F457100

General Info

Members Datasets Scaffolds Average Seq Length
510 263 1020 49

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100068121|Ga0070708_1000681212
Length 55
Sequence LQRDIEMIRKLPSGQYRLYSRKKDPKTGRRRNLGTFKTRKAAEAHERAVQYFKAR

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
197 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
198 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
199 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
209 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
210 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
211 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
212 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
218 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
221 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
242 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
245 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
246 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
259 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
260 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
261 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
262 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.29
Nodule 0
Rhizoplane 2.35
Rhizosphere 91.57
Stem 0
Stem Tuber 0
Unclassified 22.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100068121 3300005445 Bacteria 3198
2 rootL2_10059624 3300003322 Bacteria 1487
3 rootL2_10154864 3300003322 Bacteria 3260
4 Ga0065707_10805415 3300005295 Unclassified 597
5 Ga0070683_100027319 3300005329 Bacteria 5146
6 Ga0070683_100079294 3300005329 Bacteria 3073
7 Ga0070683_100137788 3300005329 Bacteria 2312
8 Ga0070690_100344726 3300005330 Unclassified 1080
9 Ga0070690_100558715 3300005330 Bacteria 864
10 Ga0068869_100010382 3300005334 Bacteria 6073
11 Ga0068869_100013285 3300005334 Bacteria 5473
12 Ga0070680_100008642 3300005336 Bacteria 7807
13 Ga0070680_100219830 3300005336 Bacteria 1603
14 Ga0070682_100000002 3300005337 Bacteria 506802
15 Ga0068868_100003860 3300005338 Bacteria 10461
16 Ga0068868_100018784 3300005338 Bacteria 5171
17 Ga0068868_101058466 3300005338 Bacteria 745
18 Ga0068868_101323194 3300005338 Bacteria 670
19 Ga0070660_100095665 3300005339 Bacteria 2348
20 Ga0070689_100689412 3300005340 Bacteria 891
21 Ga0070691_10000813 3300005341 Bacteria 12494
22 Ga0070687_100031223 3300005343 Bacteria 2612
23 Ga0070661_100046444 3300005344 Bacteria 3177
24 Ga0070692_10088940 3300005345 Unclassified 1676
25 Ga0070668_100169258 3300005347 Bacteria 1778
26 Ga0070668_101975480 3300005347 Bacteria 538
27 Ga0070669_100107902 3300005353 Bacteria 2109
28 Ga0070675_101554472 3300005354 Bacteria 610
29 Ga0070671_100547257 3300005355 Unclassified 998
30 Ga0070671_100607719 3300005355 Unclassified 945
31 Ga0070673_100646052 3300005364 Unclassified 968
32 Ga0070688_100715713 3300005365 Unclassified 776
33 Ga0070667_100064371 3300005367 Bacteria 3111
34 Ga0070667_100135343 3300005367 Bacteria 2154
35 Ga0070667_101008821 3300005367 Unclassified 777
36 Ga0070703_10151110 3300005406 Bacteria 872
37 Ga0070709_10276478 3300005434 Bacteria 1219
38 Ga0070709_10500766 3300005434 Unclassified 923
39 Ga0070713_100146124 3300005436 Bacteria 2099
40 Ga0070713_101217476 3300005436 Unclassified 729
41 Ga0070701_10285955 3300005438 Unclassified 1009
42 Ga0070701_10458171 3300005438 Bacteria 820
43 Ga0070711_100019656 3300005439 Bacteria 4336
44 Ga0070705_100118163 3300005440 Bacteria 1707
45 Ga0070705_100839839 3300005440 Bacteria 734
46 Ga0070700_100337628 3300005441 Unclassified 1112
47 Ga0070700_100932490 3300005441 Unclassified 709
48 Ga0070700_101125911 3300005441 Bacteria 652
49 Ga0070694_100576660 3300005444 Unclassified 903
50 Ga0070708_100018240 3300005445 Bacteria 5872
51 Ga0070708_100047228 3300005445 Bacteria 3802
52 Ga0070708_101068652 3300005445 Bacteria 756
53 Ga0070708_101925801 3300005445 Bacteria 548
54 Ga0070663_100010934 3300005455 Bacteria 5673
55 Ga0070663_100268923 3300005455 Bacteria 1354
56 Ga0070663_101456238 3300005455 Bacteria 608
57 Ga0070678_100232277 3300005456 Unclassified 1538
58 Ga0070662_101176883 3300005457 Unclassified 659
59 Ga0070681_10000363 3300005458 Bacteria 36626
60 Ga0070681_10019123 3300005458 Bacteria 6855
61 Ga0070681_10062578 3300005458 Bacteria 3695
62 Ga0070681_10327274 3300005458 Unclassified 1442
63 Ga0068867_100100945 3300005459 Bacteria 2204
64 Ga0068867_100239041 3300005459 Unclassified 1472
65 Ga0070706_100172831 3300005467 Bacteria 2017
66 Ga0070706_101006347 3300005467 Bacteria 768
67 Ga0070707_100000815 3300005468 Bacteria 30849
68 Ga0070707_100029652 3300005468 Bacteria 5208
69 Ga0070707_100158003 3300005468 Bacteria 2208
70 Ga0070707_100198918 3300005468 Bacteria 1953
71 Ga0070707_100840503 3300005468 Bacteria 882
72 Ga0070707_101506417 3300005468 Bacteria 639
73 Ga0070698_100338360 3300005471 Bacteria 1436
74 Ga0070698_100930164 3300005471 Bacteria 815
75 Ga0070698_101924116 3300005471 Bacteria 544
76 Ga0070699_100064969 3300005518 Bacteria 3165
77 Ga0070679_100196534 3300005530 Bacteria 1984
78 Ga0070679_101228345 3300005530 Bacteria 695
79 Ga0070684_100011096 3300005535 Bacteria 7168
80 Ga0070697_100136426 3300005536 Bacteria 2061
81 Ga0070697_100137953 3300005536 Bacteria 2049
82 Ga0070697_100520723 3300005536 Bacteria 1041
83 Ga0070697_100762896 3300005536 Bacteria 855
84 Ga0068853_100057644 3300005539 Bacteria 3353
85 Ga0068853_100402140 3300005539 Unclassified 1282
86 Ga0070672_100465926 3300005543 Bacteria 1090
87 Ga0070672_101804886 3300005543 Unclassified 550
88 Ga0070695_101109560 3300005545 Unclassified 648
89 Ga0070696_100025494 3300005546 Bacteria 4021
90 Ga0070696_100147355 3300005546 Bacteria 1725
91 Ga0070696_101065120 3300005546 Unclassified 678
92 Ga0070693_100212661 3300005547 Unclassified 1262
93 Ga0070693_100376570 3300005547 Unclassified 978
94 Ga0070693_101501820 3300005547 Unclassified 527
95 Ga0070665_100757614 3300005548 Unclassified 984
96 Ga0070665_101127899 3300005548 Bacteria 796
97 Ga0070704_100239465 3300005549 Bacteria 1484
98 Ga0070704_100431040 3300005549 Bacteria 1131
99 Ga0070704_101339653 3300005549 Unclassified 656
100 Ga0068855_100049260 3300005563 Bacteria 4969
101 Ga0070664_102060626 3300005564 Unclassified 541
102 Ga0068857_100010389 3300005577 Bacteria 8089
103 Ga0068857_101280307 3300005577 Bacteria 711
104 Ga0068854_100004200 3300005578 Bacteria 9070
105 Ga0068854_100130333 3300005578 Unclassified 1919
106 Ga0068854_100290035 3300005578 Bacteria 1320
107 Ga0068854_100579377 3300005578 Unclassified 955
108 Ga0068856_100003427 3300005614 Bacteria 16031
109 Ga0068856_100148314 3300005614 Bacteria 2353
110 Ga0068852_100002293 3300005616 Bacteria 13156
111 Ga0068852_100363890 3300005616 Unclassified 1415
112 Ga0068852_102372988 3300005616 Unclassified 551
113 Ga0068859_100049767 3300005617 Bacteria 4209
114 Ga0068859_100205772 3300005617 Unclassified 2053
115 Ga0068859_101895106 3300005617 Bacteria 658
116 Ga0068859_102253604 3300005617 Bacteria 601
117 Ga0068864_101698399 3300005618 Unclassified 636
118 Ga0068866_10770317 3300005718 Unclassified 666
119 Ga0068866_10899657 3300005718 Unclassified 622
120 Ga0068861_100044699 3300005719 Bacteria 3331
121 Ga0068861_100129572 3300005719 Unclassified 2046
122 Ga0068861_101541453 3300005719 Unclassified 653
123 Ga0068861_102196308 3300005719 Unclassified 553
124 Ga0068861_102317695 3300005719 Bacteria 539
125 Ga0068851_10400755 3300005834 Unclassified 807
126 Ga0068863_100179189 3300005841 Bacteria 2034
127 Ga0068863_100789936 3300005841 Bacteria 946
128 Ga0068858_100010001 3300005842 Bacteria 9010
129 Ga0068858_100037226 3300005842 Bacteria 4511
130 Ga0068858_100073575 3300005842 Bacteria 3172
131 Ga0068858_100223177 3300005842 Bacteria 1785
132 Ga0068858_102387242 3300005842 Bacteria 522
133 Ga0068860_100170773 3300005843 Bacteria 2100
134 Ga0068860_100246916 3300005843 Bacteria 1737
135 Ga0068860_100469269 3300005843 Bacteria 1253
136 Ga0068860_100540941 3300005843 Bacteria 1166
137 Ga0068860_100691695 3300005843 Bacteria 1029
138 Ga0068860_101041906 3300005843 Bacteria 837
139 Ga0068860_101983828 3300005843 Unclassified 603
140 Ga0068860_102136522 3300005843 Bacteria 581
141 Ga0068862_100287614 3300005844 Bacteria 1509
142 Ga0081455_10096915 3300005937 Bacteria 2377
143 Ga0081540_1086004 3300005983 Bacteria 1398
144 Ga0075365_10343849 3300006038 Bacteria 1051
145 Ga0075368_10125866 3300006042 Bacteria 1063
146 Ga0075363_100021566 3300006048 Bacteria 3247
147 Ga0075363_101013178 3300006048 Unclassified 512
148 Ga0075364_10057891 3300006051 Bacteria 2539
149 Ga0070715_10912730 3300006163 Unclassified 541
150 Ga0070712_100000400 3300006175 Bacteria 24660
151 Ga0075362_10049963 3300006177 Bacteria 1869
152 Ga0075367_10034436 3300006178 Bacteria 2926
153 Ga0075366_10000735 3300006195 Bacteria 15600
154 Ga0097621_100013628 3300006237 Bacteria 6066
155 Ga0097621_100026875 3300006237 Bacteria 4520
156 Ga0097621_101488026 3300006237 Unclassified 642
157 Ga0097621_102330077 3300006237 Bacteria 512
158 Ga0075370_10098246 3300006353 Bacteria 1693
159 Ga0075370_10685000 3300006353 Bacteria 623
160 Ga0068871_100001091 3300006358 Bacteria 18218
161 Ga0068871_100021642 3300006358 Bacteria 4946
162 Ga0068871_100206686 3300006358 Bacteria 1697
163 Ga0068871_101319555 3300006358 Bacteria 679
164 Ga0075428_100699327 3300006844 Bacteria 1080
165 Ga0075428_102520721 3300006844 Bacteria 526
166 Ga0075430_101647132 3300006846 Bacteria 527
167 Ga0075431_100037629 3300006847 Bacteria 4982
168 Ga0075431_101287676 3300006847 Unclassified 692
169 Ga0075433_10248939 3300006852 Unclassified 1577
170 Ga0075433_10328693 3300006852 Bacteria 1352
171 Ga0075433_11796418 3300006852 Bacteria 527
172 Ga0075434_100228319 3300006871 Unclassified 1881
173 Ga0075434_100238759 3300006871 Bacteria 1837
174 Ga0075434_100838541 3300006871 Bacteria 935
175 Ga0075434_102253221 3300006871 Unclassified 548
176 Ga0075429_100072252 3300006880 Bacteria 3004
177 Ga0075429_100834484 3300006880 Bacteria 807
178 Ga0068865_100202311 3300006881 Bacteria 1542
179 Ga0068865_100940364 3300006881 Bacteria 754
180 Ga0075436_100011193 3300006914 Bacteria 6149
181 Ga0075436_100561306 3300006914 Bacteria 839
182 Ga0075436_100672931 3300006914 Unclassified 765
183 Ga0075436_101410183 3300006914 Unclassified 528
184 Ga0097620_100049765 3300006931 Bacteria 4209
185 Ga0097620_100205762 3300006931 Unclassified 2053
186 Ga0097620_101894896 3300006931 Bacteria 658
187 Ga0097620_102253599 3300006931 Bacteria 601
188 Ga0075435_100024922 3300007076 Bacteria 4650
189 Ga0075435_100095513 3300007076 Bacteria 2458
190 Ga0075435_100356708 3300007076 Bacteria 1254
191 Ga0075435_100440564 3300007076 Bacteria 1123
192 Ga0075435_100968224 3300007076 Bacteria 743
193 Ga0099794_10006878 3300007265 Bacteria 4635
194 Ga0105250_10083296 3300009092 Bacteria 1298
195 Ga0105240_10017078 3300009093 Bacteria 9799
196 Ga0105240_11024974 3300009093 Bacteria 881
197 Ga0111539_10162610 3300009094 Bacteria 2610
198 Ga0111539_10176954 3300009094 Bacteria 2492
199 Ga0111539_13320189 3300009094 Bacteria 518
200 Ga0105245_10002299 3300009098 Bacteria 17292
201 Ga0105245_10081368 3300009098 Bacteria 2961
202 Ga0105247_10145913 3300009101 Bacteria 1555
203 Ga0114129_10039372 3300009147 Bacteria 6664
204 Ga0114129_10120966 3300009147 Bacteria 3604
205 Ga0114129_10186882 3300009147 Bacteria 2815
206 Ga0114129_10781852 3300009147 Bacteria 1219
207 Ga0114129_11432796 3300009147 Bacteria 851
208 Ga0114129_11980509 3300009147 Bacteria 705
209 Ga0114129_12698974 3300009147 Unclassified 592
210 Ga0105243_10622445 3300009148 Bacteria 1042
211 Ga0105243_10937014 3300009148 Bacteria 864
212 Ga0105243_11592781 3300009148 Bacteria 679
213 Ga0105241_10000024 3300009174 Bacteria 140808
214 Ga0105241_10022447 3300009174 Bacteria 4675
215 Ga0105241_10032489 3300009174 Bacteria 3913
216 Ga0105241_10043346 3300009174 Bacteria 3408
217 Ga0105241_10095143 3300009174 Bacteria 2357
218 Ga0105241_10117562 3300009174 Unclassified 2137
219 Ga0105241_10132679 3300009174 Bacteria 2018
220 Ga0105242_10175907 3300009176 Bacteria 1884
221 Ga0105248_10026955 3300009177 Bacteria 6390
222 Ga0105248_10105751 3300009177 Bacteria 3173
223 Ga0105248_10168670 3300009177 Unclassified 2467
224 Ga0105248_10342354 3300009177 Bacteria 1683
225 Ga0105237_10025509 3300009545 Bacteria 6045
226 Ga0105237_10057026 3300009545 Bacteria 3909
227 Ga0105237_11323314 3300009545 Unclassified 727
228 Ga0105237_11774825 3300009545 Bacteria 624
229 Ga0105237_12674222 3300009545 Bacteria 510
230 Ga0105238_10019543 3300009551 Bacteria 6900
231 Ga0105238_10496551 3300009551 Unclassified 1221
232 Ga0105249_10251962 3300009553 Bacteria 1751
233 Ga0105249_11074057 3300009553 Bacteria 875
234 Ga0105249_11445848 3300009553 Bacteria 759
235 Ga0105239_10037662 3300010375 Bacteria 5300
236 Ga0105239_10117891 3300010375 Bacteria 2946
237 Ga0105239_11629525 3300010375 Bacteria 746
238 Ga0105246_10020442 3300011119 Bacteria 4246
239 Ga0105246_10518041 3300011119 Unclassified 1016
240 Ga0105246_11665903 3300011119 Unclassified 605
241 Ga0157373_10021584 3300013100 Bacteria 4676
242 Ga0157373_10538640 3300013100 Bacteria 846
243 Ga0157371_10025962 3300013102 Unclassified 4263
244 Ga0157371_10242800 3300013102 Bacteria 1296
245 Ga0157370_10959179 3300013104 Unclassified 775
246 Ga0157369_10020912 3300013105 Bacteria 7316
247 Ga0157369_10051996 3300013105 Bacteria 4433
248 Ga0157369_10069390 3300013105 Bacteria 3787
249 Ga0157369_11417099 3300013105 Bacteria 707
250 Ga0157374_10250227 3300013296 Bacteria 1744
251 Ga0157378_10001198 3300013297 Bacteria 23525
252 Ga0157378_10122214 3300013297 Bacteria 2401
253 Ga0157378_11239798 3300013297 Unclassified 786
254 Ga0157378_11896316 3300013297 Bacteria 645
255 Ga0157378_12131451 3300013297 Bacteria 611
256 Ga0163162_10542914 3300013306 Bacteria 1291
257 Ga0163162_10884261 3300013306 Bacteria 1007
258 Ga0163162_11057070 3300013306 Bacteria 919
259 Ga0163162_11743917 3300013306 Unclassified 711
260 Ga0163162_12693350 3300013306 Bacteria 572
261 Ga0163162_13406313 3300013306 Unclassified 507
262 Ga0157372_10011135 3300013307 Bacteria 9567
263 Ga0157372_10070609 3300013307 Unclassified 3930
264 Ga0157372_10396613 3300013307 Bacteria 1608
265 Ga0157372_10977327 3300013307 Bacteria 981
266 Ga0157375_10152697 3300013308 Bacteria 2446
267 Ga0157375_10638288 3300013308 Bacteria 1222
268 Ga0157375_11084471 3300013308 Bacteria 937
269 Ga0163163_10004219 3300014325 Bacteria 12250
270 Ga0157380_10533925 3300014326 Bacteria 1147
271 Ga0157380_11028498 3300014326 Bacteria 859
272 Ga0157379_10122018 3300014968 Bacteria 2345
273 Ga0157379_10336325 3300014968 Bacteria 1380
274 Ga0157379_10404656 3300014968 Bacteria 1255
275 Ga0157379_11325959 3300014968 Unclassified 696
276 Ga0157376_10234902 3300014969 Unclassified 1705
277 Ga0157376_10456369 3300014969 Bacteria 1248
278 Ga0157376_11261594 3300014969 Unclassified 768
279 Ga0157376_12424237 3300014969 Bacteria 564
280 Ga0163161_10556430 3300017792 Bacteria 941
281 Ga0206352_10369532 3300020078 Bacteria 1019
282 Ga0206354_11647850 3300020081 Bacteria 875
283 Ga0206353_11984923 3300020082 Bacteria 974
284 Ga0207697_10004384 3300025315 Bacteria 6750
285 Ga0207682_10022202 3300025893 Unclassified 2499
286 Ga0207692_10958673 3300025898 Bacteria 564
287 Ga0207710_10016882 3300025900 Bacteria 3092
288 Ga0207688_10041023 3300025901 Bacteria 2573
289 Ga0207680_10076756 3300025903 Bacteria 2087
290 Ga0207647_10007176 3300025904 Bacteria 8076
291 Ga0207699_10290704 3300025906 Bacteria 1138
292 Ga0207643_10468787 3300025908 Bacteria 803
293 Ga0207705_10176780 3300025909 Bacteria 1609
294 Ga0207684_10150621 3300025910 Unclassified 2001
295 Ga0207684_10436956 3300025910 Bacteria 1124
296 Ga0207684_10817875 3300025910 Bacteria 787
297 Ga0207654_10000044 3300025911 Bacteria 99046
298 Ga0207654_10173966 3300025911 Unclassified 1400
299 Ga0207654_10229951 3300025911 Bacteria 1234
300 Ga0207654_11226828 3300025911 Bacteria 547
301 Ga0207707_10104815 3300025912 Bacteria 2471
302 Ga0207707_10308558 3300025912 Unclassified 1367
303 Ga0207707_10805987 3300025912 Bacteria 782
304 Ga0207695_10019473 3300025913 Bacteria 7816
305 Ga0207693_10000620 3300025915 Bacteria 31753
306 Ga0207663_10006253 3300025916 Bacteria 6075
307 Ga0207660_10075760 3300025917 Bacteria 2459
308 Ga0207660_10116618 3300025917 Bacteria 2017
309 Ga0207662_10032137 3300025918 Bacteria 3053
310 Ga0207662_10076240 3300025918 Bacteria 2038
311 Ga0207662_10927149 3300025918 Unclassified 617
312 Ga0207657_10068971 3300025919 Bacteria 3002
313 Ga0207652_10184373 3300025921 Bacteria 1876
314 Ga0207652_10930039 3300025921 Bacteria 767
315 Ga0207646_10008098 3300025922 Bacteria 10592
316 Ga0207646_10223231 3300025922 Bacteria 1702
317 Ga0207646_11056277 3300025922 Bacteria 716
318 Ga0207681_10555127 3300025923 Bacteria 945
319 Ga0207681_10676562 3300025923 Unclassified 857
320 Ga0207694_10049340 3300025924 Unclassified 3258
321 Ga0207650_11873696 3300025925 Bacteria 507
322 Ga0207659_10105639 3300025926 Bacteria 2131
323 Ga0207659_11057278 3300025926 Bacteria 698
324 Ga0207687_10058654 3300025927 Bacteria 2709
325 Ga0207687_10113054 3300025927 Unclassified 2019
326 Ga0207687_10266785 3300025927 Bacteria 1367
327 Ga0207687_10708310 3300025927 Bacteria 855
328 Ga0207644_10003698 3300025931 Bacteria 9917
329 Ga0207644_10261156 3300025931 Unclassified 1385
330 Ga0207644_10326451 3300025931 Unclassified 1242
331 Ga0207706_10436594 3300025933 Unclassified 1134
332 Ga0207686_10409688 3300025934 Bacteria 1034
333 Ga0207709_10451484 3300025935 Bacteria 994
334 Ga0207709_11177388 3300025935 Unclassified 631
335 Ga0207670_10047564 3300025936 Bacteria 2858
336 Ga0207670_11273451 3300025936 Unclassified 623
337 Ga0207669_10108445 3300025937 Bacteria 1854
338 Ga0207704_10045459 3300025938 Bacteria 2609
339 Ga0207704_10058099 3300025938 Bacteria 2380
340 Ga0207704_10745096 3300025938 Bacteria 814
341 Ga0207704_11757403 3300025938 Bacteria 533
342 Ga0207665_10755359 3300025939 Bacteria 767
343 Ga0207691_10009421 3300025940 Bacteria 9381
344 Ga0207691_10573351 3300025940 Unclassified 956
345 Ga0207711_10011408 3300025941 Bacteria 7386
346 Ga0207711_10189068 3300025941 Unclassified 1876
347 Ga0207689_10003392 3300025942 Bacteria 14556
348 Ga0207689_10549512 3300025942 Unclassified 970
349 Ga0207661_11985925 3300025944 Bacteria 528
350 Ga0207667_10046118 3300025949 Bacteria 4615
351 Ga0207667_11329613 3300025949 Bacteria 694
352 Ga0207712_10077669 3300025961 Bacteria 2407
353 Ga0207712_10368764 3300025961 Bacteria 1198
354 Ga0207668_10005597 3300025972 Bacteria 7405
355 Ga0207668_10125949 3300025972 Bacteria 1948
356 Ga0207668_11367856 3300025972 Bacteria 638
357 Ga0207668_11428281 3300025972 Bacteria 624
358 Ga0207668_12068097 3300025972 Bacteria 513
359 Ga0207640_10066342 3300025981 Bacteria 2411
360 Ga0207640_10219064 3300025981 Bacteria 1456
361 Ga0207640_10361502 3300025981 Bacteria 1170
362 Ga0207658_10202876 3300025986 Unclassified 1657
363 Ga0207658_10405645 3300025986 Bacteria 1199
364 Ga0207658_10527954 3300025986 Unclassified 1054
365 Ga0207658_11539850 3300025986 Bacteria 608
366 Ga0207677_10010977 3300026023 Bacteria 5145
367 Ga0207677_10102260 3300026023 Bacteria 2112
368 Ga0207677_10537978 3300026023 Bacteria 1016
369 Ga0207677_10794914 3300026023 Bacteria 846
370 Ga0207703_10077435 3300026035 Bacteria 2760
371 Ga0207703_10222449 3300026035 Bacteria 1688
372 Ga0207703_11506388 3300026035 Bacteria 647
373 Ga0207639_10401182 3300026041 Bacteria 1235
374 Ga0207639_11077055 3300026041 Bacteria 753
375 Ga0207678_10018778 3300026067 Bacteria 6073
376 Ga0207708_10071191 3300026075 Bacteria 2663
377 Ga0207708_11355355 3300026075 Bacteria 624
378 Ga0207702_10180181 3300026078 Bacteria 1945
379 Ga0207641_10159790 3300026088 Bacteria 2048
380 Ga0207648_10065747 3300026089 Bacteria 3162
381 Ga0207648_10281917 3300026089 Bacteria 1486
382 Ga0207674_10237590 3300026116 Bacteria 1769
383 Ga0207674_11556443 3300026116 Bacteria 630
384 Ga0207675_100011146 3300026118 Bacteria 8420
385 Ga0207675_100090216 3300026118 Bacteria 2882
386 Ga0207675_100377441 3300026118 Bacteria 1393
387 Ga0207675_101930925 3300026118 Unclassified 608
388 Ga0207675_102107643 3300026118 Unclassified 580
389 Ga0207683_10737423 3300026121 Unclassified 914
390 Ga0207698_10164802 3300026142 Bacteria 1943
391 Ga0207698_10455738 3300026142 Unclassified 1236
392 Ga0207698_10489382 3300026142 Unclassified 1195
393 Ga0209813_10294354 3300027866 Bacteria 629
394 Ga0207428_10004180 3300027907 Bacteria 13836
395 Ga0207428_10470195 3300027907 Unclassified 915
396 Ga0265356_1009174 3300028017 Bacteria 1117
397 Ga0268266_10747518 3300028379 Bacteria 944
398 Ga0268265_10021575 3300028380 Bacteria 4514
399 Ga0268265_11143004 3300028380 Bacteria 774
400 Ga0268264_10043327 3300028381 Bacteria 3729
401 Ga0268264_10083796 3300028381 Bacteria 2732
402 Ga0268264_10286074 3300028381 Bacteria 1546
403 Ga0268264_10482498 3300028381 Bacteria 1206
404 Ga0268264_10638959 3300028381 Bacteria 1052
405 Ga0265328_10055707 3300031239 Bacteria 1451
406 Ga0265325_10011569 3300031241 Bacteria 5069
407 Ga0265339_10123711 3300031249 Bacteria 1327
408 Ga0265331_10003869 3300031250 Bacteria 9470
409 Ga0265316_10004119 3300031344 Bacteria 14553
410 Ga0307408_101605231 3300031548 Bacteria 618
411 Ga0265313_10012201 3300031595 Bacteria 5272
412 Ga0265314_10095836 3300031711 Unclassified 1920
413 Ga0265342_10066953 3300031712 Bacteria 2103
414 Ga0307413_10112864 3300031824 Bacteria 1823
415 Ga0307406_10494072 3300031901 Bacteria 991
416 Ga0307412_11846595 3300031911 Unclassified 557
417 Ga0307416_102089233 3300032002 Unclassified 668
418 Ga0316214_1040924 3300033545 Unclassified 665
419 Ga0373950_0000097 3300034818 Bacteria 22935
420 Ga0373949_0001525 3300035090 Bacteria 6560
421 Ga0373923_0288937 3300035111 Bacteria 774
422 Ga0373941_0345484 3300035115 Bacteria 604
423 Ga0373943_0762744 3300035170 Bacteria 575
424 Ga0373955_0129575 3300035172 Bacteria 1472
425 Ga0373961_0309748 3300035241 Unclassified 586
426 Ga0373931_0625319 3300035691 Bacteria 706
427 Ga0373927_0289874 3300035695 Bacteria 1077
428 Ga0373927_0375373 3300035695 Bacteria 938
429 Ga0373937_0019332 3300036401 Bacteria 6095
430 Ga0373937_0689387 3300036401 Bacteria 968
431 Ga0373937_1972178 3300036401 Unclassified 530
432 Ga0436365_1210525 3300039437 Bacteria 11071
433 Ga0436360_1090731 3300039438 Unclassified 1671
434 Ga0439437_042832 3300042000 Bacteria 590
435 Ga0439441_079124 3300042001 Bacteria 714
436 Ga0439464_0227671 3300042439 Bacteria 599
437 Ga0453683_0473708 3300044673 Unclassified 811
438 Ga0451576_0095957 3300045051 Bacteria 3084
439 Ga0451576_2100909 3300045051 Unclassified 581
440 Ga0495629_0056956 3300046459 Bacteria 2733
441 Ga0495584_0389923 3300046491 Bacteria 708
442 Ga0495607_0062528 3300046501 Bacteria 2109
443 Ga0495610_0035881 3300046512 Bacteria 2540
444 Ga0495616_0050750 3300046513 Bacteria 2073
445 Ga0495628_0610881 3300046516 Bacteria 778
446 Ga0495663_0072145 3300046525 Bacteria 1101
447 Ga0495642_0512999 3300046528 Unclassified 531
448 Ga0495587_0162991 3300046536 Bacteria 1268
449 Ga0495633_0557340 3300046558 Bacteria 516
450 Ga0495667_0344402 3300046559 Bacteria 942
451 Ga0495656_0050158 3300046615 Bacteria 1781
452 Ga0495658_0154423 3300046683 Bacteria 1412
453 Ga0495602_0040155 3300048088 Bacteria 4297
454 Ga0496100_0220108 3300048903 Bacteria 1393
455 Ga0496100_0403698 3300048903 Bacteria 1041
456 Ga0496101_0936601 3300048904 Unclassified 682
457 Ga0496102_0509433 3300048905 Unclassified 1126
458 Ga0496105_0987369 3300048908 Unclassified 630
459 Ga0496106_1503245 3300048909 Unclassified 518
460 Ga0496108_0995269 3300048911 Bacteria 716
461 Ga0496109_0178028 3300048912 Bacteria 1997
462 Ga0496110_0583504 3300048913 Bacteria 1015
463 Ga0496110_1109372 3300048913 Bacteria 699
464 Ga0496111_0097594 3300048914 Unclassified 2157
465 Ga0496112_0001244 3300048915 Bacteria 19257
466 Ga0501296_081406 3300049519 Bacteria 514
467 Ga0501035_0417563 3300049822 Bacteria 1114
468 Ga0501044_0065856 3300049823 Bacteria 3695
469 nmdc:mga03683_61923_c1 3300050489 Bacteria 1584
470 nmdc:mga03n38_49266_c1 3300050490 Bacteria 1872
471 nmdc:mga03n38_820756_c1 3300050490 Unclassified 542
472 nmdc:mga00v17_1025717_c1 3300050491 Unclassified 519
473 nmdc:mga00v17_34688_c1 3300050491 Bacteria 2999
474 nmdc:mga0k408_187823_c1 3300050493 Bacteria 1233
475 nmdc:mga06z11_131382_c1 3300050494 Bacteria 1406
476 nmdc:mga06z11_13837_c1 3300050494 Bacteria 3557
477 nmdc:mga04h51_37914_c1 3300050495 Bacteria 1558
478 nmdc:mga07m45_570646_c1 3300050496 Bacteria 654
479 nmdc:mga07m45_61017_c1 3300050496 Bacteria 2135
480 nmdc:mga05p37_1398981_c1 3300050507 Bacteria 705
481 nmdc:mga05p37_164026_c1 3300050507 Bacteria 2712
482 nmdc:mga05p37_1774190_c1 3300050507 Bacteria 597
483 nmdc:mga09592_776341_c1 3300050508 Bacteria 812
484 nmdc:mga09592_832528_c1 3300050508 Bacteria 779
485 nmdc:mga0qj67_309994_c1 3300050509 Bacteria 1278
486 nmdc:mga06r32_1711915_c1 3300050510 Unclassified 566
487 nmdc:mga08y16_102818_c1 3300050511 Bacteria 2975
488 nmdc:mga08y16_172654_c1 3300050511 Bacteria 2245
489 nmdc:mga08y16_2060428_c1 3300050511 Bacteria 519
490 nmdc:mga0n895_1863077_c1 3300050512 Unclassified 561
491 nmdc:mga0n895_2215081_c1 3300050512 Unclassified 505
492 nmdc:mga0n895_548594_c1 3300050512 Unclassified 1162
493 nmdc:mga0n895_569305_c1 3300050512 Bacteria 1138
494 nmdc:mga0n895_834625_c1 3300050512 Bacteria 910
495 nmdc:mga0rr50_294795_c1 3300050513 Bacteria 1356
496 nmdc:mga0rr50_5099_c1 3300050513 Bacteria 7793
497 nmdc:mga0rr50_524143_c1 3300050513 Bacteria 1008
498 nmdc:mga0rr50_90064_c1 3300050513 Unclassified 2386
499 nmdc:mga08x19_340295_c1 3300050514 Bacteria 1046
500 nmdc:mga08x19_573553_c1 3300050514 Bacteria 799
501 nmdc:mga08x19_63833_c1 3300050514 Bacteria 2390
502 nmdc:mga0a205_332347_c1 3300050515 Bacteria 1389
503 nmdc:mga0a205_63450_c1 3300050515 Bacteria 3569
504 Ga0495619_0004491 3300053085 Bacteria 8911
505 Ga0500595_100564 3300053119 Bacteria 829
506 Ga0500559_0343329 3300053136 Bacteria 699
507 Ga0500604_0150537 3300053151 Bacteria 790
508 Ga0500622_0293403 3300053156 Bacteria 696
509 Ga0500639_081592 3300053163 Unclassified 1628
510 Ga0501082_1159544 3300060353 Bacteria 675
511 Ga0070708_100068121
512 rootL2_10059624
513 rootL2_10154864
514 Ga0065707_10805415
515 Ga0070683_100027319
516 Ga0070683_100079294
517 Ga0070683_100137788
518 Ga0070690_100344726
519 Ga0070690_100558715
520 Ga0068869_100010382
521 Ga0068869_100013285
522 Ga0070680_100008642
523 Ga0070680_100219830
524 Ga0070682_100000002
525 Ga0068868_100003860
526 Ga0068868_100018784
527 Ga0068868_101058466
528 Ga0068868_101323194
529 Ga0070660_100095665
530 Ga0070689_100689412
531 Ga0070691_10000813
532 Ga0070687_100031223
533 Ga0070661_100046444
534 Ga0070692_10088940
535 Ga0070668_100169258
536 Ga0070668_101975480
537 Ga0070669_100107902
538 Ga0070675_101554472
539 Ga0070671_100547257
540 Ga0070671_100607719
541 Ga0070673_100646052
542 Ga0070688_100715713
543 Ga0070667_100064371
544 Ga0070667_100135343
545 Ga0070667_101008821
546 Ga0070703_10151110
547 Ga0070709_10276478
548 Ga0070709_10500766
549 Ga0070713_100146124
550 Ga0070713_101217476
551 Ga0070701_10285955
552 Ga0070701_10458171
553 Ga0070711_100019656
554 Ga0070705_100118163
555 Ga0070705_100839839
556 Ga0070700_100337628
557 Ga0070700_100932490
558 Ga0070700_101125911
559 Ga0070694_100576660
560 Ga0070708_100018240
561 Ga0070708_100047228
562 Ga0070708_101068652
563 Ga0070708_101925801
564 Ga0070663_100010934
565 Ga0070663_100268923
566 Ga0070663_101456238
567 Ga0070678_100232277
568 Ga0070662_101176883
569 Ga0070681_10000363
570 Ga0070681_10019123
571 Ga0070681_10062578
572 Ga0070681_10327274
573 Ga0068867_100100945
574 Ga0068867_100239041
575 Ga0070706_100172831
576 Ga0070706_101006347
577 Ga0070707_100000815
578 Ga0070707_100029652
579 Ga0070707_100158003
580 Ga0070707_100198918
581 Ga0070707_100840503
582 Ga0070707_101506417
583 Ga0070698_100338360
584 Ga0070698_100930164
585 Ga0070698_101924116
586 Ga0070699_100064969
587 Ga0070679_100196534
588 Ga0070679_101228345
589 Ga0070684_100011096
590 Ga0070697_100136426
591 Ga0070697_100137953
592 Ga0070697_100520723
593 Ga0070697_100762896
594 Ga0068853_100057644
595 Ga0068853_100402140
596 Ga0070672_100465926
597 Ga0070672_101804886
598 Ga0070695_101109560
599 Ga0070696_100025494
600 Ga0070696_100147355
601 Ga0070696_101065120
602 Ga0070693_100212661
603 Ga0070693_100376570
604 Ga0070693_101501820
605 Ga0070665_100757614
606 Ga0070665_101127899
607 Ga0070704_100239465
608 Ga0070704_100431040
609 Ga0070704_101339653
610 Ga0068855_100049260
611 Ga0070664_102060626
612 Ga0068857_100010389
613 Ga0068857_101280307
614 Ga0068854_100004200
615 Ga0068854_100130333
616 Ga0068854_100290035
617 Ga0068854_100579377
618 Ga0068856_100003427
619 Ga0068856_100148314
620 Ga0068852_100002293
621 Ga0068852_100363890
622 Ga0068852_102372988
623 Ga0068859_100049767
624 Ga0068859_100205772
625 Ga0068859_101895106
626 Ga0068859_102253604
627 Ga0068864_101698399
628 Ga0068866_10770317
629 Ga0068866_10899657
630 Ga0068861_100044699
631 Ga0068861_100129572
632 Ga0068861_101541453
633 Ga0068861_102196308
634 Ga0068861_102317695
635 Ga0068851_10400755
636 Ga0068863_100179189
637 Ga0068863_100789936
638 Ga0068858_100010001
639 Ga0068858_100037226
640 Ga0068858_100073575
641 Ga0068858_100223177
642 Ga0068858_102387242
643 Ga0068860_100170773
644 Ga0068860_100246916
645 Ga0068860_100469269
646 Ga0068860_100540941
647 Ga0068860_100691695
648 Ga0068860_101041906
649 Ga0068860_101983828
650 Ga0068860_102136522
651 Ga0068862_100287614
652 Ga0081455_10096915
653 Ga0081540_1086004
654 Ga0075365_10343849
655 Ga0075368_10125866
656 Ga0075363_100021566
657 Ga0075363_101013178
658 Ga0075364_10057891
659 Ga0070715_10912730
660 Ga0070712_100000400
661 Ga0075362_10049963
662 Ga0075367_10034436
663 Ga0075366_10000735
664 Ga0097621_100013628
665 Ga0097621_100026875
666 Ga0097621_101488026
667 Ga0097621_102330077
668 Ga0075370_10098246
669 Ga0075370_10685000
670 Ga0068871_100001091
671 Ga0068871_100021642
672 Ga0068871_100206686
673 Ga0068871_101319555
674 Ga0075428_100699327
675 Ga0075428_102520721
676 Ga0075430_101647132
677 Ga0075431_100037629
678 Ga0075431_101287676
679 Ga0075433_10248939
680 Ga0075433_10328693
681 Ga0075433_11796418
682 Ga0075434_100228319
683 Ga0075434_100238759
684 Ga0075434_100838541
685 Ga0075434_102253221
686 Ga0075429_100072252
687 Ga0075429_100834484
688 Ga0068865_100202311
689 Ga0068865_100940364
690 Ga0075436_100011193
691 Ga0075436_100561306
692 Ga0075436_100672931
693 Ga0075436_101410183
694 Ga0097620_100049765
695 Ga0097620_100205762
696 Ga0097620_101894896
697 Ga0097620_102253599
698 Ga0075435_100024922
699 Ga0075435_100095513
700 Ga0075435_100356708
701 Ga0075435_100440564
702 Ga0075435_100968224
703 Ga0099794_10006878
704 Ga0105250_10083296
705 Ga0105240_10017078
706 Ga0105240_11024974
707 Ga0111539_10162610
708 Ga0111539_10176954
709 Ga0111539_13320189
710 Ga0105245_10002299
711 Ga0105245_10081368
712 Ga0105247_10145913
713 Ga0114129_10039372
714 Ga0114129_10120966
715 Ga0114129_10186882
716 Ga0114129_10781852
717 Ga0114129_11432796
718 Ga0114129_11980509
719 Ga0114129_12698974
720 Ga0105243_10622445
721 Ga0105243_10937014
722 Ga0105243_11592781
723 Ga0105241_10000024
724 Ga0105241_10022447
725 Ga0105241_10032489
726 Ga0105241_10043346
727 Ga0105241_10095143
728 Ga0105241_10117562
729 Ga0105241_10132679
730 Ga0105242_10175907
731 Ga0105248_10026955
732 Ga0105248_10105751
733 Ga0105248_10168670
734 Ga0105248_10342354
735 Ga0105237_10025509
736 Ga0105237_10057026
737 Ga0105237_11323314
738 Ga0105237_11774825
739 Ga0105237_12674222
740 Ga0105238_10019543
741 Ga0105238_10496551
742 Ga0105249_10251962
743 Ga0105249_11074057
744 Ga0105249_11445848
745 Ga0105239_10037662
746 Ga0105239_10117891
747 Ga0105239_11629525
748 Ga0105246_10020442
749 Ga0105246_10518041
750 Ga0105246_11665903
751 Ga0157373_10021584
752 Ga0157373_10538640
753 Ga0157371_10025962
754 Ga0157371_10242800
755 Ga0157370_10959179
756 Ga0157369_10020912
757 Ga0157369_10051996
758 Ga0157369_10069390
759 Ga0157369_11417099
760 Ga0157374_10250227
761 Ga0157378_10001198
762 Ga0157378_10122214
763 Ga0157378_11239798
764 Ga0157378_11896316
765 Ga0157378_12131451
766 Ga0163162_10542914
767 Ga0163162_10884261
768 Ga0163162_11057070
769 Ga0163162_11743917
770 Ga0163162_12693350
771 Ga0163162_13406313
772 Ga0157372_10011135
773 Ga0157372_10070609
774 Ga0157372_10396613
775 Ga0157372_10977327
776 Ga0157375_10152697
777 Ga0157375_10638288
778 Ga0157375_11084471
779 Ga0163163_10004219
780 Ga0157380_10533925
781 Ga0157380_11028498
782 Ga0157379_10122018
783 Ga0157379_10336325
784 Ga0157379_10404656
785 Ga0157379_11325959
786 Ga0157376_10234902
787 Ga0157376_10456369
788 Ga0157376_11261594
789 Ga0157376_12424237
790 Ga0163161_10556430
791 Ga0206352_10369532
792 Ga0206354_11647850
793 Ga0206353_11984923
794 Ga0207697_10004384
795 Ga0207682_10022202
796 Ga0207692_10958673
797 Ga0207710_10016882
798 Ga0207688_10041023
799 Ga0207680_10076756
800 Ga0207647_10007176
801 Ga0207699_10290704
802 Ga0207643_10468787
803 Ga0207705_10176780
804 Ga0207684_10150621
805 Ga0207684_10436956
806 Ga0207684_10817875
807 Ga0207654_10000044
808 Ga0207654_10173966
809 Ga0207654_10229951
810 Ga0207654_11226828
811 Ga0207707_10104815
812 Ga0207707_10308558
813 Ga0207707_10805987
814 Ga0207695_10019473
815 Ga0207693_10000620
816 Ga0207663_10006253
817 Ga0207660_10075760
818 Ga0207660_10116618
819 Ga0207662_10032137
820 Ga0207662_10076240
821 Ga0207662_10927149
822 Ga0207657_10068971
823 Ga0207652_10184373
824 Ga0207652_10930039
825 Ga0207646_10008098
826 Ga0207646_10223231
827 Ga0207646_11056277
828 Ga0207681_10555127
829 Ga0207681_10676562
830 Ga0207694_10049340
831 Ga0207650_11873696
832 Ga0207659_10105639
833 Ga0207659_11057278
834 Ga0207687_10058654
835 Ga0207687_10113054
836 Ga0207687_10266785
837 Ga0207687_10708310
838 Ga0207644_10003698
839 Ga0207644_10261156
840 Ga0207644_10326451
841 Ga0207706_10436594
842 Ga0207686_10409688
843 Ga0207709_10451484
844 Ga0207709_11177388
845 Ga0207670_10047564
846 Ga0207670_11273451
847 Ga0207669_10108445
848 Ga0207704_10045459
849 Ga0207704_10058099
850 Ga0207704_10745096
851 Ga0207704_11757403
852 Ga0207665_10755359
853 Ga0207691_10009421
854 Ga0207691_10573351
855 Ga0207711_10011408
856 Ga0207711_10189068
857 Ga0207689_10003392
858 Ga0207689_10549512
859 Ga0207661_11985925
860 Ga0207667_10046118
861 Ga0207667_11329613
862 Ga0207712_10077669
863 Ga0207712_10368764
864 Ga0207668_10005597
865 Ga0207668_10125949
866 Ga0207668_11367856
867 Ga0207668_11428281
868 Ga0207668_12068097
869 Ga0207640_10066342
870 Ga0207640_10219064
871 Ga0207640_10361502
872 Ga0207658_10202876
873 Ga0207658_10405645
874 Ga0207658_10527954
875 Ga0207658_11539850
876 Ga0207677_10010977
877 Ga0207677_10102260
878 Ga0207677_10537978
879 Ga0207677_10794914
880 Ga0207703_10077435
881 Ga0207703_10222449
882 Ga0207703_11506388
883 Ga0207639_10401182
884 Ga0207639_11077055
885 Ga0207678_10018778
886 Ga0207708_10071191
887 Ga0207708_11355355
888 Ga0207702_10180181
889 Ga0207641_10159790
890 Ga0207648_10065747
891 Ga0207648_10281917
892 Ga0207674_10237590
893 Ga0207674_11556443
894 Ga0207675_100011146
895 Ga0207675_100090216
896 Ga0207675_100377441
897 Ga0207675_101930925
898 Ga0207675_102107643
899 Ga0207683_10737423
900 Ga0207698_10164802
901 Ga0207698_10455738
902 Ga0207698_10489382
903 Ga0209813_10294354
904 Ga0207428_10004180
905 Ga0207428_10470195
906 Ga0265356_1009174
907 Ga0268266_10747518
908 Ga0268265_10021575
909 Ga0268265_11143004
910 Ga0268264_10043327
911 Ga0268264_10083796
912 Ga0268264_10286074
913 Ga0268264_10482498
914 Ga0268264_10638959
915 Ga0265328_10055707
916 Ga0265325_10011569
917 Ga0265339_10123711
918 Ga0265331_10003869
919 Ga0265316_10004119
920 Ga0307408_101605231
921 Ga0265313_10012201
922 Ga0265314_10095836
923 Ga0265342_10066953
924 Ga0307413_10112864
925 Ga0307406_10494072
926 Ga0307412_11846595
927 Ga0307416_102089233
928 Ga0316214_1040924
929 Ga0373950_0000097
930 Ga0373949_0001525
931 Ga0373923_0288937
932 Ga0373941_0345484
933 Ga0373943_0762744
934 Ga0373955_0129575
935 Ga0373961_0309748
936 Ga0373931_0625319
937 Ga0373927_0289874
938 Ga0373927_0375373
939 Ga0373937_0019332
940 Ga0373937_0689387
941 Ga0373937_1972178
942 Ga0436365_1210525
943 Ga0436360_1090731
944 Ga0439437_042832
945 Ga0439441_079124
946 Ga0439464_0227671
947 Ga0453683_0473708
948 Ga0451576_0095957
949 Ga0451576_2100909
950 Ga0495629_0056956
951 Ga0495584_0389923
952 Ga0495607_0062528
953 Ga0495610_0035881
954 Ga0495616_0050750
955 Ga0495628_0610881
956 Ga0495663_0072145
957 Ga0495642_0512999
958 Ga0495587_0162991
959 Ga0495633_0557340
960 Ga0495667_0344402
961 Ga0495656_0050158
962 Ga0495658_0154423
963 Ga0495602_0040155
964 Ga0496100_0220108
965 Ga0496100_0403698
966 Ga0496101_0936601
967 Ga0496102_0509433
968 Ga0496105_0987369
969 Ga0496106_1503245
970 Ga0496108_0995269
971 Ga0496109_0178028
972 Ga0496110_0583504
973 Ga0496110_1109372
974 Ga0496111_0097594
975 Ga0496112_0001244
976 Ga0501296_081406
977 Ga0501035_0417563
978 Ga0501044_0065856
979 nmdc:mga03683_61923_c1
980 nmdc:mga03n38_49266_c1
981 nmdc:mga03n38_820756_c1
982 nmdc:mga00v17_1025717_c1
983 nmdc:mga00v17_34688_c1
984 nmdc:mga0k408_187823_c1
985 nmdc:mga06z11_131382_c1
986 nmdc:mga06z11_13837_c1
987 nmdc:mga04h51_37914_c1
988 nmdc:mga07m45_570646_c1
989 nmdc:mga07m45_61017_c1
990 nmdc:mga05p37_1398981_c1
991 nmdc:mga05p37_164026_c1
992 nmdc:mga05p37_1774190_c1
993 nmdc:mga09592_776341_c1
994 nmdc:mga09592_832528_c1
995 nmdc:mga0qj67_309994_c1
996 nmdc:mga06r32_1711915_c1
997 nmdc:mga08y16_102818_c1
998 nmdc:mga08y16_172654_c1
999 nmdc:mga08y16_2060428_c1
1000 nmdc:mga0n895_1863077_c1
1001 nmdc:mga0n895_2215081_c1
1002 nmdc:mga0n895_548594_c1
1003 nmdc:mga0n895_569305_c1
1004 nmdc:mga0n895_834625_c1
1005 nmdc:mga0rr50_294795_c1
1006 nmdc:mga0rr50_5099_c1
1007 nmdc:mga0rr50_524143_c1
1008 nmdc:mga0rr50_90064_c1
1009 nmdc:mga08x19_340295_c1
1010 nmdc:mga08x19_573553_c1
1011 nmdc:mga08x19_63833_c1
1012 nmdc:mga0a205_332347_c1
1013 nmdc:mga0a205_63450_c1
1014 Ga0495619_0004491
1015 Ga0500595_100564
1016 Ga0500559_0343329
1017 Ga0500604_0150537
1018 Ga0500622_0293403
1019 Ga0500639_081592
1020 Ga0501082_1159544

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p4l-assembly1.cif.gz_A crystal structure of the trimeric ectodomain of archaeal fusexin1 (fsx1) 0.7422 1 29
2k8e-assembly1.cif.gz_A solution nmr structure of protein of unknown function yegp from e. coli. ontario center for structural proteomics target ec0640_1_123 northeast structural genomics consortium target et102. 0.735 2 38
7p4l-assembly1.cif.gz_B crystal structure of the trimeric ectodomain of archaeal fusexin1 (fsx1) 0.7133 1 29
7p4l-assembly1.cif.gz_C crystal structure of the trimeric ectodomain of archaeal fusexin1 (fsx1) 0.7002 1 29
7wq5-assembly1.cif.gz_A crystal structure of arabidopsis transcriptional factor wrinkled1 with dsdna 0.6687 2 38
ID Description Score Start End Superfamily
af_A0A1D6KJ58_29_91_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7788 2 36 3.30.730.10
af_A0A1D6JRM7_1460_1518_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7639 2 39 3.30.730.10
af_Q54TE4_5_145_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.7514 1 45 3.90.1140.10
af_K7VB02_32_90_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7392 2 36 3.30.730.10
af_P0DH87_218_327_2.10.25.10 Mainly Beta;Ribbon;Laminin;Laminin 0.7381 1 29 2.10.25.10
ID Description Score Start End GO Terms
AF-A0A2V6R6C1-F1-model_v4 AP2-like integrase N-terminal domain-containing protein 1.01 1 48
AF-A0A2V5YM63-F1-model_v4 Uncharacterized protein 1.01 1 39
AF-A0A6I6MUD1-F1-model_v4 AP2-like integrase N-terminal domain-containing protein 1.007 1 48
AF-A0A1Q4AJ78-F1-model_v4 AP2-like integrase N-terminal domain-containing protein 1.004 1 49
AF-A0A2V7LIK5-F1-model_v4 AP2-like integrase N-terminal domain-containing protein 1.003 1 48

Map