F457195

General Info

Members Datasets Scaffolds Average Seq Length
510 215 1020 135

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0094693|Ga0495670_0094693_25_474
Length 149
Sequence VKRGIKRLKEQTNMRKATLLILPAILLAGCSAFGGNKPKSLDEFAVARNAPLVIPPDYSLTPPVAGTVSLTAQDAQTQAIEALFGGPAPRSSTEMSVLDRAGRDRASLGIRSTAGDPDTRVVDKGQATQTILAAPQADSPEASAQTPGQ

Samples

Sample ID Description Type Environment
1 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
140 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
141 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
142 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
158 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
170 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
171 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
172 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
173 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
176 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
179 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
188 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
202 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
203 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
204 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
205 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
206 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
207 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 1.18
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.55
Rhizosphere 96.86
Stem 0
Stem Tuber 0.2
Unclassified 2.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495670_0094693 3300046691 Bacteria 1532
2 MBSR1b_contig_6802744 2162886012 Bacteria 1522
3 JGI24752J21851_1031815 3300001976 Unclassified 697
4 JGI24739J22299_10003381 3300001989 Bacteria 6090
5 JGI24738J21930_10002673 3300002075 Bacteria 4593
6 JGI24033J26618_1020042 3300002155 Bacteria 851
7 JGI24034J26672_10041854 3300002239 Bacteria 771
8 JGI24742J22300_10025480 3300002244 Bacteria 1022
9 Ga0065712_10221706 3300005290 Bacteria 1039
10 Ga0065715_10002244 3300005293 Bacteria 8545
11 Ga0065715_10142836 3300005293 Bacteria 1821
12 Ga0065715_10676846 3300005293 Bacteria 665
13 Ga0070658_10001600 3300005327 Bacteria 19143
14 Ga0070676_10413647 3300005328 Bacteria 941
15 Ga0070676_11229661 3300005328 Unclassified 570
16 Ga0070683_100002224 3300005329 Bacteria 15369
17 Ga0070670_100044820 3300005331 Bacteria 3802
18 Ga0070670_100090243 3300005331 Bacteria 2634
19 Ga0070670_100130966 3300005331 Bacteria 2166
20 Ga0070670_101781294 3300005331 Bacteria 567
21 Ga0070677_10004568 3300005333 Bacteria 4525
22 Ga0070677_10204602 3300005333 Bacteria 955
23 Ga0070666_10003536 3300005335 Bacteria 9473
24 Ga0070666_10060271 3300005335 Bacteria 2568
25 Ga0070666_10765097 3300005335 Bacteria 710
26 Ga0070680_100011205 3300005336 Bacteria 6935
27 Ga0070680_100056703 3300005336 Bacteria 3202
28 Ga0070680_100207279 3300005336 Bacteria 1653
29 Ga0068868_100743313 3300005338 Bacteria 881
30 Ga0070660_100000194 3300005339 Bacteria 40512
31 Ga0070660_100001048 3300005339 Bacteria 18599
32 Ga0070660_100060303 3300005339 Bacteria 2944
33 Ga0070660_100120823 3300005339 Bacteria 2090
34 Ga0070660_100252078 3300005339 Bacteria 1440
35 Ga0070661_100000157 3300005344 Bacteria 55418
36 Ga0070668_100140132 3300005347 Bacteria 1948
37 Ga0070668_100323613 3300005347 Bacteria 1299
38 Ga0070668_102052298 3300005347 Bacteria 528
39 Ga0070669_100019487 3300005353 Bacteria 4846
40 Ga0070669_100020028 3300005353 Bacteria 4777
41 Ga0070669_100058324 3300005353 Bacteria 2833
42 Ga0070669_100096034 3300005353 Bacteria 2230
43 Ga0070669_100228905 3300005353 Bacteria 1473
44 Ga0070669_100233445 3300005353 Bacteria 1459
45 Ga0070669_100282736 3300005353 Bacteria 1330
46 Ga0070675_100053108 3300005354 Bacteria 3332
47 Ga0070675_100068461 3300005354 Bacteria 2939
48 Ga0070671_100017860 3300005355 Bacteria 5751
49 Ga0070671_100018699 3300005355 Bacteria 5630
50 Ga0070671_100043512 3300005355 Bacteria 3732
51 Ga0070671_100068727 3300005355 Bacteria 2955
52 Ga0070671_100700226 3300005355 Bacteria 879
53 Ga0070671_101641898 3300005355 Bacteria 570
54 Ga0070674_100181692 3300005356 Bacteria 1612
55 Ga0070673_100079740 3300005364 Bacteria 2651
56 Ga0070673_100126161 3300005364 Bacteria 2142
57 Ga0070673_100419878 3300005364 Bacteria 1199
58 Ga0070659_100000086 3300005366 Bacteria 70060
59 Ga0070659_100193091 3300005366 Bacteria 1674
60 Ga0070659_100321252 3300005366 Bacteria 1294
61 Ga0070659_100389891 3300005366 Bacteria 1174
62 Ga0070667_100010080 3300005367 Bacteria 7823
63 Ga0070667_100016155 3300005367 Bacteria 6175
64 Ga0070667_100277977 3300005367 Bacteria 1503
65 Ga0070714_100805784 3300005435 Bacteria 910
66 Ga0070701_10071199 3300005438 Bacteria 1859
67 Ga0070705_100285248 3300005440 Bacteria 1176
68 Ga0070700_100048484 3300005441 Bacteria 2633
69 Ga0070663_100129047 3300005455 Bacteria 1918
70 Ga0070663_100174835 3300005455 Bacteria 1662
71 Ga0070663_101774013 3300005455 Bacteria 553
72 Ga0070678_100985573 3300005456 Bacteria 774
73 Ga0070662_100000640 3300005457 Bacteria 21171
74 Ga0070662_100072391 3300005457 Bacteria 2544
75 Ga0070662_100862023 3300005457 Bacteria 772
76 Ga0070662_100978910 3300005457 Bacteria 724
77 Ga0070681_10451968 3300005458 Bacteria 1197
78 Ga0070681_10684987 3300005458 Bacteria 941
79 Ga0068867_100152991 3300005459 Bacteria 1814
80 Ga0068867_100264258 3300005459 Bacteria 1404
81 Ga0070679_100098364 3300005530 Bacteria 2913
82 Ga0070679_100210421 3300005530 Bacteria 1909
83 Ga0070679_100214050 3300005530 Bacteria 1890
84 Ga0070679_100485558 3300005530 Bacteria 1179
85 Ga0070684_100165532 3300005535 Bacteria 2007
86 Ga0068853_100002366 3300005539 Bacteria 14099
87 Ga0068853_100068438 3300005539 Bacteria 3087
88 Ga0068853_100212990 3300005539 Bacteria 1762
89 Ga0068853_100281636 3300005539 Bacteria 1533
90 Ga0068853_101817927 3300005539 Bacteria 591
91 Ga0070672_100008982 3300005543 Bacteria 6869
92 Ga0070672_100524045 3300005543 Bacteria 1027
93 Ga0070695_100198257 3300005545 Bacteria 1433
94 Ga0070693_100010206 3300005547 Bacteria 4697
95 Ga0070693_100889191 3300005547 Unclassified 667
96 Ga0070665_100005304 3300005548 Bacteria 13314
97 Ga0070665_100693144 3300005548 Bacteria 1032
98 Ga0070665_100785036 3300005548 Bacteria 965
99 Ga0068855_100001534 3300005563 Bacteria 29001
100 Ga0068855_100016873 3300005563 Bacteria 8781
101 Ga0068855_100050721 3300005563 Bacteria 4889
102 Ga0068855_101179185 3300005563 Bacteria 797
103 Ga0070664_100001052 3300005564 Bacteria 21695
104 Ga0070664_100022438 3300005564 Bacteria 5204
105 Ga0070664_100167132 3300005564 Bacteria 1949
106 Ga0068857_100282929 3300005577 Bacteria 1526
107 Ga0068854_100107209 3300005578 Bacteria 2103
108 Ga0068856_100000159 3300005614 Bacteria 70023
109 Ga0068856_101071841 3300005614 Bacteria 823
110 Ga0068852_100005858 3300005616 Bacteria 8830
111 Ga0068852_100018129 3300005616 Bacteria 5540
112 Ga0068852_100291511 3300005616 Bacteria 1577
113 Ga0068852_100449238 3300005616 Bacteria 1276
114 Ga0068859_100007322 3300005617 Bacteria 11193
115 Ga0068859_100153229 3300005617 Bacteria 2381
116 Ga0068864_100044153 3300005618 Bacteria 3819
117 Ga0068864_100317712 3300005618 Bacteria 1462
118 Ga0068864_100996974 3300005618 Bacteria 831
119 Ga0068861_100657274 3300005719 Bacteria 969
120 Ga0068870_10122827 3300005840 Bacteria 1498
121 Ga0068863_100518677 3300005841 Bacteria 1175
122 Ga0068858_100137172 3300005842 Bacteria 2296
123 Ga0068860_102461139 3300005843 Unclassified 540
124 Ga0068860_102729424 3300005843 Unclassified 512
125 Ga0068862_100013680 3300005844 Bacteria 6720
126 Ga0068862_100222963 3300005844 Bacteria 1708
127 Ga0068862_101259488 3300005844 Bacteria 740
128 Ga0068862_101303193 3300005844 Bacteria 728
129 Ga0097621_100182212 3300006237 Bacteria 1815
130 Ga0068871_100279302 3300006358 Bacteria 1461
131 Ga0075431_100004395 3300006847 Bacteria 13822
132 Ga0068865_100540770 3300006881 Bacteria 977
133 Ga0097620_100007322 3300006931 Bacteria 11193
134 Ga0097620_100153230 3300006931 Bacteria 2381
135 Ga0111539_10136063 3300009094 Bacteria 2877
136 Ga0111539_11791783 3300009094 Bacteria 712
137 Ga0105243_10228626 3300009148 Bacteria 1649
138 Ga0105241_10415798 3300009174 Bacteria 1182
139 Ga0105242_10165685 3300009176 Bacteria 1939
140 Ga0105248_10000213 3300009177 Bacteria 66972
141 Ga0105248_10529579 3300009177 Bacteria 1329
142 Ga0105237_10617937 3300009545 Bacteria 1090
143 Ga0105238_10217959 3300009551 Bacteria 1884
144 Ga0105238_10324217 3300009551 Bacteria 1526
145 Ga0105249_10144261 3300009553 Bacteria 2286
146 Ga0105249_12158071 3300009553 Bacteria 630
147 Ga0157316_1030167 3300012510 Bacteria 652
148 Ga0157373_10026494 3300013100 Bacteria 4187
149 Ga0157373_10252036 3300013100 Bacteria 1249
150 Ga0157373_10455558 3300013100 Bacteria 921
151 Ga0157373_10512367 3300013100 Bacteria 867
152 Ga0157371_10000915 3300013102 Bacteria 33246
153 Ga0157371_10124542 3300013102 Bacteria 1833
154 Ga0157371_10750697 3300013102 Bacteria 733
155 Ga0157370_10080854 3300013104 Bacteria 3059
156 Ga0157370_11009839 3300013104 Bacteria 753
157 Ga0157369_10007383 3300013105 Bacteria 12652
158 Ga0163162_10078902 3300013306 Bacteria 3358
159 Ga0163162_10606373 3300013306 Bacteria 1221
160 Ga0157372_11409917 3300013307 Bacteria 803
161 Ga0157372_13306195 3300013307 Bacteria 514
162 Ga0157375_10055611 3300013308 Bacteria 3903
163 Ga0157375_10576463 3300013308 Bacteria 1286
164 Ga0157375_10742286 3300013308 Bacteria 1133
165 Ga0163163_10004075 3300014325 Bacteria 12457
166 Ga0163163_10809653 3300014325 Bacteria 1000
167 Ga0157380_10039131 3300014326 Bacteria 3686
168 Ga0157380_10049117 3300014326 Bacteria 3326
169 Ga0157380_10157615 3300014326 Bacteria 1969
170 Ga0157380_10373919 3300014326 Bacteria 1342
171 Ga0157379_10046364 3300014968 Bacteria 3877
172 Ga0163161_10013234 3300017792 Bacteria 5735
173 Ga0163161_10069319 3300017792 Bacteria 2578
174 Ga0163161_10144490 3300017792 Bacteria 1803
175 Ga0213875_10000307 3300021388 Bacteria 46789
176 Ga0207666_1010806 3300025271 Bacteria 1254
177 Ga0207673_1024561 3300025290 Bacteria 823
178 Ga0207697_10105857 3300025315 Bacteria 1202
179 Ga0207682_10003212 3300025893 Bacteria 7149
180 Ga0207688_10135115 3300025901 Bacteria 1448
181 Ga0207688_10520080 3300025901 Bacteria 746
182 Ga0207680_10041874 3300025903 Bacteria 2675
183 Ga0207680_10610261 3300025903 Bacteria 780
184 Ga0207647_10019837 3300025904 Bacteria 4515
185 Ga0207647_10352330 3300025904 Bacteria 833
186 Ga0207645_10061651 3300025907 Bacteria 2396
187 Ga0207705_10000276 3300025909 Bacteria 49160
188 Ga0207705_10001746 3300025909 Bacteria 17194
189 Ga0207705_10196024 3300025909 Bacteria 1529
190 Ga0207707_10626345 3300025912 Bacteria 908
191 Ga0207660_10000059 3300025917 Bacteria 56766
192 Ga0207660_10332927 3300025917 Bacteria 1214
193 Ga0207657_10000218 3300025919 Bacteria 59661
194 Ga0207657_10002119 3300025919 Bacteria 21474
195 Ga0207657_10006606 3300025919 Bacteria 12004
196 Ga0207657_10124871 3300025919 Bacteria 2114
197 Ga0207657_10242522 3300025919 Bacteria 1438
198 Ga0207657_10581158 3300025919 Bacteria 875
199 Ga0207657_10984354 3300025919 Bacteria 647
200 Ga0207657_11204135 3300025919 Unclassified 575
201 Ga0207649_10001645 3300025920 Bacteria 12964
202 Ga0207649_10554702 3300025920 Bacteria 879
203 Ga0207652_10086671 3300025921 Bacteria 2746
204 Ga0207652_10191563 3300025921 Bacteria 1839
205 Ga0207652_10371902 3300025921 Bacteria 1290
206 Ga0207681_10007451 3300025923 Bacteria 6705
207 Ga0207681_10028727 3300025923 Bacteria 3605
208 Ga0207681_10119190 3300025923 Bacteria 1933
209 Ga0207681_10396011 3300025923 Bacteria 1114
210 Ga0207681_10429714 3300025923 Bacteria 1071
211 Ga0207681_10477039 3300025923 Bacteria 1018
212 Ga0207681_10538140 3300025923 Bacteria 960
213 Ga0207681_10899917 3300025923 Bacteria 741
214 Ga0207681_11669432 3300025923 Bacteria 533
215 Ga0207694_10007706 3300025924 Bacteria 8158
216 Ga0207694_11035379 3300025924 Bacteria 695
217 Ga0207650_10022509 3300025925 Bacteria 4461
218 Ga0207650_10042129 3300025925 Bacteria 3349
219 Ga0207650_11385896 3300025925 Unclassified 598
220 Ga0207650_11802601 3300025925 Bacteria 518
221 Ga0207659_10060744 3300025926 Bacteria 2722
222 Ga0207659_10482763 3300025926 Bacteria 1047
223 Ga0207664_10315247 3300025929 Bacteria 1379
224 Ga0207664_10855044 3300025929 Bacteria 817
225 Ga0207644_10034365 3300025931 Bacteria 3547
226 Ga0207644_10049681 3300025931 Bacteria 3004
227 Ga0207644_10052858 3300025931 Bacteria 2921
228 Ga0207644_10069236 3300025931 Bacteria 2576
229 Ga0207644_10535021 3300025931 Bacteria 969
230 Ga0207690_10000100 3300025932 Bacteria 71510
231 Ga0207690_10109282 3300025932 Bacteria 1989
232 Ga0207690_10217604 3300025932 Bacteria 1460
233 Ga0207706_10000812 3300025933 Bacteria 32408
234 Ga0207706_10002713 3300025933 Bacteria 17246
235 Ga0207706_10063144 3300025933 Bacteria 3261
236 Ga0207709_10131267 3300025935 Bacteria 1708
237 Ga0207669_10088388 3300025937 Bacteria 2009
238 Ga0207704_10816899 3300025938 Bacteria 779
239 Ga0207691_10000355 3300025940 Bacteria 46166
240 Ga0207691_10235620 3300025940 Bacteria 1583
241 Ga0207711_10001921 3300025941 Bacteria 18877
242 Ga0207711_10238998 3300025941 Bacteria 1665
243 Ga0207661_10001153 3300025944 Bacteria 17664
244 Ga0207679_10000287 3300025945 Bacteria 38346
245 Ga0207679_10101242 3300025945 Bacteria 2253
246 Ga0207667_10000122 3300025949 Bacteria 121588
247 Ga0207667_10021727 3300025949 Bacteria 7110
248 Ga0207667_10068175 3300025949 Bacteria 3705
249 Ga0207667_11032831 3300025949 Bacteria 808
250 Ga0207651_10045997 3300025960 Bacteria 2931
251 Ga0207651_10137263 3300025960 Bacteria 1883
252 Ga0207651_10142582 3300025960 Bacteria 1853
253 Ga0207651_10324279 3300025960 Bacteria 1288
254 Ga0207668_10030791 3300025972 Bacteria 3529
255 Ga0207668_10473302 3300025972 Bacteria 1073
256 Ga0207668_10659894 3300025972 Bacteria 916
257 Ga0207668_10858904 3300025972 Bacteria 806
258 Ga0207668_11279492 3300025972 Bacteria 660
259 Ga0207640_10034721 3300025981 Bacteria 3149
260 Ga0207640_11647392 3300025981 Bacteria 579
261 Ga0207658_10023721 3300025986 Bacteria 4285
262 Ga0207658_10044961 3300025986 Bacteria 3217
263 Ga0207677_10887723 3300026023 Unclassified 803
264 Ga0207703_10114880 3300026035 Bacteria 2303
265 Ga0207639_10017503 3300026041 Bacteria 5081
266 Ga0207639_10076369 3300026041 Bacteria 2638
267 Ga0207639_10138880 3300026041 Bacteria 2022
268 Ga0207678_10027050 3300026067 Bacteria 5002
269 Ga0207678_10028518 3300026067 Bacteria 4873
270 Ga0207678_11473940 3300026067 Bacteria 601
271 Ga0207678_11811434 3300026067 Bacteria 534
272 Ga0207708_10045160 3300026075 Bacteria 3358
273 Ga0207702_10000208 3300026078 Bacteria 69979
274 Ga0207702_10237488 3300026078 Bacteria 1706
275 Ga0207702_10690132 3300026078 Bacteria 1006
276 Ga0207641_10385040 3300026088 Bacteria 1344
277 Ga0207648_10169520 3300026089 Bacteria 1929
278 Ga0207648_10618945 3300026089 Bacteria 999
279 Ga0207676_10180089 3300026095 Bacteria 1850
280 Ga0207676_10495446 3300026095 Bacteria 1159
281 Ga0207674_10285865 3300026116 Bacteria 1597
282 Ga0207674_10570345 3300026116 Bacteria 1093
283 Ga0207675_101355601 3300026118 Bacteria 732
284 Ga0207683_10038847 3300026121 Bacteria 4151
285 Ga0207683_10878513 3300026121 Bacteria 832
286 Ga0207698_10001407 3300026142 Bacteria 13964
287 Ga0207698_10071995 3300026142 Bacteria 2745
288 Ga0207698_10155695 3300026142 Bacteria 1990
289 Ga0207698_10839450 3300026142 Bacteria 923
290 Ga0209970_1067863 3300027614 Bacteria 660
291 Ga0209983_1019085 3300027665 Bacteria 1425
292 Ga0209998_10154495 3300027717 Unclassified 591
293 Ga0209974_10022033 3300027876 Bacteria 2109
294 Ga0268266_10008685 3300028379 Bacteria 9012
295 Ga0268266_10425173 3300028379 Bacteria 1259
296 Ga0268265_10118805 3300028380 Bacteria 2174
297 Ga0268265_10241998 3300028380 Bacteria 1593
298 Ga0268265_10708452 3300028380 Bacteria 973
299 Ga0268264_10309906 3300028381 Bacteria 1489
300 Ga0316176_1017963 3300030732 Bacteria 855
301 Ga0316178_1064076 3300030735 Bacteria 901
302 Ga0316181_1031510 3300030744 Bacteria 1303
303 Ga0316182_1281089 3300030745 Bacteria 1739
304 Ga0307408_100242648 3300031548 Bacteria 1481
305 Ga0307408_100602442 3300031548 Bacteria 976
306 Ga0307408_100629910 3300031548 Bacteria 956
307 Ga0307408_100720213 3300031548 Bacteria 898
308 Ga0307408_101191002 3300031548 Bacteria 710
309 Ga0307405_10079112 3300031731 Bacteria 2142
310 Ga0307405_10154653 3300031731 Bacteria 1617
311 Ga0307405_10161051 3300031731 Bacteria 1589
312 Ga0307405_10322053 3300031731 Bacteria 1181
313 Ga0307405_11037631 3300031731 Bacteria 701
314 Ga0307405_11075906 3300031731 Bacteria 690
315 Ga0307405_11309430 3300031731 Bacteria 630
316 Ga0307405_11375203 3300031731 Bacteria 616
317 Ga0307413_10026028 3300031824 Bacteria 3218
318 Ga0307413_10031309 3300031824 Bacteria 3000
319 Ga0307413_10052148 3300031824 Bacteria 2469
320 Ga0307413_10062523 3300031824 Bacteria 2303
321 Ga0307413_10078149 3300031824 Bacteria 2110
322 Ga0307413_10124913 3300031824 Bacteria 1750
323 Ga0307413_10401930 3300031824 Bacteria 1073
324 Ga0307413_10479897 3300031824 Bacteria 993
325 Ga0307413_10523597 3300031824 Bacteria 956
326 Ga0307413_10608216 3300031824 Bacteria 895
327 Ga0307413_11099685 3300031824 Bacteria 686
328 Ga0307413_11335555 3300031824 Bacteria 628
329 Ga0307413_11787303 3300031824 Bacteria 550
330 Ga0307413_11899242 3300031824 Bacteria 535
331 Ga0307410_10012107 3300031852 Bacteria 4968
332 Ga0307410_10022841 3300031852 Bacteria 3875
333 Ga0307410_10041466 3300031852 Bacteria 3036
334 Ga0307410_10142005 3300031852 Bacteria 1777
335 Ga0307410_10314970 3300031852 Bacteria 1239
336 Ga0307410_10399554 3300031852 Bacteria 1110
337 Ga0307410_10399921 3300031852 Bacteria 1109
338 Ga0307410_10738765 3300031852 Bacteria 832
339 Ga0307410_11104839 3300031852 Bacteria 687
340 Ga0307410_11430569 3300031852 Bacteria 607
341 Ga0307410_11589643 3300031852 Bacteria 577
342 Ga0307406_10065700 3300031901 Bacteria 2358
343 Ga0307406_10210647 3300031901 Bacteria 1437
344 Ga0307406_10220497 3300031901 Bacteria 1409
345 Ga0307406_10415914 3300031901 Bacteria 1070
346 Ga0307406_11345318 3300031901 Bacteria 624
347 Ga0307406_11654037 3300031901 Bacteria 566
348 Ga0307407_10237679 3300031903 Bacteria 1241
349 Ga0307407_10287477 3300031903 Bacteria 1141
350 Ga0307407_10307965 3300031903 Bacteria 1107
351 Ga0307412_10105533 3300031911 Bacteria 2001
352 Ga0307412_10124440 3300031911 Bacteria 1862
353 Ga0307412_10125374 3300031911 Bacteria 1856
354 Ga0307412_10464031 3300031911 Bacteria 1046
355 Ga0307412_10495196 3300031911 Bacteria 1016
356 Ga0307412_11202135 3300031911 Bacteria 679
357 Ga0307412_11300786 3300031911 Bacteria 654
358 Ga0307409_100075150 3300031995 Bacteria 2704
359 Ga0307409_100301593 3300031995 Bacteria 1490
360 Ga0307409_100356947 3300031995 Bacteria 1381
361 Ga0307409_100509333 3300031995 Bacteria 1174
362 Ga0307409_100704969 3300031995 Bacteria 1009
363 Ga0307409_100720830 3300031995 Bacteria 998
364 Ga0307409_100859297 3300031995 Bacteria 918
365 Ga0307409_100875381 3300031995 Bacteria 910
366 Ga0307409_101107719 3300031995 Bacteria 813
367 Ga0307416_100004927 3300032002 Bacteria 8131
368 Ga0307416_100122615 3300032002 Bacteria 2320
369 Ga0307416_100351862 3300032002 Bacteria 1491
370 Ga0307416_100400997 3300032002 Bacteria 1409
371 Ga0307416_100467949 3300032002 Bacteria 1317
372 Ga0307416_101175538 3300032002 Bacteria 872
373 Ga0307416_102136911 3300032002 Bacteria 661
374 Ga0307416_102213275 3300032002 Bacteria 651
375 Ga0307416_102323244 3300032002 Bacteria 636
376 Ga0307416_102347932 3300032002 Bacteria 633
377 Ga0307416_103172125 3300032002 Bacteria 550
378 Ga0307414_10001618 3300032004 Bacteria 11716
379 Ga0307414_10022062 3300032004 Bacteria 4008
380 Ga0307414_10135895 3300032004 Bacteria 1917
381 Ga0307414_10142853 3300032004 Bacteria 1876
382 Ga0307414_10260691 3300032004 Bacteria 1446
383 Ga0307414_10377234 3300032004 Bacteria 1225
384 Ga0307414_10501913 3300032004 Bacteria 1074
385 Ga0307414_10841643 3300032004 Bacteria 838
386 Ga0307414_10899724 3300032004 Bacteria 811
387 Ga0307414_11347589 3300032004 Bacteria 662
388 Ga0307414_11380107 3300032004 Bacteria 654
389 Ga0307414_11722567 3300032004 Bacteria 584
390 Ga0307414_12263102 3300032004 Bacteria 507
391 Ga0307411_10008509 3300032005 Bacteria 5324
392 Ga0307411_10015783 3300032005 Bacteria 4254
393 Ga0307411_10021468 3300032005 Bacteria 3779
394 Ga0307411_10067291 3300032005 Bacteria 2410
395 Ga0307411_10068559 3300032005 Bacteria 2391
396 Ga0307411_10148364 3300032005 Bacteria 1739
397 Ga0307411_10225322 3300032005 Bacteria 1457
398 Ga0307411_10681108 3300032005 Bacteria 893
399 Ga0307411_10969419 3300032005 Bacteria 759
400 Ga0307411_11515623 3300032005 Bacteria 616
401 Ga0307411_11597304 3300032005 Bacteria 601
402 Ga0307411_12118102 3300032005 Bacteria 526
403 Ga0307411_12300936 3300032005 Bacteria 506
404 Ga0307415_100028601 3300032126 Bacteria 3549
405 Ga0307415_100118066 3300032126 Bacteria 1982
406 Ga0307415_100137283 3300032126 Bacteria 1862
407 Ga0307415_100368540 3300032126 Bacteria 1215
408 Ga0307415_100466582 3300032126 Bacteria 1095
409 Ga0307415_100819528 3300032126 Bacteria 851
410 Ga0373930_0014540 3300034816 Bacteria 1467
411 Ga0373949_0034406 3300035090 Bacteria 1221
412 Ga0373952_0071280 3300035092 Bacteria 869
413 Ga0373939_0279426 3300035114 Unclassified 659
414 Ga0373960_0091688 3300035121 Bacteria 972
415 Ga0373962_0031509 3300035242 Bacteria 1455
416 Ga0373931_0081369 3300035691 Bacteria 1788
417 Ga0373925_1709843 3300037068 Bacteria 514
418 Ga0395899_0006469 3300037312 Bacteria 9076
419 Ga0395899_0108638 3300037312 Bacteria 1996
420 Ga0395899_0291334 3300037312 Bacteria 1107
421 Ga0395899_0414608 3300037312 Bacteria 888
422 Ga0395899_0613732 3300037312 Bacteria 691
423 Ga0395900_0017863 3300037418 Bacteria 7240
424 Ga0395900_0067219 3300037418 Bacteria 3682
425 Ga0395900_0209097 3300037418 Bacteria 1971
426 Ga0395900_0991302 3300037418 Bacteria 760
427 Ga0395898_0277570 3300037466 Bacteria 1598
428 Ga0395898_0457536 3300037466 Bacteria 1215
429 Ga0395898_0694421 3300037466 Bacteria 959
430 Ga0395905_0001994 3300037471 Bacteria 23323
431 Ga0395905_0009966 3300037471 Bacteria 9258
432 Ga0395905_0102234 3300037471 Bacteria 2690
433 Ga0395905_0269511 3300037471 Bacteria 1588
434 Ga0395905_0411359 3300037471 Bacteria 1248
435 Ga0395905_0677675 3300037471 Bacteria 933
436 Ga0436364_0822555 3300037853 Bacteria 215682
437 Ga0395901_0004115 3300038443 Bacteria 14655
438 Ga0395901_0034327 3300038443 Bacteria 5238
439 Ga0395901_0204463 3300038443 Bacteria 2069
440 Ga0395901_0313216 3300038443 Bacteria 1625
441 Ga0395901_0429026 3300038443 Bacteria 1354
442 Ga0395901_0551920 3300038443 Bacteria 1167
443 Ga0439453_0021952 3300041408 Bacteria 1154
444 Ga0439461_0197500 3300041410 Bacteria 539
445 Ga0439465_0015015 3300041413 Bacteria 2417
446 Ga0439445_0000045 3300042004 Bacteria 17275
447 Ga0450890_029706 3300042127 Bacteria 773
448 Ga0466967_0211329 3300045976 Bacteria 1840
449 Ga0466967_0397356 3300045976 Bacteria 1341
450 Ga0466967_0445267 3300045976 Bacteria 1265
451 Ga0495584_0214374 3300046491 Bacteria 979
452 Ga0495663_0001653 3300046525 Bacteria 6951
453 Ga0495663_0042268 3300046525 Bacteria 1388
454 Ga0495642_0163111 3300046528 Bacteria 967
455 Ga0495598_0002429 3300046537 Bacteria 3847
456 Ga0495598_0022311 3300046537 Bacteria 1693
457 Ga0495598_0073402 3300046537 Bacteria 1082
458 Ga0495621_0000028 3300046539 Bacteria 27731
459 Ga0495621_0001915 3300046539 Bacteria 5473
460 Ga0495621_0015087 3300046539 Bacteria 2458
461 Ga0495633_0020894 3300046558 Bacteria 3284
462 Ga0495633_0163366 3300046558 Bacteria 1027
463 Ga0495656_0141023 3300046615 Bacteria 1156
464 Ga0495668_0044621 3300046616 Bacteria 2464
465 Ga0495659_0016267 3300046664 Bacteria 2452
466 Ga0495659_0046386 3300046664 Bacteria 1568
467 Ga0495661_0565590 3300046665 Bacteria 537
468 Ga0495669_0384919 3300046684 Bacteria 679
469 Ga0495670_0043497 3300046691 Bacteria 2241
470 Ga0495670_0067138 3300046691 Bacteria 1810
471 Ga0495636_0097537 3300047318 Bacteria 1282
472 Ga0495636_0174680 3300047318 Bacteria 973
473 Ga0495636_0228134 3300047318 Bacteria 856
474 Ga0495677_0032956 3300047445 Bacteria 1887
475 Ga0495677_0050435 3300047445 Bacteria 1531
476 Ga0495677_0363385 3300047445 Bacteria 572
477 Ga0495615_0122791 3300048090 Bacteria 752
478 Ga0495615_0184754 3300048090 Bacteria 637
479 Ga0496102_0015604 3300048905 Bacteria 6617
480 Ga0496103_0266333 3300048906 Bacteria 1102
481 Ga0496107_0112428 3300048910 Bacteria 2002
482 Ga0496107_0535006 3300048910 Unclassified 868
483 Ga0496108_0817339 3300048911 Unclassified 803
484 Ga0496108_0871189 3300048911 Bacteria 774
485 Ga0496109_0124876 3300048912 Bacteria 2399
486 Ga0496109_0695298 3300048912 Bacteria 954
487 Ga0496110_0047865 3300048913 Bacteria 3746
488 Ga0496110_1005093 3300048913 Unclassified 741
489 Ga0496111_0079342 3300048914 Bacteria 2394
490 Ga0496111_0961780 3300048914 Bacteria 613
491 Ga0496114_0003647 3300048917 Bacteria 11842
492 Ga0501306_051018 3300049127 Bacteria 663
493 Ga0501311_037963 3300049527 Bacteria 721
494 Ga0501320_033647 3300049536 Bacteria 648
495 Ga0501048_0312026 3300049582 Bacteria 1120
496 Ga0501217_077900 3300049661 Bacteria 913
497 Ga0501239_032046 3300049672 Bacteria 694
498 Ga0501249_193048 3300049679 Bacteria 531
499 Ga0501252_056085 3300049682 Bacteria 606
500 Ga0501257_047970 3300049686 Bacteria 1061
501 Ga0501234_041490 3300049707 Bacteria 754
502 Ga0501268_064980 3300049765 Bacteria 729
503 nmdc:mga06r32_11261_c1 3300050510 Bacteria 8056
504 nmdc:mga08y16_1511157_c1 3300050511 Bacteria 632
505 Ga0501084_1373244 3300054114 Unclassified 592
506 Ga0590075_060526 3300059424 Bacteria 976
507 Ga0587088_108204 3300059508 Bacteria 629
508 Ga0587091_175729 3300059511 Bacteria 560
509 Ga0587106_136099 3300059605 Bacteria 535
510 2885427451 2885427238 Bacteria 2291351
511 Ga0495670_0094693
512 MBSR1b_contig_6802744
513 JGI24752J21851_1031815
514 JGI24739J22299_10003381
515 JGI24738J21930_10002673
516 JGI24033J26618_1020042
517 JGI24034J26672_10041854
518 JGI24742J22300_10025480
519 Ga0065712_10221706
520 Ga0065715_10002244
521 Ga0065715_10142836
522 Ga0065715_10676846
523 Ga0070658_10001600
524 Ga0070676_10413647
525 Ga0070676_11229661
526 Ga0070683_100002224
527 Ga0070670_100044820
528 Ga0070670_100090243
529 Ga0070670_100130966
530 Ga0070670_101781294
531 Ga0070677_10004568
532 Ga0070677_10204602
533 Ga0070666_10003536
534 Ga0070666_10060271
535 Ga0070666_10765097
536 Ga0070680_100011205
537 Ga0070680_100056703
538 Ga0070680_100207279
539 Ga0068868_100743313
540 Ga0070660_100000194
541 Ga0070660_100001048
542 Ga0070660_100060303
543 Ga0070660_100120823
544 Ga0070660_100252078
545 Ga0070661_100000157
546 Ga0070668_100140132
547 Ga0070668_100323613
548 Ga0070668_102052298
549 Ga0070669_100019487
550 Ga0070669_100020028
551 Ga0070669_100058324
552 Ga0070669_100096034
553 Ga0070669_100228905
554 Ga0070669_100233445
555 Ga0070669_100282736
556 Ga0070675_100053108
557 Ga0070675_100068461
558 Ga0070671_100017860
559 Ga0070671_100018699
560 Ga0070671_100043512
561 Ga0070671_100068727
562 Ga0070671_100700226
563 Ga0070671_101641898
564 Ga0070674_100181692
565 Ga0070673_100079740
566 Ga0070673_100126161
567 Ga0070673_100419878
568 Ga0070659_100000086
569 Ga0070659_100193091
570 Ga0070659_100321252
571 Ga0070659_100389891
572 Ga0070667_100010080
573 Ga0070667_100016155
574 Ga0070667_100277977
575 Ga0070714_100805784
576 Ga0070701_10071199
577 Ga0070705_100285248
578 Ga0070700_100048484
579 Ga0070663_100129047
580 Ga0070663_100174835
581 Ga0070663_101774013
582 Ga0070678_100985573
583 Ga0070662_100000640
584 Ga0070662_100072391
585 Ga0070662_100862023
586 Ga0070662_100978910
587 Ga0070681_10451968
588 Ga0070681_10684987
589 Ga0068867_100152991
590 Ga0068867_100264258
591 Ga0070679_100098364
592 Ga0070679_100210421
593 Ga0070679_100214050
594 Ga0070679_100485558
595 Ga0070684_100165532
596 Ga0068853_100002366
597 Ga0068853_100068438
598 Ga0068853_100212990
599 Ga0068853_100281636
600 Ga0068853_101817927
601 Ga0070672_100008982
602 Ga0070672_100524045
603 Ga0070695_100198257
604 Ga0070693_100010206
605 Ga0070693_100889191
606 Ga0070665_100005304
607 Ga0070665_100693144
608 Ga0070665_100785036
609 Ga0068855_100001534
610 Ga0068855_100016873
611 Ga0068855_100050721
612 Ga0068855_101179185
613 Ga0070664_100001052
614 Ga0070664_100022438
615 Ga0070664_100167132
616 Ga0068857_100282929
617 Ga0068854_100107209
618 Ga0068856_100000159
619 Ga0068856_101071841
620 Ga0068852_100005858
621 Ga0068852_100018129
622 Ga0068852_100291511
623 Ga0068852_100449238
624 Ga0068859_100007322
625 Ga0068859_100153229
626 Ga0068864_100044153
627 Ga0068864_100317712
628 Ga0068864_100996974
629 Ga0068861_100657274
630 Ga0068870_10122827
631 Ga0068863_100518677
632 Ga0068858_100137172
633 Ga0068860_102461139
634 Ga0068860_102729424
635 Ga0068862_100013680
636 Ga0068862_100222963
637 Ga0068862_101259488
638 Ga0068862_101303193
639 Ga0097621_100182212
640 Ga0068871_100279302
641 Ga0075431_100004395
642 Ga0068865_100540770
643 Ga0097620_100007322
644 Ga0097620_100153230
645 Ga0111539_10136063
646 Ga0111539_11791783
647 Ga0105243_10228626
648 Ga0105241_10415798
649 Ga0105242_10165685
650 Ga0105248_10000213
651 Ga0105248_10529579
652 Ga0105237_10617937
653 Ga0105238_10217959
654 Ga0105238_10324217
655 Ga0105249_10144261
656 Ga0105249_12158071
657 Ga0157316_1030167
658 Ga0157373_10026494
659 Ga0157373_10252036
660 Ga0157373_10455558
661 Ga0157373_10512367
662 Ga0157371_10000915
663 Ga0157371_10124542
664 Ga0157371_10750697
665 Ga0157370_10080854
666 Ga0157370_11009839
667 Ga0157369_10007383
668 Ga0163162_10078902
669 Ga0163162_10606373
670 Ga0157372_11409917
671 Ga0157372_13306195
672 Ga0157375_10055611
673 Ga0157375_10576463
674 Ga0157375_10742286
675 Ga0163163_10004075
676 Ga0163163_10809653
677 Ga0157380_10039131
678 Ga0157380_10049117
679 Ga0157380_10157615
680 Ga0157380_10373919
681 Ga0157379_10046364
682 Ga0163161_10013234
683 Ga0163161_10069319
684 Ga0163161_10144490
685 Ga0213875_10000307
686 Ga0207666_1010806
687 Ga0207673_1024561
688 Ga0207697_10105857
689 Ga0207682_10003212
690 Ga0207688_10135115
691 Ga0207688_10520080
692 Ga0207680_10041874
693 Ga0207680_10610261
694 Ga0207647_10019837
695 Ga0207647_10352330
696 Ga0207645_10061651
697 Ga0207705_10000276
698 Ga0207705_10001746
699 Ga0207705_10196024
700 Ga0207707_10626345
701 Ga0207660_10000059
702 Ga0207660_10332927
703 Ga0207657_10000218
704 Ga0207657_10002119
705 Ga0207657_10006606
706 Ga0207657_10124871
707 Ga0207657_10242522
708 Ga0207657_10581158
709 Ga0207657_10984354
710 Ga0207657_11204135
711 Ga0207649_10001645
712 Ga0207649_10554702
713 Ga0207652_10086671
714 Ga0207652_10191563
715 Ga0207652_10371902
716 Ga0207681_10007451
717 Ga0207681_10028727
718 Ga0207681_10119190
719 Ga0207681_10396011
720 Ga0207681_10429714
721 Ga0207681_10477039
722 Ga0207681_10538140
723 Ga0207681_10899917
724 Ga0207681_11669432
725 Ga0207694_10007706
726 Ga0207694_11035379
727 Ga0207650_10022509
728 Ga0207650_10042129
729 Ga0207650_11385896
730 Ga0207650_11802601
731 Ga0207659_10060744
732 Ga0207659_10482763
733 Ga0207664_10315247
734 Ga0207664_10855044
735 Ga0207644_10034365
736 Ga0207644_10049681
737 Ga0207644_10052858
738 Ga0207644_10069236
739 Ga0207644_10535021
740 Ga0207690_10000100
741 Ga0207690_10109282
742 Ga0207690_10217604
743 Ga0207706_10000812
744 Ga0207706_10002713
745 Ga0207706_10063144
746 Ga0207709_10131267
747 Ga0207669_10088388
748 Ga0207704_10816899
749 Ga0207691_10000355
750 Ga0207691_10235620
751 Ga0207711_10001921
752 Ga0207711_10238998
753 Ga0207661_10001153
754 Ga0207679_10000287
755 Ga0207679_10101242
756 Ga0207667_10000122
757 Ga0207667_10021727
758 Ga0207667_10068175
759 Ga0207667_11032831
760 Ga0207651_10045997
761 Ga0207651_10137263
762 Ga0207651_10142582
763 Ga0207651_10324279
764 Ga0207668_10030791
765 Ga0207668_10473302
766 Ga0207668_10659894
767 Ga0207668_10858904
768 Ga0207668_11279492
769 Ga0207640_10034721
770 Ga0207640_11647392
771 Ga0207658_10023721
772 Ga0207658_10044961
773 Ga0207677_10887723
774 Ga0207703_10114880
775 Ga0207639_10017503
776 Ga0207639_10076369
777 Ga0207639_10138880
778 Ga0207678_10027050
779 Ga0207678_10028518
780 Ga0207678_11473940
781 Ga0207678_11811434
782 Ga0207708_10045160
783 Ga0207702_10000208
784 Ga0207702_10237488
785 Ga0207702_10690132
786 Ga0207641_10385040
787 Ga0207648_10169520
788 Ga0207648_10618945
789 Ga0207676_10180089
790 Ga0207676_10495446
791 Ga0207674_10285865
792 Ga0207674_10570345
793 Ga0207675_101355601
794 Ga0207683_10038847
795 Ga0207683_10878513
796 Ga0207698_10001407
797 Ga0207698_10071995
798 Ga0207698_10155695
799 Ga0207698_10839450
800 Ga0209970_1067863
801 Ga0209983_1019085
802 Ga0209998_10154495
803 Ga0209974_10022033
804 Ga0268266_10008685
805 Ga0268266_10425173
806 Ga0268265_10118805
807 Ga0268265_10241998
808 Ga0268265_10708452
809 Ga0268264_10309906
810 Ga0316176_1017963
811 Ga0316178_1064076
812 Ga0316181_1031510
813 Ga0316182_1281089
814 Ga0307408_100242648
815 Ga0307408_100602442
816 Ga0307408_100629910
817 Ga0307408_100720213
818 Ga0307408_101191002
819 Ga0307405_10079112
820 Ga0307405_10154653
821 Ga0307405_10161051
822 Ga0307405_10322053
823 Ga0307405_11037631
824 Ga0307405_11075906
825 Ga0307405_11309430
826 Ga0307405_11375203
827 Ga0307413_10026028
828 Ga0307413_10031309
829 Ga0307413_10052148
830 Ga0307413_10062523
831 Ga0307413_10078149
832 Ga0307413_10124913
833 Ga0307413_10401930
834 Ga0307413_10479897
835 Ga0307413_10523597
836 Ga0307413_10608216
837 Ga0307413_11099685
838 Ga0307413_11335555
839 Ga0307413_11787303
840 Ga0307413_11899242
841 Ga0307410_10012107
842 Ga0307410_10022841
843 Ga0307410_10041466
844 Ga0307410_10142005
845 Ga0307410_10314970
846 Ga0307410_10399554
847 Ga0307410_10399921
848 Ga0307410_10738765
849 Ga0307410_11104839
850 Ga0307410_11430569
851 Ga0307410_11589643
852 Ga0307406_10065700
853 Ga0307406_10210647
854 Ga0307406_10220497
855 Ga0307406_10415914
856 Ga0307406_11345318
857 Ga0307406_11654037
858 Ga0307407_10237679
859 Ga0307407_10287477
860 Ga0307407_10307965
861 Ga0307412_10105533
862 Ga0307412_10124440
863 Ga0307412_10125374
864 Ga0307412_10464031
865 Ga0307412_10495196
866 Ga0307412_11202135
867 Ga0307412_11300786
868 Ga0307409_100075150
869 Ga0307409_100301593
870 Ga0307409_100356947
871 Ga0307409_100509333
872 Ga0307409_100704969
873 Ga0307409_100720830
874 Ga0307409_100859297
875 Ga0307409_100875381
876 Ga0307409_101107719
877 Ga0307416_100004927
878 Ga0307416_100122615
879 Ga0307416_100351862
880 Ga0307416_100400997
881 Ga0307416_100467949
882 Ga0307416_101175538
883 Ga0307416_102136911
884 Ga0307416_102213275
885 Ga0307416_102323244
886 Ga0307416_102347932
887 Ga0307416_103172125
888 Ga0307414_10001618
889 Ga0307414_10022062
890 Ga0307414_10135895
891 Ga0307414_10142853
892 Ga0307414_10260691
893 Ga0307414_10377234
894 Ga0307414_10501913
895 Ga0307414_10841643
896 Ga0307414_10899724
897 Ga0307414_11347589
898 Ga0307414_11380107
899 Ga0307414_11722567
900 Ga0307414_12263102
901 Ga0307411_10008509
902 Ga0307411_10015783
903 Ga0307411_10021468
904 Ga0307411_10067291
905 Ga0307411_10068559
906 Ga0307411_10148364
907 Ga0307411_10225322
908 Ga0307411_10681108
909 Ga0307411_10969419
910 Ga0307411_11515623
911 Ga0307411_11597304
912 Ga0307411_12118102
913 Ga0307411_12300936
914 Ga0307415_100028601
915 Ga0307415_100118066
916 Ga0307415_100137283
917 Ga0307415_100368540
918 Ga0307415_100466582
919 Ga0307415_100819528
920 Ga0373930_0014540
921 Ga0373949_0034406
922 Ga0373952_0071280
923 Ga0373939_0279426
924 Ga0373960_0091688
925 Ga0373962_0031509
926 Ga0373931_0081369
927 Ga0373925_1709843
928 Ga0395899_0006469
929 Ga0395899_0108638
930 Ga0395899_0291334
931 Ga0395899_0414608
932 Ga0395899_0613732
933 Ga0395900_0017863
934 Ga0395900_0067219
935 Ga0395900_0209097
936 Ga0395900_0991302
937 Ga0395898_0277570
938 Ga0395898_0457536
939 Ga0395898_0694421
940 Ga0395905_0001994
941 Ga0395905_0009966
942 Ga0395905_0102234
943 Ga0395905_0269511
944 Ga0395905_0411359
945 Ga0395905_0677675
946 Ga0436364_0822555
947 Ga0395901_0004115
948 Ga0395901_0034327
949 Ga0395901_0204463
950 Ga0395901_0313216
951 Ga0395901_0429026
952 Ga0395901_0551920
953 Ga0439453_0021952
954 Ga0439461_0197500
955 Ga0439465_0015015
956 Ga0439445_0000045
957 Ga0450890_029706
958 Ga0466967_0211329
959 Ga0466967_0397356
960 Ga0466967_0445267
961 Ga0495584_0214374
962 Ga0495663_0001653
963 Ga0495663_0042268
964 Ga0495642_0163111
965 Ga0495598_0002429
966 Ga0495598_0022311
967 Ga0495598_0073402
968 Ga0495621_0000028
969 Ga0495621_0001915
970 Ga0495621_0015087
971 Ga0495633_0020894
972 Ga0495633_0163366
973 Ga0495656_0141023
974 Ga0495668_0044621
975 Ga0495659_0016267
976 Ga0495659_0046386
977 Ga0495661_0565590
978 Ga0495669_0384919
979 Ga0495670_0043497
980 Ga0495670_0067138
981 Ga0495636_0097537
982 Ga0495636_0174680
983 Ga0495636_0228134
984 Ga0495677_0032956
985 Ga0495677_0050435
986 Ga0495677_0363385
987 Ga0495615_0122791
988 Ga0495615_0184754
989 Ga0496102_0015604
990 Ga0496103_0266333
991 Ga0496107_0112428
992 Ga0496107_0535006
993 Ga0496108_0817339
994 Ga0496108_0871189
995 Ga0496109_0124876
996 Ga0496109_0695298
997 Ga0496110_0047865
998 Ga0496110_1005093
999 Ga0496111_0079342
1000 Ga0496111_0961780
1001 Ga0496114_0003647
1002 Ga0501306_051018
1003 Ga0501311_037963
1004 Ga0501320_033647
1005 Ga0501048_0312026
1006 Ga0501217_077900
1007 Ga0501239_032046
1008 Ga0501249_193048
1009 Ga0501252_056085
1010 Ga0501257_047970
1011 Ga0501234_041490
1012 Ga0501268_064980
1013 nmdc:mga06r32_11261_c1
1014 nmdc:mga08y16_1511157_c1
1015 Ga0501084_1373244
1016 Ga0590075_060526
1017 Ga0587088_108204
1018 Ga0587091_175729
1019 Ga0587106_136099
1020 2885427451

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11233

DUF3035

Protein of unknown function (DUF3035)

33

146

0.87

Map