 Bacteria 24140
78 Ga0209051_1002460 3300025303 Bacteria 13251
79 Ga0209051_1003979 3300025303 Bacteria 9383
80 Ga0209051_1006066 3300025303 Bacteria 6895
81 Ga0209051_1009127 3300025303 Bacteria 5147
82 Ga0207697_10004823 3300025315 Bacteria 6372
83 Ga0207697_10058530 3300025315 Bacteria 1600
84 Ga0207655_1005476 3300025728 Bacteria 8617
85 Ga0207655_1023324 3300025728 Bacteria 3073
86 Ga0207682_10043756 3300025893 Bacteria 1834
87 Ga0207710_10000027 3300025900 Bacteria 307001
88 Ga0207680_10289282 3300025903 Bacteria 1140
89 Ga0207645_10019501 3300025907 Bacteria 4445
90 Ga0207671_10004613 3300025914 Bacteria 13076
91 Ga0207681_10001882 3300025923 Bacteria 13430
92 Ga0207681_10015247 3300025923 Bacteria 4792
93 Ga0207681_10015988 3300025923 Bacteria 4687
94 Ga0207687_10524288 3300025927 Bacteria 991
95 Ga0207664_10394713 3300025929 Bacteria 1230
96 Ga0207709_10404835 3300025935 Bacteria 1044
97 Ga0207709_10665032 3300025935 Bacteria 830
98 Ga0207669_10170636 3300025937 Bacteria 1548
99 Ga0207691_10011415 3300025940 Bacteria 8524
100 Ga0207711_10000089 3300025941 Bacteria 97575
101 Ga0207711_10329004 3300025941 Bacteria 1413
102 Ga0207651_10086788 3300025960 Bacteria 2276
103 Ga0207712_10000484 3300025961 Bacteria 33199
104 Ga0207668_10001612 3300025972 Bacteria 13171
105 Ga0207658_10000600 3300025986 Bacteria 32084
106 Ga0207658_10136658 3300025986 Bacteria 1978
107 Ga0207703_10027632 3300026035 Bacteria 4467
108 Ga0207639_10108976 3300026041 Bacteria 2253
109 Ga0207678_10098272 3300026067 Bacteria 2501
110 Ga0207641_10001014 3300026088 Bacteria 28540
111 Ga0207683_10101459 3300026121 Bacteria 2569
112 Ga0268265_10000028 3300028380 Bacteria 236467
113 Ga0268264_10000092 3300028381 Bacteria 232950
114 Ga0307408_100001200 3300031548 Bacteria 19575
115 Ga0307408_100023860 3300031548 Bacteria 4170
116 Ga0307408_100029791 3300031548 Bacteria 3785
117 Ga0307408_100143199 3300031548 Bacteria 1878
118 Ga0307408_100553385 3300031548 Bacteria 1015
119 Ga0307405_10019060 3300031731 Bacteria 3801
120 Ga0307405_10019227 3300031731 Bacteria 3788
121 Ga0307405_10029229 3300031731 Bacteria 3220
122 Ga0307405_10043931 3300031731 Bacteria 2730
123 Ga0307405_10159845 3300031731 Bacteria 1594
124 Ga0307405_10278910 3300031731 Bacteria 1257
125 Ga0307413_10057753 3300031824 Bacteria 2375
126 Ga0307413_10089296 3300031824 Bacteria 2002
127 Ga0307413_10127098 3300031824 Bacteria 1738
128 Ga0307413_10280383 3300031824 Bacteria 1253
129 Ga0307413_10666571 3300031824 Bacteria 860
130 Ga0307410_10017746 3300031852 Bacteria 4282
131 Ga0307410_10059836 3300031852 Bacteria 2601
132 Ga0307410_10119328 3300031852 Bacteria 1921
133 Ga0307410_10144933 3300031852 Bacteria 1761
134 Ga0307410_10290980 3300031852 Bacteria 1285
135 Ga0307410_10382655 3300031852 Bacteria 1132
136 Ga0307410_10399851 3300031852 Bacteria 1110
137 Ga0307410_10796446 3300031852 Bacteria 803
138 Ga0307406_10321272 3300031901 Bacteria 1197
139 Ga0307407_10075882 3300031903 Bacteria 2017
140 Ga0307407_10083596 3300031903 Bacteria 1937
141 Ga0307407_10244803 3300031903 Bacteria 1225
142 Ga0307407_10319092 3300031903 Bacteria 1090
143 Ga0307407_10428067 3300031903 Bacteria 955
144 Ga0307407_10564729 3300031903 Bacteria 843
145 Ga0307412_10002167 3300031911 Bacteria 10899
146 Ga0307412_10066538 3300031911 Bacteria 2443
147 Ga0307412_10081507 3300031911 Bacteria 2238
148 Ga0307412_10096214 3300031911 Bacteria 2083
149 Ga0307412_10177545 3300031911 Bacteria 1598
150 Ga0307412_10195877 3300031911 Bacteria 1531
151 Ga0307412_10209623 3300031911 Bacteria 1486
152 Ga0307409_100023242 3300031995 Bacteria 4291
153 Ga0307409_100030508 3300031995 Bacteria 3874
154 Ga0307409_100041937 3300031995 Bacteria 3423
155 Ga0307409_100091466 3300031995 Bacteria 2493
156 Ga0307409_100202518 3300031995 Bacteria 1777
157 Ga0307409_100240315 3300031995 Bacteria 1648
158 Ga0307409_100263608 3300031995 Bacteria 1583
159 Ga0307409_100317093 3300031995 Bacteria 1457
160 Ga0307409_100619024 3300031995 Bacteria 1072
161 Ga0307416_100017801 3300032002 Bacteria 4984
162 Ga0307416_100550042 3300032002 Bacteria 1227
163 Ga0307416_100706027 3300032002 Bacteria 1098
164 Ga0307414_10178095 3300032004 Bacteria 1707
165 Ga0307414_10271599 3300032004 Bacteria 1420
166 Ga0307414_10379497 3300032004 Bacteria 1222
167 Ga0307414_10576191 3300032004 Bacteria 1006
168 Ga0307411_10059593 3300032005 Bacteria 2531
169 Ga0307411_10148034 3300032005 Bacteria 1741
170 Ga0307415_100025727 3300032126 Bacteria 3700
171 Ga0307415_100036532 3300032126 Bacteria 3220
172 Ga0307415_100058750 3300032126 Bacteria 2649
173 Ga0307415_100552108 3300032126 Bacteria 1017
174 Ga0307415_100748223 3300032126 Bacteria 887
175 Ga0395899_0010072 3300037312 Bacteria 7247
176 Ga0395899_0016113 3300037312 Bacteria 5698
177 Ga0395899_0066152 3300037312 Bacteria 2654
178 Ga0395899_0069519 3300037312 Bacteria 2578
179 Ga0395899_0105356 3300037312 Bacteria 2031
180 Ga0395900_0018741 3300037418 Bacteria 7058
181 Ga0395900_0049923 3300037418 Bacteria 4310
182 Ga0395900_0069069 3300037418 Bacteria 3631
183 Ga0395900_0085090 3300037418 Bacteria 3250
184 Ga0395900_0123356 3300037418 Bacteria 2657
185 Ga0395900_0533316 3300037418 Bacteria 1120
186 Ga0395898_0002818 3300037466 Bacteria 19939
187 Ga0395898_0017683 3300037466 Bacteria 7276
188 Ga0395898_0035249 3300037466 Bacteria 4978
189 Ga0395898_0233430 3300037466 Bacteria 1754
190 Ga0395905_0042768 3300037471 Bacteria 4250
191 Ga0395905_0256016 3300037471 Bacteria 1635
192 Ga0395905_0392725 3300037471 Bacteria 1282
193 Ga0395901_0004509 3300038443 Bacteria 14043
194 Ga0395901_0013220 3300038443 Bacteria 8381
195 Ga0395901_0020548 3300038443 Bacteria 6758
196 Ga0395901_0032466 3300038443 Bacteria 5387
197 Ga0395901_0092197 3300038443 Bacteria 3171
198 Ga0395901_0467249 3300038443 Bacteria 1288
199 Ga0395901_0573034 3300038443 Bacteria 1141
200 Ga0395901_0928656 3300038443 Bacteria 850
201 Ga0439436_0001657 3300041404 Bacteria 6504
202 Ga0439436_0037334 3300041404 Bacteria 1399
203 Ga0439438_014162 3300041405 Bacteria 2380
204 Ga0439438_028062 3300041405 Bacteria 1516
205 Ga0439438_046254 3300041405 Bacteria 1118
206 Ga0439439_0006641 3300041406 Bacteria 2679
207 Ga0439439_0063698 3300041406 Bacteria 982
208 Ga0439447_046914 3300041407 Bacteria 1039
209 Ga0439461_0011178 3300041410 Bacteria 1662
210 Ga0439461_0039613 3300041410 Bacteria 1013
211 Ga0439466_0000140 3300041411 Bacteria 28683
212 Ga0439466_0002880 3300041411 Bacteria 6728
213 Ga0439466_0005004 3300041411 Bacteria 5086
214 Ga0439466_0017756 3300041411 Bacteria 2559
215 Ga0439466_0065116 3300041411 Bacteria 1168
216 Ga0439465_0017421 3300041413 Bacteria 2242
217 Ga0439465_0053852 3300041413 Bacteria 1322
218 Ga0439465_0132555 3300041413 Bacteria 880
219 Ga0451791_0960927 3300041451 Bacteria 1118
220 Ga0451793_0843802 3300041452 Bacteria 1778
221 Ga0451795_0295132 3300041456 Bacteria 1236
222 Ga0439431_0016897 3300041997 Bacteria 1711
223 Ga0439431_0038158 3300041997 Bacteria 1215
224 Ga0439431_0047120 3300041997 Bacteria 1110
225 Ga0439433_0000441 3300041999 Bacteria 7628
226 Ga0439442_000043 3300042002 Bacteria 28612
227 Ga0439442_000244 3300042002 Bacteria 13232
228 Ga0439445_0011303 3300042004 Bacteria 2127
229 Ga0439432_063467 3300042006 Bacteria 1135
230 Ga0439432_097563 3300042006 Bacteria 881
231 Ga0439449_0007219 3300042007 Bacteria 4228
232 Ga0439449_0011042 3300042007 Bacteria 3406
233 Ga0439449_0027037 3300042007 Bacteria 2141
234 Ga0439457_000675 3300042014 Bacteria 10082
235 Ga0439457_039861 3300042014 Bacteria 1046
236 Ga0450919_000570 3300042121 Bacteria 4643
237 Ga0450920_001109 3300042122 Bacteria 4401
238 Ga0450920_004835 3300042122 Bacteria 2381
239 Ga0450907_000198 3300042146 Bacteria 21876
240 Ga0439446_0002486 3300042156 Bacteria 4433
241 Ga0450908_004069 3300042184 Bacteria 2827
242 Ga0439434_0001553 3300042435 Bacteria 6616
243 Ga0439434_0024967 3300042435 Bacteria 1803
244 Ga0439434_0066224 3300042435 Bacteria 1134
245 Ga0439434_0066872 3300042435 Bacteria 1128
246 Ga0439435_0054799 3300042436 Bacteria 1149
247 Ga0439459_0035879 3300042438 Bacteria 1032
248 Ga0450918_004243 3300042531 Bacteria 2624
249 Ga0450918_012176 3300042531 Bacteria 1499
250 Ga0466972_0013352 3300044658 Bacteria 4124
251 Ga0466972_0028949 3300044658 Bacteria 2729
252 Ga0466965_0007219 3300044683 Bacteria 5093
253 Ga0466965_0007905 3300044683 Bacteria 4905
254 Ga0466965_0023660 3300044683 Bacteria 2967
255 Ga0466965_0254388 3300044683 Bacteria 943
256 Ga0466966_0212317 3300044684 Bacteria 1169
257 Ga0466961_0078689 3300044693 Bacteria 2088
258 Ga0466964_0252995 3300044706 Bacteria 869
259 Ga0466968_0048723 3300044735 Bacteria 1803
260 Ga0466970_0001725 3300044765 Bacteria 10530
261 Ga0466970_0003790 3300044765 Bacteria 7401
262 Ga0466970_0037634 3300044765 Bacteria 2565
263 Ga0466957_0007729 3300044842 Bacteria 6081
264 Ga0466957_0472705 3300044842 Bacteria 866
265 Ga0466960_0000151 3300044901 Bacteria 23589
266 Ga0466960_0001725 3300044901 Bacteria 8026
267 Ga0466960_0041195 3300044901 Bacteria 2187
268 Ga0466960_0047702 3300044901 Bacteria 2055
269 Ga0466960_0102533 3300044901 Bacteria 1476
270 Ga0466959_0091393 3300045049 Bacteria 2185
271 Ga0466958_0049275 3300045836 Bacteria 2548
272 Ga0466967_0725078 3300045976 Bacteria 985
273 Ga0495638_0042577 3300046460 Bacteria 2867
274 Ga0495638_0359400 3300046460 Bacteria 766
275 Ga0495653_0020578 3300046463 Bacteria 5348
276 Ga0495580_0004371 3300046472 Bacteria 11866
277 Ga0495580_0016668 3300046472 Bacteria 5514
278 Ga0495580_0197192 3300046472 Bacteria 1388
279 Ga0495582_0148278 3300046473 Bacteria 1331
280 Ga0495639_0008854 3300046475 Bacteria 4313
281 Ga0495662_0077766 3300046476 Bacteria 1611
282 Ga0495664_0051009 3300046477 Bacteria 2457
283 Ga0495594_0283284 3300046499 Bacteria 944
284 Ga0495606_0009971 3300046507 Bacteria 7946
285 Ga0495648_0004374 3300046524 Bacteria 12088
286 Ga0495665_0000709 3300046531 Bacteria 17165
287 Ga0495586_0003928 3300046535 Bacteria 7975
288 Ga0495586_0015922 3300046535 Bacteria 4001
289 Ga0495586_0036644 3300046535 Bacteria 2633
290 Ga0495587_0148820 3300046536 Bacteria 1334
291 Ga0495645_0214352 3300046543 Bacteria 1298
292 Ga0495645_0256556 3300046543 Bacteria 1160
293 Ga0495667_0016886 3300046559 Bacteria 4928
294 Ga0495656_0002635 3300046615 Bacteria 5986
295 Ga0495668_0029362 3300046616 Bacteria 3107
296 Ga0495668_0069677 3300046616 Bacteria 1934
297 Ga0495611_0032305 3300046648 Bacteria 2306
298 Ga0495661_0105546 3300046665 Bacteria 1578
299 Ga0495588_0009692 3300046674 Bacteria 4463
300 Ga0495588_0049192 3300046674 Bacteria 2167
301 Ga0495588_0069781 3300046674 Bacteria 1826
302 Ga0495657_0233250 3300046675 Bacteria 1112
303 Ga0495670_0045408 3300046691 Bacteria 2193
304 Ga0495670_0198616 3300046691 Bacteria 1062
305 Ga0495600_0008415 3300046809 Bacteria 6334
306 Ga0495581_0042134 3300047315 Bacteria 2642
307 Ga0495581_0241359 3300047315 Bacteria 1056
308 Ga0495674_0504012 3300047319 Bacteria 968
309 Ga0495672_0050798 3300047320 Bacteria 2445
310 Ga0495672_0065651 3300047320 Bacteria 2073
311 Ga0495675_0006002 3300047444 Bacteria 7427
312 Ga0495677_0064871 3300047445 Bacteria 1357
313 Ga0495673_0016646 3300047469 Bacteria 3754
314 Ga0495681_0045648 3300047470 Bacteria 2095
315 Ga0495686_0162347 3300047472 Bacteria 1305
316 Ga0495593_0018131 3300047673 Bacteria 3958
317 Ga0495593_0080636 3300047673 Bacteria 1683
318 Ga0496100_0030948 3300048903 Bacteria 3323
319 Ga0496100_0041613 3300048903 Bacteria 2930
320 Ga0496100_0091587 3300048903 Bacteria 2075
321 Ga0496100_0183713 3300048903 Bacteria 1513
322 Ga0496100_0351594 3300048903 Bacteria 1113
323 Ga0496101_0000133 3300048904 Bacteria 67081
324 Ga0496101_0019633 3300048904 Bacteria 4617
325 Ga0496101_0029708 3300048904 Bacteria 3824
326 Ga0496102_0000032 3300048905 Bacteria 214049
327 Ga0496102_0000803 3300048905 Bacteria 30524
328 Ga0496102_0056408 3300048905 Bacteria 3583
329 Ga0496102_0204713 3300048905 Bacteria 1860
330 Ga0496102_0456669 3300048905 Bacteria 1198
331 Ga0496103_0000027 3300048906 Bacteria 213677
332 Ga0496103_0001206 3300048906 Bacteria 17757
333 Ga0496103_0004543 3300048906 Bacteria 8399
334 Ga0496103_0025891 3300048906 Bacteria 3548
335 Ga0496103_0050167 3300048906 Bacteria 2581
336 Ga0496104_0290437 3300048907 Bacteria 1547
337 Ga0496105_0088086 3300048908 Bacteria 2564
338 Ga0496106_0015995 3300048909 Bacteria 5548
339 Ga0496106_0088362 3300048909 Bacteria 2389
340 Ga0496106_0132040 3300048909 Bacteria 1959
341 Ga0496106_0149449 3300048909 Bacteria 1842
342 Ga0496107_0030012 3300048910 Bacteria 3873
343 Ga0496107_0151651 3300048910 Bacteria 1715
344 Ga0496108_0245720 3300048911 Bacteria 1557
345 Ga0496109_0115237 3300048912 Bacteria 2500
346 Ga0496109_0256315 3300048912 Bacteria 1648
347 Ga0496111_0137146 3300048914 Bacteria 1812
348 Ga0496112_0021629 3300048915 Bacteria 6118
349 Ga0496112_0065168 3300048915 Bacteria 3595
350 Ga0496112_0281689 3300048915 Bacteria 1609
351 Ga0496113_0003077 3300048916 Bacteria 9903
352 Ga0496113_0104677 3300048916 Bacteria 2196
353 Ga0496113_0545406 3300048916 Bacteria 930
354 Ga0496114_0126039 3300048917 Bacteria 2207
355 Ga0496116_0000088 3300048919 Bacteria 213188
356 Ga0496116_0010772 3300048919 Bacteria 7630
357 Ga0496117_0000018 3300048920 Bacteria 479613
358 Ga0496117_0001870 3300048920 Bacteria 28374
359 Ga0496117_0003054 3300048920 Bacteria 20066
360 Ga0496118_0000013 3300048921 Bacteria 574008
361 Ga0496118_0002411 3300048921 Bacteria 25221
362 Ga0496118_0002485 3300048921 Bacteria 24744
363 Ga0496119_0015706 3300048922 Bacteria 5807
364 Ga0496119_0020907 3300048922 Bacteria 4748
365 Ga0496119_0043970 3300048922 Bacteria 2817
366 Ga0496119_0048481 3300048922 Bacteria 2633
367 Ga0496119_0115527 3300048922 Bacteria 1482
368 Ga0496120_0011247 3300048923 Bacteria 6170
369 Ga0496120_0031492 3300048923 Bacteria 3210
370 Ga0496121_0000095 3300048924 Bacteria 209011
371 Ga0496121_0012383 3300048924 Bacteria 9313
372 Ga0496123_0023074 3300048926 Bacteria 4776
373 Ga0496124_0000363 3300048927 Bacteria 82857
374 Ga0496124_0052833 3300048927 Bacteria 3450
375 Ga0496124_0126992 3300048927 Bacteria 2030
376 Ga0496124_0162422 3300048927 Unclassified 1739
377 Ga0496124_0532412 3300048927 Bacteria 780
378 Ga0496125_0016386 3300048928 Bacteria 7120
379 Ga0496125_0050222 3300048928 Bacteria 3455
380 Ga0496126_0000415 3300048929 Bacteria 86270
381 Ga0496126_0007146 3300048929 Bacteria 12294
382 Ga0496126_0111027 3300048929 Bacteria 2388
383 Ga0496126_0245009 3300048929 Bacteria 1495
384 Ga0501309_022326 3300049129 Bacteria 894
385 Ga0501305_015076 3300049161 Bacteria 1088
386 Ga0501311_012181 3300049527 Bacteria 1069
387 Ga0501313_022593 3300049529 Bacteria 785
388 Ga0501315_010892 3300049531 Bacteria 1101
389 Ga0501316_009856 3300049532 Bacteria 1079
390 Ga0501317_002804 3300049533 Bacteria 1682
391 Ga0501317_009033 3300049533 Bacteria 1162
392 Ga0501318_006770 3300049534 Bacteria 1179
393 Ga0501320_004634 3300049536 Bacteria 1220
394 Ga0501321_001807 3300049537 Bacteria 1771
395 Ga0501032_0000489 3300049569 Bacteria 32163
396 Ga0501032_0002322 3300049569 Bacteria 14909
397 Ga0501032_0015763 3300049569 Bacteria 5329
398 Ga0501032_0195537 3300049569 Bacteria 1321
399 Ga0501034_0000016 3300049571 Bacteria 289751
400 Ga0501034_0186988 3300049571 Bacteria 2034
401 Ga0501036_0006678 3300049572 Bacteria 9376
402 Ga0501036_0465011 3300049572 Bacteria 1053
403 Ga0501037_0000256 3300049573 Bacteria 45692
404 Ga0501037_0004927 3300049573 Bacteria 9714
405 Ga0501037_0080496 3300049573 Bacteria 2363
406 Ga0501037_0102529 3300049573 Bacteria 2064
407 Ga0501038_0006375 3300049574 Bacteria 10921
408 Ga0501039_0001292 3300049575 Bacteria 18279
409 Ga0501043_0001802 3300049579 Bacteria 18406
410 Ga0501043_0031178 3300049579 Bacteria 4192
411 Ga0501043_0083113 3300049579 Bacteria 2517
412 Ga0501070_0002836 3300049586 Bacteria 15125
413 Ga0501070_0187441 3300049586 Bacteria 1701
414 Ga0501071_0800847 3300049587 Unclassified 726
415 Ga0501072_0611726 3300049588 Unclassified 859
416 Ga0501073_0054026 3300049589 Bacteria 2813
417 Ga0501077_0375272 3300049593 Bacteria 908
418 Ga0501044_0077058 3300049823 Bacteria 3382
419 nmdc:mga03n38_14831_c1 3300050490 Bacteria 2997
420 nmdc:mga00v17_235551_c1 3300050491 Bacteria 1186
421 nmdc:mga00v17_31072_c1 3300050491 Bacteria 3147
422 nmdc:mga00v17_69424_c1 3300050491 Bacteria 2181
423 nmdc:mga0yw44_317259_c1 3300050492 Bacteria 1046
424 nmdc:mga06z11_329368_c1 3300050494 Bacteria 912
425 Ga0500635_0011000 3300053080 Bacteria 2560
426 Ga0495655_0059129 3300053083 Bacteria 1040
427 Ga0500643_003081 3300053087 Bacteria 8193
428 Ga0500643_026776 3300053087 Bacteria 1800
429 Ga0500651_0000706 3300053093 Bacteria 16449
430 Ga0500556_0040937 3300053104 Bacteria 1631
431 Ga0500642_0072429 3300053130 Bacteria 1570
432 Ga0500652_001006 3300053131 Bacteria 9209
433 Ga0500652_013416 3300053131 Bacteria 2901
434 Ga0500590_000283 3300053148 Bacteria 16088
435 Ga0500616_0006157 3300053153 Bacteria 7934
436 Ga0500616_0010186 3300053153 Bacteria 5642
437 Ga0500616_0018798 3300053153 Bacteria 3903
438 Ga0500645_000007 3300053730 Bacteria 233700
439 Ga0500645_034561 3300053730 Bacteria 1509
440 Ga0590075_065014 3300059424 Bacteria 941
441 Ga0587090_003487 3300059510 Bacteria 1832
442 Ga0587072_006472 3300059643 Bacteria 1786
443 Ga0466962_0279954 3300061719 Bacteria 823
444 2644636389 2643221715 Bacteria 6671032
445 2537897867 2537561592 Bacteria 4348607
446 2644487607 2643221687 Bacteria 6500351
447 2644515711 2643221692 Bacteria 7282860
448 2644637415 2643221715 Bacteria 6671032
449 2691513860 2690315906 Bacteria 4517044
450 2738705864 2738541274 Bacteria 6909446
451 2739330353 2738543028 Bacteria 6917070
452 2753302095 2751185788 Bacteria 4541048
453 2775656911 2775506735 Bacteria 4556596
454 2808831127 2808606357 Bacteria 4466944
455 2808852391 2808606360 Bacteria 4404006
456 2808879317 2808606366 Bacteria 4415912
457 2808891181 2808606370 Bacteria 4942454
458 2808896437 2808606371 Bacteria 4251511
459 2810363752 2808606700 Bacteria 3482157
460 2812321178 2811994871 Bacteria 4497550
461 2842135649 2842134933 Bacteria 5847019
462 2844852720 2844849076 Bacteria 4091819
463 2857479346 2857479173 Bacteria 2469263
464 2857634528 2857632687 Bacteria 2448521
465 2857742120 2857740372 Bacteria 4782044
466 2870802492 2870801768 Bacteria 2710986
467 2870804564 2870804320 Bacteria 2552467
468 2897563478 2897561785 Bacteria 3256946
469 2902792535 2902792274 Bacteria 7270173
470 2902801674 2902799365 Bacteria 5419524
471 2902815394 2902810491 Bacteria 6794147
472 2902839083 2902837492 Bacteria 6697721
473 2904432592 2904430863 Bacteria 3486923
474 2904498231 2904497146 Bacteria 4731781
475 2904503053 2904501621 Bacteria 3401437
476 2904777593 2904776348 Bacteria 4658726
477 2905930888 2905926851 Bacteria 4423176
478 2908675770 2908674828 Bacteria 3382763
479 2909074822 2909074476 Bacteria 3436050
480 2910812645 2910809715 Bacteria 4982797
481 2919034963 2919034639 Bacteria 4763403
482 2919041285 2919039151 Bacteria 3391018
483 2919043775 2919042368 Bacteria 3905917
484 2919051447 2919051321 Bacteria 4210889
485 2919059790 2919059106 Bacteria 4991624
486 2919394767 2919391150 Bacteria 4884741
487 2919540423 2919538618 Bacteria 4677069
488 2928106800 2928104781 Bacteria 3877447
489 2928502391 2928500415 Bacteria 3384541
490 2932428277 2932426870 Bacteria 4547726
491 2933421116 2933418574 Bacteria 4476724
492 2939583368 2939582691 Bacteria 7088898
493 2939601313 2939598168 Bacteria 4687164
494 2939648685 2939647034 Bacteria 4681660
495 2939675266 2939674588 Bacteria 4844420
496 2939746256 2939743619 Bacteria 5762299
497 2945918936 2945916053 Bacteria 4555517
498 2945920702 2945920336 Bacteria 4501603
499 2945943112 2945941187 Bacteria 4682474
500 2945959146 2945956166 Bacteria 5110334
501 2946004423 2946003308 Bacteria 3857229
502 2946025907 2946024296 Bacteria 3508095
503 2946039005 2946037020 Bacteria 4900426
504 2946062787 2946059875 Bacteria 4386623
505 2954000412 2953998280 Bacteria 4812144
506 2974306916 2974302888 Bacteria 4369871
507 2984554230 2984551494 Bacteria 3877562
508 8004022745 8004021418 Bacteria 4313954
509 8004029421 8004025490 Bacteria 4327753
510 8054107872 8054107350 Bacteria 5022511
511 LJQas_1001217
512 LJQas_1001668
513 JGI25152J39213_1000140
514 rootL2_10140888
515 Ga0055540_1000489
516 Ga0055540_1000565
517 Ga0055540_1009411
518 Ga0070670_100127516
519 Ga0070666_10160351
520 Ga0070668_100002242
521 Ga0070668_100169633
522 Ga0070669_100004157
523 Ga0070669_100021613
524 Ga0070675_100170556
525 Ga0070671_100474955
526 Ga0070673_100157299
527 Ga0070667_100000022
528 Ga0070667_100167390
529 Ga0070714_100919094
530 Ga0070685_10383619
531 Ga0068853_100131815
532 Ga0070672_100249214
533 Ga0070665_100010516
534 Ga0068859_100000329
535 Ga0068864_100682064
536 Ga0068863_100012815
537 Ga0068858_100001138
538 Ga0068858_100125242
539 Ga0068860_100000038
540 Ga0068862_100000084
541 Ga0075365_10020980
542 Ga0075365_10272421
543 Ga0075364_10004837
544 Ga0075364_10014160
545 Ga0075364_10197111
546 Ga0075364_10224383
547 Ga0075432_10017291
548 Ga0075369_10002885
549 Ga0097620_100000329
550 Ga0105244_10004227
551 Ga0105244_10006637
552 Ga0105244_10140427
553 Ga0105244_10142214
554 Ga0105240_10662982
555 Ga0111539_11441381
556 Ga0105245_10205402
557 Ga0105245_10384629
558 Ga0105247_10000021
559 Ga0105247_10000065
560 Ga0105243_10157032
561 Ga0105248_10000130
562 Ga0105248_10300777
563 Ga0105237_10014427
564 Ga0105249_10000620
565 Ga0105246_10002276
566 Ga0105246_10019891
567 Ga0105246_10152017
568 Ga0105246_10188007
569 Ga0157371_10122610
570 Ga0157370_10020509
571 Ga0157369_10363898
572 Ga0157369_10498787
573 Ga0157374_10368873
574 Ga0157378_10343827
575 Ga0163162_10034522
576 Ga0163162_10094947
577 Ga0157375_10759246
578 Ga0163163_10023301
579 Ga0157379_10860216
580 Ga0206354_11277054
581 Ga0207425_1002927
582 Ga0209148_1002761
583 Ga0209759_1019662
584 Ga0209129_1000067
585 Ga0209673_1061594
586 Ga0209025_1001395
587 Ga0209051_1001145
588 Ga0209051_1002460
589 Ga0209051_1003979
590 Ga0209051_1006066
591 Ga0209051_1009127
592 Ga0207697_10004823
593 Ga0207697_10058530
594 Ga0207655_1005476
595 Ga0207655_1023324
596 Ga0207682_10043756
597 Ga0207710_10000027
598 Ga0207680_10289282
599 Ga0207645_10019501
600 Ga0207671_10004613
601 Ga0207681_10001882
602 Ga0207681_10015247
603 Ga0207681_10015988
604 Ga0207687_10524288
605 Ga0207664_10394713
606 Ga0207709_10404835
607 Ga0207709_10665032
608 Ga0207669_10170636
609 Ga0207691_10011415
610 Ga0207711_10000089
611 Ga0207711_10329004
612 Ga0207651_10086788
613 Ga0207712_10000484
614 Ga0207668_10001612
615 Ga0207658_10000600
616 Ga0207658_10136658
617 Ga0207703_10027632
618 Ga0207639_10108976
619 Ga0207678_10098272
620 Ga0207641_10001014
621 Ga0207683_10101459
622 Ga0268265_10000028
623 Ga0268264_10000092
624 Ga0307408_100001200
625 Ga0307408_100023860
626 Ga0307408_100029791
627 Ga0307408_100143199
628 Ga0307408_100553385
629 Ga0307405_10019060
630 Ga0307405_10019227
631 Ga0307405_10029229
632 Ga0307405_10043931
633 Ga0307405_10159845
634 Ga0307405_10278910
635 Ga0307413_10057753
636 Ga0307413_10089296
637 Ga0307413_10127098
638 Ga0307413_10280383
639 Ga0307413_10666571
640 Ga0307410_10017746
641 Ga0307410_10059836
642 Ga0307410_10119328
643 Ga0307410_10144933
644 Ga0307410_10290980
645 Ga0307410_10382655
646 Ga0307410_10399851
647 Ga0307410_10796446
648 Ga0307406_10321272
649 Ga0307407_10075882
650 Ga0307407_10083596
651 Ga0307407_10244803
652 Ga0307407_10319092
653 Ga0307407_10428067
654 Ga0307407_10564729
655 Ga0307412_10002167
656 Ga0307412_10066538
657 Ga0307412_10081507
658 Ga0307412_10096214
659 Ga0307412_10177545
660 Ga0307412_10195877
661 Ga0307412_10209623
662 Ga0307409_100023242
663 Ga0307409_100030508
664 Ga0307409_100041937
665 Ga0307409_100091466
666 Ga0307409_100202518
667 Ga0307409_100240315
668 Ga0307409_100263608
669 Ga0307409_100317093
670 Ga0307409_100619024
671 Ga0307416_100017801
672 Ga0307416_100550042
673 Ga0307416_100706027
674 Ga0307414_10178095
675 Ga0307414_10271599
676 Ga0307414_10379497
677 Ga0307414_10576191
678 Ga0307411_10059593
679 Ga0307411_10148034
680 Ga0307415_100025727
681 Ga0307415_100036532
682 Ga0307415_100058750
683 Ga0307415_100552108
684 Ga0307415_100748223
685 Ga0395899_0010072
686 Ga0395899_0016113
687 Ga0395899_0066152
688 Ga0395899_0069519
689 Ga0395899_0105356
690 Ga0395900_0018741
691 Ga0395900_0049923
692 Ga0395900_0069069
693 Ga0395900_0085090
694 Ga0395900_0123356
695 Ga0395900_0533316
696 Ga0395898_0002818
697 Ga0395898_0017683
698 Ga0395898_0035249
699 Ga0395898_0233430
700 Ga0395905_0042768
701 Ga0395905_0256016
702 Ga0395905_0392725
703 Ga0395901_0004509
704 Ga0395901_0013220
705 Ga0395901_0020548
706 Ga0395901_0032466
707 Ga0395901_0092197
708 Ga0395901_0467249
709 Ga0395901_0573034
710 Ga0395901_0928656
711 Ga0439436_0001657
712 Ga0439436_0037334
713 Ga0439438_014162
714 Ga0439438_028062
715 Ga0439438_046254
716 Ga0439439_0006641
717 Ga0439439_0063698
718 Ga0439447_046914
719 Ga0439461_0011178
720 Ga0439461_0039613
721 Ga0439466_0000140
722 Ga0439466_0002880
723 Ga0439466_0005004
724 Ga0439466_0017756
725 Ga0439466_0065116
726 Ga0439465_0017421
727 Ga0439465_0053852
728 Ga0439465_0132555
729 Ga0451791_0960927
730 Ga0451793_0843802
731 Ga0451795_0295132
732 Ga0439431_0016897
733 Ga0439431_0038158
734 Ga0439431_0047120
735 Ga0439433_0000441
736 Ga0439442_000043
737 Ga0439442_000244
738 Ga0439445_0011303
739 Ga0439432_063467
740 Ga0439432_097563
741 Ga0439449_0007219
742 Ga0439449_0011042
743 Ga0439449_0027037
744 Ga0439457_000675
745 Ga0439457_039861
746 Ga0450919_000570
747 Ga0450920_001109
748 Ga0450920_004835
749 Ga0450907_000198
750 Ga0439446_0002486
751 Ga0450908_004069
752 Ga0439434_0001553
753 Ga0439434_0024967
754 Ga0439434_0066224
755 Ga0439434_0066872
756 Ga0439435_0054799
757 Ga0439459_0035879
758 Ga0450918_004243
759 Ga0450918_012176
760 Ga0466972_0013352
761 Ga0466972_0028949
762 Ga0466965_0007219
763 Ga0466965_0007905
764 Ga0466965_0023660
765 Ga0466965_0254388
766 Ga0466966_0212317
767 Ga0466961_0078689
768 Ga0466964_0252995
769 Ga0466968_0048723
770 Ga0466970_0001725
771 Ga0466970_0003790
772 Ga0466970_0037634
773 Ga0466957_0007729
774 Ga0466957_0472705
775 Ga0466960_0000151
776 Ga0466960_0001725
777 Ga0466960_0041195
778 Ga0466960_0047702
779 Ga0466960_0102533
780 Ga0466959_0091393
781 Ga0466958_0049275
782 Ga0466967_0725078
783 Ga0495638_0042577
784 Ga0495638_0359400
785 Ga0495653_0020578
786 Ga0495580_0004371
787 Ga0495580_0016668
788 Ga0495580_0197192
789 Ga0495582_0148278
790 Ga0495639_0008854
791 Ga0495662_0077766
792 Ga0495664_0051009
793 Ga0495594_0283284
794 Ga0495606_0009971
795 Ga0495648_0004374
796 Ga0495665_0000709
797 Ga0495586_0003928
798 Ga0495586_0015922
799 Ga0495586_0036644
800 Ga0495587_0148820
801 Ga0495645_0214352
802 Ga0495645_0256556
803 Ga0495667_0016886
804 Ga0495656_0002635
805 Ga0495668_0029362
806 Ga0495668_0069677
807 Ga0495611_0032305
808 Ga0495661_0105546
809 Ga0495588_0009692
810 Ga0495588_0049192
811 Ga0495588_0069781
812 Ga0495657_0233250
813 Ga0495670_0045408
814 Ga0495670_0198616
815 Ga0495600_0008415
816 Ga0495581_0042134
817 Ga0495581_0241359
818 Ga0495674_0504012
819 Ga0495672_0050798
820 Ga0495672_0065651
821 Ga0495675_0006002
822 Ga0495677_0064871
823 Ga0495673_0016646
824 Ga0495681_0045648
825 Ga0495686_0162347
826 Ga0495593_0018131
827 Ga0495593_0080636
828 Ga0496100_0030948
829 Ga0496100_0041613
830 Ga0496100_0091587
831 Ga0496100_0183713
832 Ga0496100_0351594
833 Ga0496101_0000133
834 Ga0496101_0019633
835 Ga0496101_0029708
836 Ga0496102_0000032
837 Ga0496102_0000803
838 Ga0496102_0056408
839 Ga0496102_0204713
840 Ga0496102_0456669
841 Ga0496103_0000027
842 Ga0496103_0001206
843 Ga0496103_0004543
844 Ga0496103_0025891
845 Ga0496103_0050167
846 Ga0496104_0290437
847 Ga0496105_0088086
848 Ga0496106_0015995
849 Ga0496106_0088362
850 Ga0496106_0132040
851 Ga0496106_0149449
852 Ga0496107_0030012
853 Ga0496107_0151651
854 Ga0496108_0245720
855 Ga0496109_0115237
856 Ga0496109_0256315
857 Ga0496111_0137146
858 Ga0496112_0021629
859 Ga0496112_0065168
860 Ga0496112_0281689
861 Ga0496113_0003077
862 Ga0496113_0104677
863 Ga0496113_0545406
864 Ga0496114_0126039
865 Ga0496116_0000088
866 Ga0496116_0010772
867 Ga0496117_0000018
868 Ga0496117_0001870
869 Ga0496117_0003054
870 Ga0496118_0000013
871 Ga0496118_0002411
872 Ga0496118_0002485
873 Ga0496119_0015706
874 Ga0496119_0020907
875 Ga0496119_0043970
876 Ga0496119_0048481
877 Ga0496119_0115527
878 Ga0496120_0011247
879 Ga0496120_0031492
880 Ga0496121_0000095
881 Ga0496121_0012383
882 Ga0496123_0023074
883 Ga0496124_0000363
884 Ga0496124_0052833
885 Ga0496124_0126992
886 Ga0496124_0162422
887 Ga0496124_0532412
888 Ga0496125_0016386
889 Ga0496125_0050222
890 Ga0496126_0000415
891 Ga0496126_0007146
892 Ga0496126_0111027
893 Ga0496126_0245009
894 Ga0501309_022326
895 Ga0501305_015076
896 Ga0501311_012181
897 Ga0501313_022593
898 Ga0501315_010892
899 Ga0501316_009856
900 Ga0501317_002804
901 Ga0501317_009033
902 Ga0501318_006770
903 Ga0501320_004634
904 Ga0501321_001807
905 Ga0501032_0000489
906 Ga0501032_0002322
907 Ga0501032_0015763
908 Ga0501032_0195537
909 Ga0501034_0000016
910 Ga0501034_0186988
911 Ga0501036_0006678
912 Ga0501036_0465011
913 Ga0501037_0000256
914 Ga0501037_0004927
915 Ga0501037_0080496
916 Ga0501037_0102529
917 Ga0501038_0006375
918 Ga0501039_0001292
919 Ga0501043_0001802
920 Ga0501043_0031178
921 Ga0501043_0083113
922 Ga0501070_0002836
923 Ga0501070_0187441
924 Ga0501071_0800847
925 Ga0501072_0611726
926 Ga0501073_0054026
927 Ga0501077_0375272
928 Ga0501044_0077058
929 nmdc:mga03n38_14831_c1
930 nmdc:mga00v17_235551_c1
931 nmdc:mga00v17_31072_c1
932 nmdc:mga00v17_69424_c1
933 nmdc:mga0yw44_317259_c1
934 nmdc:mga06z11_329368_c1
935 Ga0500635_0011000
936 Ga0495655_0059129
937 Ga0500643_003081
938 Ga0500643_026776
939 Ga0500651_0000706
940 Ga0500556_0040937
941 Ga0500642_0072429
942 Ga0500652_001006
943 Ga0500652_013416
944 Ga0500590_000283
945 Ga0500616_0006157
946 Ga0500616_0010186
947 Ga0500616_0018798
948 Ga0500645_000007
949 Ga0500645_034561
950 Ga0590075_065014
951 Ga0587090_003487
952 Ga0587072_006472
953 Ga0466962_0279954
954 2644636389
955 2537897867
956 2644487607
957 2644515711
958 2644637415
959 2691513860
960 2738705864
961 2739330353
962 2753302095
963 2775656911
964 2808831127
965 2808852391
966 2808879317
967 2808891181
968 2808896437
969 2810363752
970 2812321178
971 2842135649
972 2844852720
973 2857479346
974 2857634528
975 2857742120
976 2870802492
977 2870804564
978 2897563478
979 2902792535
980 2902801674
981 2902815394
982 2902839083
983 2904432592
984 2904498231
985 2904503053
986 2904777593
987 2905930888
988 2908675770
989 2909074822
990 2910812645
991 2919034963
992 2919041285
993 2919043775
994 2919051447
995 2919059790
996 2919394767
997 2919540423
998 2928106800
999 2928502391
1000 2932428277
1001 2933421116
1002 2939583368
1003 2939601313
1004 2939648685
1005 2939675266
1006 2939746256
1007 2945918936
1008 2945920702
1009 2945943112
1010 2945959146
1011 2946004423
1012 2946025907
1013 2946039005
1014 2946062787
1015 2954000412
1016 2974306916
1017 2984554230
1018 8004022745
1019 8004029421
1020 8054107872

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

26

184

0.86

PF08659

KR

KR domain

25

116

0.86

PF00106

adh_short

short chain dehydrogenase

24

215

0.85

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

30

258

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1geg-assembly2.cif.gz_F cryatal structure analysis of meso-2,3-butanediol dehydrogenase 0.8701 7 238
7eny-assembly1.cif.gz_C crystal structure of hydroxysteroid dehydrogenase from escherichia coli 0.8666 4 241
3edm-assembly1.cif.gz_D crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.8657 4 239
3edm-assembly1.cif.gz_C crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.8647 4 241
6zzo-assembly2.cif.gz_D-3 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and acetoacetate 0.8634 4 239
ID Description Score Start End Superfamily
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9423 3 82 3.40.50.720
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8943 4 62 3.40.50.720
af_Q5AEJ7_6_258_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8669 4 241 3.40.50.720
af_Q0JBH4_12_100_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8604 7 88 3.40.50.720
af_Q7Z5J1_16_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8581 2 198 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A527ZB18-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9967 4 82
AF-A0A527ZK25-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9945 4 88
AF-A0A7X9GT35-F1-model_v4 SDR family oxidoreductase 0.982 1 249
AF-A0A3C1QWH6-F1-model_v4 Oxidoreductase 0.9817 1 88
AF-X1XQX1-F1-model_v4 deleted 0.9786 1 82

Map