F457090

General Info

Members Datasets Scaffolds Average Seq Length
510 180 510 109

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10385509|Ga0070677_103855091
Length 131
Sequence MSLKRSRRSTLYWTPSHLERSESRMIRDFHAHIYFDPDQLAEAQALGAAAHAKFGVPEGHYHVRPVGPHPRGSCQLTVPADQLGEIAQWLVLNRGGLTIFAHANTGDDLADHTEHVIWFGDSELLDLSIFR

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
141 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
142 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
143 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
144 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
175 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
176 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
177 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
178 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
179 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.73
Rhizosphere 95.69
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000058 3300001904 Bacteria 18173
2 JGI24737J22298_10009527 3300001990 Bacteria 3225
3 JGI24737J22298_10032854 3300001990 Bacteria 1614
4 JGI24034J26672_10055799 3300002239 Bacteria 686
5 Ga0070658_10000629 3300005327 Bacteria 30443
6 Ga0070658_10013952 3300005327 Bacteria 6450
7 Ga0070658_10113194 3300005327 Bacteria 2250
8 Ga0070658_10131813 3300005327 Bacteria 2083
9 Ga0070658_10205612 3300005327 Bacteria 1662
10 Ga0070658_10421058 3300005327 Unclassified 1148
11 Ga0070658_10516636 3300005327 Bacteria 1032
12 Ga0070658_10839513 3300005327 Bacteria 798
13 Ga0070683_100024902 3300005329 Bacteria 5366
14 Ga0070683_100223118 3300005329 Bacteria 1791
15 Ga0070683_100307904 3300005329 Bacteria 1507
16 Ga0070683_101672509 3300005329 Bacteria 612
17 Ga0070670_100034870 3300005331 Bacteria 4330
18 Ga0070670_100792549 3300005331 Bacteria 855
19 Ga0070677_10098899 3300005333 Unclassified 1283
20 Ga0070677_10385509 3300005333 Unclassified 735
21 Ga0070677_10707995 3300005333 Bacteria 568
22 Ga0068869_101322586 3300005334 Bacteria 636
23 Ga0070666_10006670 3300005335 Bacteria 7100
24 Ga0070666_10098757 3300005335 Unclassified 2011
25 Ga0070680_100007960 3300005336 Bacteria 8090
26 Ga0070680_100163406 3300005336 Bacteria 1871
27 Ga0070680_101534843 3300005336 Unclassified 577
28 Ga0070682_100011804 3300005337 Bacteria 4998
29 Ga0068868_100164806 3300005338 Bacteria 1832
30 Ga0068868_101567503 3300005338 Bacteria 618
31 Ga0070660_100000085 3300005339 Bacteria 56233
32 Ga0070660_100004179 3300005339 Bacteria 9971
33 Ga0070660_100020567 3300005339 Bacteria 4852
34 Ga0070660_100030986 3300005339 Bacteria 4014
35 Ga0070660_100149519 3300005339 Bacteria 1877
36 Ga0070660_100224711 3300005339 Bacteria 1526
37 Ga0070660_100681666 3300005339 Unclassified 861
38 Ga0070660_101173511 3300005339 Bacteria 651
39 Ga0070660_101327637 3300005339 Bacteria 611
40 Ga0070691_10007749 3300005341 Bacteria 4917
41 Ga0070661_100005813 3300005344 Bacteria 8484
42 Ga0070661_100006820 3300005344 Bacteria 7871
43 Ga0070661_100060113 3300005344 Bacteria 2788
44 Ga0070661_100496162 3300005344 Bacteria 977
45 Ga0070661_100706953 3300005344 Bacteria 821
46 Ga0070661_101028175 3300005344 Bacteria 684
47 Ga0070661_101606429 3300005344 Bacteria 550
48 Ga0070692_10003494 3300005345 Bacteria 6382
49 Ga0070692_10010924 3300005345 Bacteria 4154
50 Ga0070692_10390509 3300005345 Bacteria 876
51 Ga0070692_11148340 3300005345 Unclassified 551
52 Ga0070668_100683237 3300005347 Bacteria 904
53 Ga0070668_101187929 3300005347 Bacteria 691
54 Ga0070671_100011569 3300005355 Bacteria 7097
55 Ga0070671_100079508 3300005355 Bacteria 2741
56 Ga0070671_100081517 3300005355 Bacteria 2705
57 Ga0070671_100876567 3300005355 Bacteria 783
58 Ga0070671_101084233 3300005355 Unclassified 703
59 Ga0070674_100029612 3300005356 Bacteria 3609
60 Ga0070674_100096219 3300005356 Bacteria 2148
61 Ga0070674_100157653 3300005356 Unclassified 1719
62 Ga0070673_100000937 3300005364 Bacteria 16526
63 Ga0070673_101234801 3300005364 Bacteria 701
64 Ga0070659_100050293 3300005366 Bacteria 3277
65 Ga0070659_100064693 3300005366 Bacteria 2895
66 Ga0070659_100085851 3300005366 Bacteria 2518
67 Ga0070659_100125999 3300005366 Bacteria 2078
68 Ga0070659_100241544 3300005366 Bacteria 1495
69 Ga0070659_100504080 3300005366 Bacteria 1032
70 Ga0070659_100561679 3300005366 Bacteria 978
71 Ga0070659_101279849 3300005366 Bacteria 650
72 Ga0070667_100096215 3300005367 Bacteria 2553
73 Ga0070667_101623537 3300005367 Bacteria 608
74 Ga0070714_100693729 3300005435 Bacteria 982
75 Ga0070714_100873423 3300005435 Bacteria 873
76 Ga0070705_100867515 3300005440 Unclassified 723
77 Ga0070663_100010317 3300005455 Bacteria 5821
78 Ga0070663_100011073 3300005455 Bacteria 5646
79 Ga0070663_100057640 3300005455 Bacteria 2787
80 Ga0070663_100077701 3300005455 Bacteria 2431
81 Ga0070663_100319125 3300005455 Bacteria 1249
82 Ga0070663_100550091 3300005455 Bacteria 965
83 Ga0070663_100761377 3300005455 Bacteria 828
84 Ga0070663_100780052 3300005455 Bacteria 818
85 Ga0070678_100001897 3300005456 Bacteria 11265
86 Ga0070678_100131010 3300005456 Bacteria 1992
87 Ga0070678_100317594 3300005456 Unclassified 1329
88 Ga0070662_100006530 3300005457 Bacteria 7524
89 Ga0070662_100014950 3300005457 Bacteria 5190
90 Ga0070662_100051225 3300005457 Bacteria 2980
91 Ga0070662_100079269 3300005457 Bacteria 2442
92 Ga0070662_100137202 3300005457 Unclassified 1892
93 Ga0070662_100218251 3300005457 Bacteria 1520
94 Ga0070662_101078867 3300005457 Bacteria 689
95 Ga0070681_10523074 3300005458 Bacteria 1100
96 Ga0070681_12053067 3300005458 Bacteria 500
97 Ga0070679_100133696 3300005530 Bacteria 2461
98 Ga0070679_100779023 3300005530 Bacteria 900
99 Ga0070679_101024747 3300005530 Unclassified 770
100 Ga0070679_101568468 3300005530 Unclassified 606
101 Ga0070684_100024140 3300005535 Bacteria 5097
102 Ga0070684_100096023 3300005535 Bacteria 2642
103 Ga0068853_100131591 3300005539 Bacteria 2240
104 Ga0068853_100222082 3300005539 Bacteria 1726
105 Ga0068853_100254929 3300005539 Bacteria 1611
106 Ga0068853_100992191 3300005539 Bacteria 808
107 Ga0070672_100024264 3300005543 Bacteria 4479
108 Ga0070672_100099674 3300005543 Bacteria 2355
109 Ga0070672_100243959 3300005543 Bacteria 1512
110 Ga0070672_100954700 3300005543 Bacteria 759
111 Ga0070693_100232586 3300005547 Unclassified 1213
112 Ga0070665_100307307 3300005548 Unclassified 1589
113 Ga0070665_100822782 3300005548 Bacteria 942
114 Ga0068855_100000300 3300005563 Bacteria 61687
115 Ga0068855_100519763 3300005563 Bacteria 1291
116 Ga0068855_100531267 3300005563 Bacteria 1275
117 Ga0070664_100008653 3300005564 Bacteria 8234
118 Ga0070664_100009543 3300005564 Bacteria 7868
119 Ga0070664_100115188 3300005564 Bacteria 2349
120 Ga0070664_100311128 3300005564 Bacteria 1425
121 Ga0070664_101088392 3300005564 Bacteria 752
122 Ga0070664_101111449 3300005564 Bacteria 745
123 Ga0068857_100162272 3300005577 Bacteria 2028
124 Ga0068857_100179368 3300005577 Bacteria 1927
125 Ga0068857_102000856 3300005577 Bacteria 568
126 Ga0068854_100086057 3300005578 Bacteria 2329
127 Ga0068854_100092313 3300005578 Bacteria 2255
128 Ga0068854_101211705 3300005578 Bacteria 677
129 Ga0068856_100040715 3300005614 Bacteria 4564
130 Ga0068856_100085220 3300005614 Bacteria 3139
131 Ga0068856_100103660 3300005614 Bacteria 2838
132 Ga0068856_100263146 3300005614 Bacteria 1740
133 Ga0068856_101916747 3300005614 Bacteria 603
134 Ga0068852_100580266 3300005616 Bacteria 1124
135 Ga0068852_100743675 3300005616 Bacteria 993
136 Ga0068852_101512683 3300005616 Unclassified 693
137 Ga0068859_100130962 3300005617 Bacteria 2580
138 Ga0068859_101468295 3300005617 Unclassified 752
139 Ga0068864_100030627 3300005618 Bacteria 4561
140 Ga0068864_100216374 3300005618 Bacteria 1766
141 Ga0068864_101455725 3300005618 Bacteria 687
142 Ga0068851_10038476 3300005834 Unclassified 2400
143 Ga0068851_10764243 3300005834 Bacteria 599
144 Ga0068863_100077682 3300005841 Bacteria 3142
145 Ga0068858_100005290 3300005842 Bacteria 12652
146 Ga0068858_100107732 3300005842 Bacteria 2601
147 Ga0068860_100528662 3300005843 Bacteria 1180
148 Ga0068860_100872493 3300005843 Bacteria 915
149 Ga0081539_10014640 3300005985 Bacteria 5776
150 Ga0097621_100102767 3300006237 Bacteria 2406
151 Ga0097621_100137361 3300006237 Unclassified 2086
152 Ga0097621_101423345 3300006237 Bacteria 657
153 Ga0097621_101624208 3300006237 Unclassified 615
154 Ga0068871_100095627 3300006358 Bacteria 2481
155 Ga0068871_100127621 3300006358 Bacteria 2154
156 Ga0068865_101120833 3300006881 Bacteria 694
157 Ga0097620_100130950 3300006931 Bacteria 2580
158 Ga0097620_101468732 3300006931 Unclassified 752
159 Ga0075435_100720716 3300007076 Unclassified 867
160 Ga0105251_10498011 3300009011 Bacteria 569
161 Ga0105240_10655902 3300009093 Bacteria 1150
162 Ga0105241_12431281 3300009174 Unclassified 523
163 Ga0105248_10028457 3300009177 Bacteria 6225
164 Ga0105248_10036614 3300009177 Bacteria 5488
165 Ga0105248_10234260 3300009177 Bacteria 2067
166 Ga0105248_10374384 3300009177 Bacteria 1603
167 Ga0105237_10076132 3300009545 Bacteria 3346
168 Ga0105237_11043364 3300009545 Bacteria 824
169 Ga0105238_10070732 3300009551 Bacteria 3487
170 Ga0105239_10293067 3300010375 Bacteria 1832
171 Ga0105239_11564029 3300010375 Bacteria 762
172 Ga0105246_11851230 3300011119 Bacteria 578
173 Ga0157373_10051912 3300013100 Bacteria 2919
174 Ga0157373_10164905 3300013100 Bacteria 1559
175 Ga0157373_10207119 3300013100 Bacteria 1383
176 Ga0157373_10386536 3300013100 Unclassified 1001
177 Ga0157373_10516474 3300013100 Bacteria 864
178 Ga0157373_10734443 3300013100 Unclassified 725
179 Ga0157371_10007000 3300013102 Bacteria 9176
180 Ga0157371_10233201 3300013102 Bacteria 1323
181 Ga0157371_10636040 3300013102 Bacteria 795
182 Ga0157371_11035077 3300013102 Unclassified 627
183 Ga0157371_11636215 3300013102 Unclassified 505
184 Ga0157370_10068522 3300013104 Bacteria 3353
185 Ga0157370_10146642 3300013104 Bacteria 2197
186 Ga0157370_10312879 3300013104 Unclassified 1449
187 Ga0157370_10916779 3300013104 Bacteria 795
188 Ga0157370_11058996 3300013104 Bacteria 733
189 Ga0157370_11079000 3300013104 Bacteria 726
190 Ga0157370_11132406 3300013104 Bacteria 707
191 Ga0157370_11239672 3300013104 Bacteria 672
192 Ga0157370_11620396 3300013104 Bacteria 581
193 Ga0157369_10000141 3300013105 Bacteria 102055
194 Ga0157369_10026620 3300013105 Bacteria 6414
195 Ga0157369_10343966 3300013105 Bacteria 1549
196 Ga0157369_10434428 3300013105 Bacteria 1360
197 Ga0157369_11417120 3300013105 Bacteria 707
198 Ga0157374_10002376 3300013296 Bacteria 15859
199 Ga0157374_10394513 3300013296 Unclassified 1380
200 Ga0157374_11239211 3300013296 Bacteria 767
201 Ga0157378_10312020 3300013297 Bacteria 1525
202 Ga0157378_10814976 3300013297 Unclassified 960
203 Ga0157378_12317036 3300013297 Bacteria 588
204 Ga0163162_10113074 3300013306 Bacteria 2813
205 Ga0157372_10539333 3300013307 Bacteria 1360
206 Ga0157372_11297813 3300013307 Bacteria 840
207 Ga0157372_11689307 3300013307 Bacteria 728
208 Ga0157372_13051889 3300013307 Bacteria 535
209 Ga0157375_10001232 3300013308 Bacteria 22092
210 Ga0182008_10042143 3300014497 Bacteria 2275
211 Ga0182008_10087278 3300014497 Bacteria 1537
212 Ga0157379_10009707 3300014968 Bacteria 8382
213 Ga0157379_10261244 3300014968 Bacteria 1573
214 Ga0197907_10039069 3300020069 Unclassified 545
215 Ga0206356_11232869 3300020070 Unclassified 510
216 Ga0206354_10095100 3300020081 Unclassified 690
217 Ga0206353_11010324 3300020082 Unclassified 547
218 Ga0213876_10072961 3300021384 Bacteria 1812
219 Ga0224712_10564018 3300022467 Unclassified 554
220 Ga0207697_10079289 3300025315 Bacteria 1383
221 Ga0207656_10034728 3300025321 Bacteria 2107
222 Ga0207682_10326412 3300025893 Bacteria 721
223 Ga0207682_10421541 3300025893 Bacteria 631
224 Ga0207688_10009726 3300025901 Bacteria 5231
225 Ga0207680_10146699 3300025903 Bacteria 1569
226 Ga0207680_10193029 3300025903 Bacteria 1383
227 Ga0207680_10432834 3300025903 Unclassified 933
228 Ga0207647_10005418 3300025904 Bacteria 9357
229 Ga0207647_10034508 3300025904 Bacteria 3229
230 Ga0207647_10064020 3300025904 Bacteria 2235
231 Ga0207647_10119559 3300025904 Bacteria 1554
232 Ga0207647_10376072 3300025904 Bacteria 802
233 Ga0207647_10408318 3300025904 Bacteria 764
234 Ga0207645_11129160 3300025907 Bacteria 528
235 Ga0207705_10000003 3300025909 Bacteria 709270
236 Ga0207705_10000061 3300025909 Bacteria 150179
237 Ga0207705_10002968 3300025909 Bacteria 12960
238 Ga0207705_10017228 3300025909 Bacteria 5174
239 Ga0207705_10022519 3300025909 Bacteria 4492
240 Ga0207705_10040860 3300025909 Bacteria 3327
241 Ga0207705_10094798 3300025909 Bacteria 2189
242 Ga0207705_10155225 3300025909 Bacteria 1717
243 Ga0207705_10803080 3300025909 Unclassified 730
244 Ga0207654_10559052 3300025911 Bacteria 813
245 Ga0207707_10492194 3300025912 Bacteria 1046
246 Ga0207695_10054084 3300025913 Bacteria 4195
247 Ga0207660_10018452 3300025917 Bacteria 4651
248 Ga0207660_10153091 3300025917 Bacteria 1773
249 Ga0207657_10015074 3300025919 Bacteria 7508
250 Ga0207657_10017727 3300025919 Bacteria 6819
251 Ga0207657_10019447 3300025919 Bacteria 6448
252 Ga0207657_10024051 3300025919 Bacteria 5655
253 Ga0207657_10099732 3300025919 Bacteria 2412
254 Ga0207657_10115797 3300025919 Bacteria 2209
255 Ga0207657_10119177 3300025919 Bacteria 2172
256 Ga0207657_10380358 3300025919 Unclassified 1112
257 Ga0207649_10006562 3300025920 Bacteria 6321
258 Ga0207649_10016768 3300025920 Bacteria 4141
259 Ga0207649_10118625 3300025920 Bacteria 1780
260 Ga0207649_10161232 3300025920 Bacteria 1554
261 Ga0207649_11637149 3300025920 Bacteria 510
262 Ga0207652_10237593 3300025921 Bacteria 1642
263 Ga0207694_10290603 3300025924 Bacteria 1344
264 Ga0207650_10008406 3300025925 Bacteria 7046
265 Ga0207650_10019734 3300025925 Bacteria 4741
266 Ga0207664_10180937 3300025929 Bacteria 1810
267 Ga0207644_10127555 3300025931 Bacteria 1944
268 Ga0207644_10131930 3300025931 Bacteria 1913
269 Ga0207644_10316221 3300025931 Bacteria 1261
270 Ga0207644_10855829 3300025931 Unclassified 761
271 Ga0207690_10011515 3300025932 Bacteria 5284
272 Ga0207690_10089723 3300025932 Bacteria 2168
273 Ga0207690_10180826 3300025932 Bacteria 1588
274 Ga0207690_10187250 3300025932 Bacteria 1563
275 Ga0207690_10504493 3300025932 Bacteria 979
276 Ga0207690_11246438 3300025932 Bacteria 621
277 Ga0207706_10030010 3300025933 Bacteria 4853
278 Ga0207706_10071113 3300025933 Bacteria 3060
279 Ga0207706_10107825 3300025933 Bacteria 2451
280 Ga0207706_10188658 3300025933 Bacteria 1810
281 Ga0207706_10428909 3300025933 Bacteria 1145
282 Ga0207706_10465898 3300025933 Bacteria 1092
283 Ga0207669_10040752 3300025937 Bacteria 2697
284 Ga0207669_10248477 3300025937 Unclassified 1323
285 Ga0207691_10020592 3300025940 Bacteria 6236
286 Ga0207691_10112299 3300025940 Bacteria 2422
287 Ga0207691_10143477 3300025940 Bacteria 2103
288 Ga0207711_10047439 3300025941 Bacteria 3672
289 Ga0207711_10062194 3300025941 Bacteria 3220
290 Ga0207711_10156963 3300025941 Bacteria 2057
291 Ga0207711_11223617 3300025941 Bacteria 693
292 Ga0207689_10417661 3300025942 Bacteria 1119
293 Ga0207661_10096808 3300025944 Bacteria 2470
294 Ga0207661_10957164 3300025944 Bacteria 789
295 Ga0207661_10958307 3300025944 Bacteria 788
296 Ga0207679_10014539 3300025945 Bacteria 5179
297 Ga0207679_10079626 3300025945 Bacteria 2499
298 Ga0207679_10140032 3300025945 Bacteria 1954
299 Ga0207679_10180220 3300025945 Bacteria 1747
300 Ga0207667_10000187 3300025949 Bacteria 90766
301 Ga0207667_10045302 3300025949 Bacteria 4659
302 Ga0207667_10228646 3300025949 Bacteria 1905
303 Ga0207667_10274210 3300025949 Bacteria 1724
304 Ga0207667_10962239 3300025949 Bacteria 843
305 Ga0207667_11197073 3300025949 Bacteria 740
306 Ga0207667_11198234 3300025949 Bacteria 739
307 Ga0207651_10204897 3300025960 Bacteria 1583
308 Ga0207640_10011228 3300025981 Bacteria 5067
309 Ga0207640_10017533 3300025981 Bacteria 4192
310 Ga0207640_10171799 3300025981 Bacteria 1616
311 Ga0207658_10164856 3300025986 Bacteria 1819
312 Ga0207658_10575623 3300025986 Bacteria 1010
313 Ga0207658_11203767 3300025986 Bacteria 692
314 Ga0207677_10321831 3300026023 Bacteria 1285
315 Ga0207677_11280862 3300026023 Bacteria 673
316 Ga0207703_10019038 3300026035 Bacteria 5362
317 Ga0207703_10527594 3300026035 Bacteria 1111
318 Ga0207639_10050351 3300026041 Bacteria 3163
319 Ga0207639_10540937 3300026041 Bacteria 1068
320 Ga0207639_10951386 3300026041 Bacteria 804
321 Ga0207678_10004644 3300026067 Bacteria 12335
322 Ga0207678_10009292 3300026067 Bacteria 8653
323 Ga0207678_10022133 3300026067 Bacteria 5569
324 Ga0207678_10043850 3300026067 Bacteria 3869
325 Ga0207678_10091304 3300026067 Bacteria 2603
326 Ga0207678_10124331 3300026067 Bacteria 2201
327 Ga0207678_10335585 3300026067 Bacteria 1302
328 Ga0207702_10031269 3300026078 Bacteria 4436
329 Ga0207702_10038036 3300026078 Bacteria 4030
330 Ga0207702_10081828 3300026078 Bacteria 2805
331 Ga0207702_10106643 3300026078 Bacteria 2483
332 Ga0207702_11297105 3300026078 Unclassified 722
333 Ga0207641_10463973 3300026088 Bacteria 1225
334 Ga0207648_10940786 3300026089 Bacteria 808
335 Ga0207676_10369741 3300026095 Bacteria 1331
336 Ga0207674_10022291 3300026116 Bacteria 6803
337 Ga0207674_10028200 3300026116 Bacteria 5929
338 Ga0207674_10138189 3300026116 Bacteria 2398
339 Ga0207683_10009904 3300026121 Bacteria 8127
340 Ga0207683_10037087 3300026121 Bacteria 4245
341 Ga0207683_10106819 3300026121 Bacteria 2503
342 Ga0207683_10318516 3300026121 Unclassified 1424
343 Ga0207698_10015640 3300026142 Bacteria 5088
344 Ga0207698_10603149 3300026142 Bacteria 1083
345 Ga0207698_11547129 3300026142 Bacteria 678
346 Ga0207698_11710724 3300026142 Bacteria 644
347 Ga0268264_10895540 3300028381 Bacteria 890
348 Ga0268264_11385248 3300028381 Bacteria 714
349 Ga0307408_100230139 3300031548 Bacteria 1517
350 Ga0307408_101359096 3300031548 Bacteria 667
351 Ga0307405_10691456 3300031731 Bacteria 843
352 Ga0307413_10026869 3300031824 Bacteria 3179
353 Ga0307413_10288129 3300031824 Bacteria 1239
354 Ga0307413_10636962 3300031824 Bacteria 877
355 Ga0307410_10011551 3300031852 Bacteria 5056
356 Ga0307410_10034816 3300031852 Bacteria 3265
357 Ga0307410_10415900 3300031852 Bacteria 1089
358 Ga0307406_10975944 3300031901 Bacteria 725
359 Ga0307407_10011499 3300031903 Bacteria 4215
360 Ga0307407_10093305 3300031903 Bacteria 1850
361 Ga0307407_11079663 3300031903 Unclassified 623
362 Ga0307412_10300961 3300031911 Bacteria 1267
363 Ga0307412_10832721 3300031911 Bacteria 803
364 Ga0307409_100024010 3300031995 Bacteria 4241
365 Ga0307409_100209241 3300031995 Bacteria 1751
366 Ga0307409_100622327 3300031995 Bacteria 1070
367 Ga0307409_101562803 3300031995 Bacteria 687
368 Ga0307409_101773282 3300031995 Unclassified 646
369 Ga0307416_100000663 3300032002 Bacteria 17833
370 Ga0307416_100278866 3300032002 Bacteria 1646
371 Ga0307416_100794429 3300032002 Bacteria 1042
372 Ga0307416_102076048 3300032002 Bacteria 670
373 Ga0307416_102955032 3300032002 Bacteria 569
374 Ga0307414_10225049 3300032004 Bacteria 1542
375 Ga0307414_11312921 3300032004 Bacteria 671
376 Ga0307411_10161564 3300032005 Bacteria 1678
377 Ga0307411_10372128 3300032005 Bacteria 1172
378 Ga0307411_11553226 3300032005 Bacteria 609
379 Ga0307411_11652458 3300032005 Unclassified 592
380 Ga0307415_100317668 3300032126 Bacteria 1297
381 Ga0307415_100785645 3300032126 Bacteria 867
382 Ga0395899_0000255 3300037312 Bacteria 70382
383 Ga0395899_0001175 3300037312 Bacteria 23096
384 Ga0395899_0018840 3300037312 Bacteria 5245
385 Ga0395899_0039015 3300037312 Bacteria 3556
386 Ga0395899_0048357 3300037312 Bacteria 3165
387 Ga0395899_0063466 3300037312 Bacteria 2717
388 Ga0395899_0223744 3300037312 Bacteria 1302
389 Ga0395899_0237338 3300037312 Unclassified 1256
390 Ga0395899_0297687 3300037312 Bacteria 1093
391 Ga0395899_0315813 3300037312 Unclassified 1054
392 Ga0395899_0347737 3300037312 Bacteria 992
393 Ga0395899_0360876 3300037312 Bacteria 970
394 Ga0395900_0000126 3300037418 Bacteria 127586
395 Ga0395900_0000308 3300037418 Bacteria 72664
396 Ga0395900_0017288 3300037418 Bacteria 7360
397 Ga0395900_0017999 3300037418 Bacteria 7213
398 Ga0395900_0030881 3300037418 Bacteria 5502
399 Ga0395900_0044421 3300037418 Bacteria 4578
400 Ga0395900_0097951 3300037418 Bacteria 3013
401 Ga0395900_0148893 3300037418 Bacteria 2392
402 Ga0395900_0174097 3300037418 Bacteria 2189
403 Ga0395900_0291559 3300037418 Bacteria 1620
404 Ga0395900_0511714 3300037418 Bacteria 1149
405 Ga0395900_0624549 3300037418 Bacteria 1016
406 Ga0395900_0861993 3300037418 Bacteria 831
407 Ga0395898_0001096 3300037466 Bacteria 41791
408 Ga0395898_0016515 3300037466 Bacteria 7551
409 Ga0395898_0023751 3300037466 Bacteria 6190
410 Ga0395898_0024175 3300037466 Bacteria 6130
411 Ga0395898_0079169 3300037466 Bacteria 3170
412 Ga0395898_0225834 3300037466 Bacteria 1786
413 Ga0395898_0353269 3300037466 Bacteria 1402
414 Ga0395898_0422343 3300037466 Bacteria 1270
415 Ga0395898_0551138 3300037466 Bacteria 1095
416 Ga0395898_0732263 3300037466 Bacteria 930
417 Ga0395898_1506601 3300037466 Unclassified 598
418 Ga0395905_0000005 3300037471 Bacteria 557808
419 Ga0395905_0000735 3300037471 Bacteria 43152
420 Ga0395905_0008998 3300037471 Bacteria 9798
421 Ga0395905_0063025 3300037471 Bacteria 3468
422 Ga0395905_0073352 3300037471 Bacteria 3208
423 Ga0395905_0090633 3300037471 Bacteria 2866
424 Ga0395905_0106812 3300037471 Unclassified 2628
425 Ga0395905_0117878 3300037471 Bacteria 2495
426 Ga0395905_0194643 3300037471 Bacteria 1901
427 Ga0395905_0224556 3300037471 Bacteria 1757
428 Ga0395905_0305746 3300037471 Bacteria 1478
429 Ga0395905_0387974 3300037471 Bacteria 1291
430 Ga0395905_0515521 3300037471 Bacteria 1096
431 Ga0395905_0584053 3300037471 Bacteria 1019
432 Ga0395905_1348833 3300037471 Unclassified 617
433 Ga0395905_1713143 3300037471 Unclassified 534
434 Ga0395901_0000147 3300038443 Bacteria 91584
435 Ga0395901_0001666 3300038443 Bacteria 22932
436 Ga0395901_0004383 3300038443 Bacteria 14238
437 Ga0395901_0016131 3300038443 Bacteria 7609
438 Ga0395901_0021747 3300038443 Bacteria 6572
439 Ga0395901_0030989 3300038443 Bacteria 5512
440 Ga0395901_0050158 3300038443 Bacteria 4337
441 Ga0395901_0067462 3300038443 Bacteria 3725
442 Ga0395901_0098377 3300038443 Bacteria 3067
443 Ga0395901_0206724 3300038443 Bacteria 2056
444 Ga0395901_0243381 3300038443 Bacteria 1875
445 Ga0395901_0461041 3300038443 Bacteria 1298
446 Ga0395901_0539248 3300038443 Bacteria 1183
447 Ga0395901_0565352 3300038443 Bacteria 1151
448 Ga0395901_0725492 3300038443 Bacteria 989
449 Ga0395901_1078928 3300038443 Unclassified 774
450 Ga0436365_0822316 3300039437 Bacteria 19672
451 Ga0439465_0012942 3300041413 Bacteria 2608
452 Ga0439465_0231384 3300041413 Bacteria 680
453 Ga0451843_1665004 3300041509 Unclassified 579
454 Ga0439432_010307 3300042006 Bacteria 3241
455 Ga0439449_0119690 3300042007 Bacteria 977
456 Ga0450899_047028 3300042135 Bacteria 547
457 Ga0439458_0002234 3300042157 Bacteria 4775
458 Ga0466966_0007349 3300044684 Bacteria 7305
459 Ga0466966_0365713 3300044684 Bacteria 866
460 Ga0466966_0438304 3300044684 Bacteria 785
461 Ga0466966_0702177 3300044684 Bacteria 609
462 Ga0466961_0015016 3300044693 Bacteria 4972
463 Ga0466961_0114941 3300044693 Bacteria 1691
464 Ga0466963_0011371 3300044694 Bacteria 5418
465 Ga0466963_0378691 3300044694 Bacteria 997
466 Ga0466963_0473938 3300044694 Bacteria 883
467 Ga0466964_0141874 3300044706 Bacteria 1105
468 Ga0466971_0025016 3300044719 Bacteria 2666
469 Ga0466971_0087648 3300044719 Bacteria 1423
470 Ga0466970_0056857 3300044765 Bacteria 2091
471 Ga0466957_0024811 3300044842 Bacteria 3551
472 Ga0466957_0437850 3300044842 Bacteria 899
473 Ga0466960_0186924 3300044901 Unclassified 1126
474 Ga0466959_0027863 3300045049 Bacteria 4190
475 Ga0466959_0120935 3300045049 Bacteria 1862
476 Ga0466958_0008145 3300045836 Bacteria 5802
477 Ga0466958_0390388 3300045836 Unclassified 898
478 Ga0466967_0028204 3300045976 Bacteria 4684
479 Ga0466967_0373726 3300045976 Bacteria 1383
480 Ga0495643_0266460 3300046522 Bacteria 793
481 Ga0495621_0081613 3300046539 Unclassified 1206
482 Ga0496100_0078290 3300048903 Bacteria 2225
483 Ga0496101_0322394 3300048904 Bacteria 1212
484 Ga0496101_0495155 3300048904 Bacteria 965
485 Ga0496102_0031799 3300048905 Bacteria 4737
486 Ga0496103_0182878 3300048906 Bacteria 1347
487 Ga0496106_0083352 3300048909 Bacteria 2459
488 Ga0496107_0044653 3300048910 Bacteria 3186
489 Ga0496108_0006540 3300048911 Bacteria 9451
490 Ga0496108_0131090 3300048911 Bacteria 2155
491 Ga0496109_0022315 3300048912 Bacteria 5605
492 Ga0496110_0530507 3300048913 Bacteria 1071
493 Ga0496110_0698797 3300048913 Unclassified 915
494 Ga0496111_0007165 3300048914 Bacteria 7287
495 Ga0496111_0054692 3300048914 Bacteria 2886
496 Ga0496111_0115273 3300048914 Bacteria 1981
497 Ga0496112_0054252 3300048915 Bacteria 3937
498 Ga0496113_0587068 3300048916 Bacteria 892
499 Ga0496114_0073452 3300048917 Bacteria 2878
500 Ga0496115_0100755 3300048918 Bacteria 2368
501 Ga0501067_0027658 3300049583 Bacteria 3143
502 Ga0501069_0083408 3300049585 Unclassified 1802
503 Ga0501209_126530 3300049656 Bacteria 761
504 Ga0501249_119736 3300049679 Bacteria 642
505 Ga0501225_0037804 3300049705 Bacteria 1330
506 Ga0501263_016851 3300049760 Bacteria 955
507 Ga0501268_001196 3300049765 Bacteria 3160
508 Ga0501273_028915 3300049770 Bacteria 782
509 Ga0466962_0024157 3300061719 Bacteria 2920
510 Ga0466962_0480951 3300061719 Unclassified 627

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100876567 Ga0070671_1008765671 106
2 3300005543 Ga0070672_100243959 Ga0070672_1002439591 106
3 3300006237 Ga0097621_101423345 Ga0097621_1014233452 106
4 3300009177 Ga0105248_10374384 Ga0105248_103743843 106
5 3300013307 Ga0157372_11689307 Ga0157372_116893072 106
6 3300014497 Ga0182008_10087278 Ga0182008_100872782 106
7 3300025940 Ga0207691_10143477 Ga0207691_101434771 106
8 3300025941 Ga0207711_11223617 Ga0207711_112236171 106
9 3300046539 Ga0495621_0081613 Ga0495621_0081613_46_372 106
10 3300001904 JGI24736J21556_1000058 JGI24736J21556_10000584 107
11 3300001990 JGI24737J22298_10009527 JGI24737J22298_100095274 107
12 3300001990 JGI24737J22298_10032854 JGI24737J22298_100328543 107
13 3300002239 JGI24034J26672_10055799 JGI24034J26672_100557991 107
14 3300005327 Ga0070658_10000629 Ga0070658_1000062929 107
15 3300005327 Ga0070658_10013952 Ga0070658_100139523 107
16 3300005327 Ga0070658_10113194 Ga0070658_101131942 107
17 3300005327 Ga0070658_10131813 Ga0070658_101318133 107
18 3300005327 Ga0070658_10205612 Ga0070658_102056122 107
19 3300005327 Ga0070658_10421058 Ga0070658_104210582 107
20 3300005327 Ga0070658_10516636 Ga0070658_105166362 107
21 3300005327 Ga0070658_10839513 Ga0070658_108395132 107
22 3300005329 Ga0070683_100024902 Ga0070683_1000249026 107
23 3300005329 Ga0070683_100223118 Ga0070683_1002231181 107
24 3300005329 Ga0070683_100307904 Ga0070683_1003079042 107
25 3300005329 Ga0070683_101672509 Ga0070683_1016725091 107
26 3300005331 Ga0070670_100034870 Ga0070670_1000348703 107
27 3300005331 Ga0070670_100792549 Ga0070670_1007925492 107
28 3300005333 Ga0070677_10098899 Ga0070677_100988992 107
29 3300005333 Ga0070677_10385509 Ga0070677_103855091 107
30 3300005333 Ga0070677_10707995 Ga0070677_107079951 107
31 3300005334 Ga0068869_101322586 Ga0068869_1013225861 107
32 3300005335 Ga0070666_10006670 Ga0070666_100066709 107
33 3300005335 Ga0070666_10098757 Ga0070666_100987573 107
34 3300005336 Ga0070680_100007960 Ga0070680_1000079605 107
35 3300005336 Ga0070680_100163406 Ga0070680_1001634063 107
36 3300005336 Ga0070680_101534843 Ga0070680_1015348431 107
37 3300005337 Ga0070682_100011804 Ga0070682_1000118044 107
38 3300005338 Ga0068868_100164806 Ga0068868_1001648062 107
39 3300005338 Ga0068868_101567503 Ga0068868_1015675032 107
40 3300005339 Ga0070660_100000085 Ga0070660_10000008528 107
41 3300005339 Ga0070660_100004179 Ga0070660_1000041799 107
42 3300005339 Ga0070660_100020567 Ga0070660_1000205673 107
43 3300005339 Ga0070660_100030986 Ga0070660_1000309864 107
44 3300005339 Ga0070660_100149519 Ga0070660_1001495192 107
45 3300005339 Ga0070660_100224711 Ga0070660_1002247112 107
46 3300005339 Ga0070660_100681666 Ga0070660_1006816661 107
47 3300005339 Ga0070660_101173511 Ga0070660_1011735111 107
48 3300005339 Ga0070660_101327637 Ga0070660_1013276371 107
49 3300005341 Ga0070691_10007749 Ga0070691_100077496 107
50 3300005344 Ga0070661_100005813 Ga0070661_1000058132 107
51 3300005344 Ga0070661_100006820 Ga0070661_1000068203 107
52 3300005344 Ga0070661_100060113 Ga0070661_1000601134 107
53 3300005344 Ga0070661_100496162 Ga0070661_1004961622 107
54 3300005344 Ga0070661_100706953 Ga0070661_1007069532 107
55 3300005344 Ga0070661_101028175 Ga0070661_1010281752 107
56 3300005344 Ga0070661_101606429 Ga0070661_1016064291 107
57 3300005345 Ga0070692_10003494 Ga0070692_100034944 107
58 3300005345 Ga0070692_10010924 Ga0070692_100109242 107
59 3300005345 Ga0070692_10390509 Ga0070692_103905092 107
60 3300005345 Ga0070692_11148340 Ga0070692_111483401 107
61 3300005347 Ga0070668_100683237 Ga0070668_1006832372 107
62 3300005347 Ga0070668_101187929 Ga0070668_1011879292 107
63 3300005355 Ga0070671_100011569 Ga0070671_1000115696 107
64 3300005355 Ga0070671_100079508 Ga0070671_1000795083 107
65 3300005355 Ga0070671_100081517 Ga0070671_1000815172 107
66 3300005355 Ga0070671_101084233 Ga0070671_1010842331 107
67 3300005356 Ga0070674_100029612 Ga0070674_1000296123 107
68 3300005356 Ga0070674_100096219 Ga0070674_1000962193 107
69 3300005356 Ga0070674_100157653 Ga0070674_1001576532 107
70 3300005364 Ga0070673_100000937 Ga0070673_1000009371 107
71 3300005364 Ga0070673_101234801 Ga0070673_1012348012 107
72 3300005366 Ga0070659_100050293 Ga0070659_1000502933 107
73 3300005366 Ga0070659_100064693 Ga0070659_1000646934 107
74 3300005366 Ga0070659_100085851 Ga0070659_1000858513 107
75 3300005366 Ga0070659_100125999 Ga0070659_1001259992 107
76 3300005366 Ga0070659_100241544 Ga0070659_1002415442 107
77 3300005366 Ga0070659_100504080 Ga0070659_1005040802 107
78 3300005366 Ga0070659_100561679 Ga0070659_1005616792 107
79 3300005366 Ga0070659_101279849 Ga0070659_1012798491 107
80 3300005367 Ga0070667_100096215 Ga0070667_1000962151 107
81 3300005367 Ga0070667_101623537 Ga0070667_1016235371 107
82 3300005435 Ga0070714_100693729 Ga0070714_1006937292 107
83 3300005435 Ga0070714_100873423 Ga0070714_1008734232 107
84 3300005440 Ga0070705_100867515 Ga0070705_1008675152 107
85 3300005455 Ga0070663_100010317 Ga0070663_1000103172 107
86 3300005455 Ga0070663_100011073 Ga0070663_1000110734 107
87 3300005455 Ga0070663_100057640 Ga0070663_1000576403 107
88 3300005455 Ga0070663_100077701 Ga0070663_1000777013 107
89 3300005455 Ga0070663_100319125 Ga0070663_1003191252 107
90 3300005455 Ga0070663_100550091 Ga0070663_1005500912 107
91 3300005455 Ga0070663_100761377 Ga0070663_1007613772 107
92 3300005455 Ga0070663_100780052 Ga0070663_1007800522 107
93 3300005456 Ga0070678_100001897 Ga0070678_1000018977 107
94 3300005456 Ga0070678_100131010 Ga0070678_1001310102 107
95 3300005456 Ga0070678_100317594 Ga0070678_1003175942 107
96 3300005457 Ga0070662_100006530 Ga0070662_1000065302 107
97 3300005457 Ga0070662_100014950 Ga0070662_1000149504 107
98 3300005457 Ga0070662_100051225 Ga0070662_1000512252 107
99 3300005457 Ga0070662_100079269 Ga0070662_1000792692 107
100 3300005457 Ga0070662_100137202 Ga0070662_1001372022 107
101 3300005457 Ga0070662_100218251 Ga0070662_1002182512 107
102 3300005457 Ga0070662_101078867 Ga0070662_1010788671 107
103 3300005458 Ga0070681_10523074 Ga0070681_105230742 107
104 3300005458 Ga0070681_12053067 Ga0070681_120530671 107
105 3300005530 Ga0070679_100133696 Ga0070679_1001336964 107
106 3300005530 Ga0070679_100779023 Ga0070679_1007790231 107
107 3300005530 Ga0070679_101024747 Ga0070679_1010247472 107
108 3300005530 Ga0070679_101568468 Ga0070679_1015684682 107
109 3300005535 Ga0070684_100024140 Ga0070684_1000241402 107
110 3300005535 Ga0070684_100096023 Ga0070684_1000960232 107
111 3300005539 Ga0068853_100131591 Ga0068853_1001315912 107
112 3300005539 Ga0068853_100222082 Ga0068853_1002220821 107
113 3300005539 Ga0068853_100254929 Ga0068853_1002549293 107
114 3300005539 Ga0068853_100992191 Ga0068853_1009921912 107
115 3300005543 Ga0070672_100024264 Ga0070672_1000242643 107
116 3300005543 Ga0070672_100099674 Ga0070672_1000996742 107
117 3300005543 Ga0070672_100954700 Ga0070672_1009547002 107
118 3300005547 Ga0070693_100232586 Ga0070693_1002325861 107
119 3300005548 Ga0070665_100307307 Ga0070665_1003073072 107
120 3300005548 Ga0070665_100822782 Ga0070665_1008227822 107
121 3300005563 Ga0068855_100000300 Ga0068855_10000030030 107
122 3300005563 Ga0068855_100519763 Ga0068855_1005197631 107
123 3300005563 Ga0068855_100531267 Ga0068855_1005312672 107
124 3300005564 Ga0070664_100008653 Ga0070664_1000086534 107
125 3300005564 Ga0070664_100009543 Ga0070664_1000095434 107
126 3300005564 Ga0070664_100115188 Ga0070664_1001151883 107
127 3300005564 Ga0070664_100311128 Ga0070664_1003111282 107
128 3300005564 Ga0070664_101088392 Ga0070664_1010883922 107
129 3300005564 Ga0070664_101111449 Ga0070664_1011114492 107
130 3300005577 Ga0068857_100162272 Ga0068857_1001622722 107
131 3300005577 Ga0068857_100179368 Ga0068857_1001793682 107
132 3300005577 Ga0068857_102000856 Ga0068857_1020008562 107
133 3300005578 Ga0068854_100086057 Ga0068854_1000860572 107
134 3300005578 Ga0068854_100092313 Ga0068854_1000923132 107
135 3300005578 Ga0068854_101211705 Ga0068854_1012117051 107
136 3300005614 Ga0068856_100040715 Ga0068856_1000407153 107
137 3300005614 Ga0068856_100085220 Ga0068856_1000852203 107
138 3300005614 Ga0068856_100103660 Ga0068856_1001036603 107
139 3300005614 Ga0068856_100263146 Ga0068856_1002631461 107
140 3300005614 Ga0068856_101916747 Ga0068856_1019167471 107
141 3300005616 Ga0068852_100580266 Ga0068852_1005802662 107
142 3300005616 Ga0068852_100743675 Ga0068852_1007436752 107
143 3300005616 Ga0068852_101512683 Ga0068852_1015126832 107
144 3300005617 Ga0068859_100130962 Ga0068859_1001309622 107
145 3300005617 Ga0068859_101468295 Ga0068859_1014682952 107
146 3300005618 Ga0068864_100030627 Ga0068864_1000306274 107
147 3300005618 Ga0068864_100216374 Ga0068864_1002163742 107
148 3300005618 Ga0068864_101455725 Ga0068864_1014557251 107
149 3300005834 Ga0068851_10038476 Ga0068851_100384762 107
150 3300005834 Ga0068851_10764243 Ga0068851_107642432 107
151 3300005841 Ga0068863_100077682 Ga0068863_1000776822 107
152 3300005842 Ga0068858_100005290 Ga0068858_10000529014 107
153 3300005842 Ga0068858_100107732 Ga0068858_1001077323 107
154 3300005843 Ga0068860_100528662 Ga0068860_1005286622 107
155 3300005843 Ga0068860_100872493 Ga0068860_1008724931 107
156 3300005985 Ga0081539_10014640 Ga0081539_100146403 107
157 3300006237 Ga0097621_100102767 Ga0097621_1001027672 107
158 3300006237 Ga0097621_100137361 Ga0097621_1001373612 107
159 3300006237 Ga0097621_101624208 Ga0097621_1016242082 107
160 3300006358 Ga0068871_100095627 Ga0068871_1000956272 107
161 3300006358 Ga0068871_100127621 Ga0068871_1001276212 107
162 3300006881 Ga0068865_101120833 Ga0068865_1011208332 107
163 3300006931 Ga0097620_100130950 Ga0097620_1001309503 107
164 3300006931 Ga0097620_101468732 Ga0097620_1014687322 107
165 3300007076 Ga0075435_100720716 Ga0075435_1007207162 107
166 3300009011 Ga0105251_10498011 Ga0105251_104980112 107
167 3300009093 Ga0105240_10655902 Ga0105240_106559022 107
168 3300009174 Ga0105241_12431281 Ga0105241_124312811 107
169 3300009177 Ga0105248_10028457 Ga0105248_100284573 107
170 3300009177 Ga0105248_10036614 Ga0105248_100366144 107
171 3300009177 Ga0105248_10234260 Ga0105248_102342603 107
172 3300009545 Ga0105237_10076132 Ga0105237_100761323 107
173 3300009545 Ga0105237_11043364 Ga0105237_110433642 107
174 3300009551 Ga0105238_10070732 Ga0105238_100707322 107
175 3300010375 Ga0105239_10293067 Ga0105239_102930672 107
176 3300010375 Ga0105239_11564029 Ga0105239_115640291 107
177 3300011119 Ga0105246_11851230 Ga0105246_118512302 107
178 3300013100 Ga0157373_10051912 Ga0157373_100519121 107
179 3300013100 Ga0157373_10164905 Ga0157373_101649051 107
180 3300013100 Ga0157373_10207119 Ga0157373_102071192 107
181 3300013100 Ga0157373_10386536 Ga0157373_103865362 107
182 3300013100 Ga0157373_10516474 Ga0157373_105164742 107
183 3300013100 Ga0157373_10734443 Ga0157373_107344431 107
184 3300013102 Ga0157371_10007000 Ga0157371_100070003 107
185 3300013102 Ga0157371_10233201 Ga0157371_102332011 107
186 3300013102 Ga0157371_10636040 Ga0157371_106360401 107
187 3300013102 Ga0157371_11035077 Ga0157371_110350772 107
188 3300013102 Ga0157371_11636215 Ga0157371_116362152 107
189 3300013104 Ga0157370_10068522 Ga0157370_100685222 107
190 3300013104 Ga0157370_10146642 Ga0157370_101466423 107
191 3300013104 Ga0157370_10312879 Ga0157370_103128792 107
192 3300013104 Ga0157370_10916779 Ga0157370_109167792 107
193 3300013104 Ga0157370_11058996 Ga0157370_110589962 107
194 3300013104 Ga0157370_11079000 Ga0157370_110790001 107
195 3300013104 Ga0157370_11132406 Ga0157370_111324062 107
196 3300013104 Ga0157370_11239672 Ga0157370_112396721 107
197 3300013104 Ga0157370_11620396 Ga0157370_116203961 107
198 3300013105 Ga0157369_10000141 Ga0157369_10000141114 107
199 3300013105 Ga0157369_10026620 Ga0157369_100266205 107
200 3300013105 Ga0157369_10343966 Ga0157369_103439662 107
201 3300013105 Ga0157369_10434428 Ga0157369_104344283 107
202 3300013105 Ga0157369_11417120 Ga0157369_114171202 107
203 3300013296 Ga0157374_10002376 Ga0157374_100023763 107
204 3300013296 Ga0157374_10394513 Ga0157374_103945132 107
205 3300013296 Ga0157374_11239211 Ga0157374_112392112 107
206 3300013297 Ga0157378_10312020 Ga0157378_103120202 107
207 3300013297 Ga0157378_10814976 Ga0157378_108149762 107
208 3300013297 Ga0157378_12317036 Ga0157378_123170361 107
209 3300013306 Ga0163162_10113074 Ga0163162_101130743 107
210 3300013307 Ga0157372_10539333 Ga0157372_105393332 107
211 3300013307 Ga0157372_11297813 Ga0157372_112978131 107
212 3300013307 Ga0157372_13051889 Ga0157372_130518891 107
213 3300013308 Ga0157375_10001232 Ga0157375_1000123220 107
214 3300014497 Ga0182008_10042143 Ga0182008_100421432 107
215 3300014968 Ga0157379_10009707 Ga0157379_100097075 107
216 3300014968 Ga0157379_10261244 Ga0157379_102612443 107
217 3300020069 Ga0197907_10039069 Ga0197907_100390692 107
218 3300020070 Ga0206356_11232869 Ga0206356_112328691 107
219 3300020081 Ga0206354_10095100 Ga0206354_100951001 107
220 3300020082 Ga0206353_11010324 Ga0206353_110103242 107
221 3300021384 Ga0213876_10072961 Ga0213876_100729613 107
222 3300022467 Ga0224712_10564018 Ga0224712_105640181 107
223 3300025315 Ga0207697_10079289 Ga0207697_100792891 107
224 3300025321 Ga0207656_10034728 Ga0207656_100347282 107
225 3300025893 Ga0207682_10326412 Ga0207682_103264122 107
226 3300025893 Ga0207682_10421541 Ga0207682_104215411 107
227 3300025901 Ga0207688_10009726 Ga0207688_100097264 107
228 3300025903 Ga0207680_10146699 Ga0207680_101466992 107
229 3300025903 Ga0207680_10193029 Ga0207680_101930292 107
230 3300025903 Ga0207680_10432834 Ga0207680_104328341 107
231 3300025904 Ga0207647_10005418 Ga0207647_100054185 107
232 3300025904 Ga0207647_10034508 Ga0207647_100345082 107
233 3300025904 Ga0207647_10064020 Ga0207647_100640203 107
234 3300025904 Ga0207647_10119559 Ga0207647_101195592 107
235 3300025904 Ga0207647_10376072 Ga0207647_103760722 107
236 3300025904 Ga0207647_10408318 Ga0207647_104083182 107
237 3300025907 Ga0207645_11129160 Ga0207645_111291602 107
238 3300025909 Ga0207705_10000003 Ga0207705_10000003650 107
239 3300025909 Ga0207705_10000061 Ga0207705_1000006129 107
240 3300025909 Ga0207705_10002968 Ga0207705_100029682 107
241 3300025909 Ga0207705_10017228 Ga0207705_100172285 107
242 3300025909 Ga0207705_10022519 Ga0207705_100225192 107
243 3300025909 Ga0207705_10040860 Ga0207705_100408603 107
244 3300025909 Ga0207705_10094798 Ga0207705_100947981 107
245 3300025909 Ga0207705_10155225 Ga0207705_101552252 107
246 3300025909 Ga0207705_10803080 Ga0207705_108030801 107
247 3300025911 Ga0207654_10559052 Ga0207654_105590522 107
248 3300025912 Ga0207707_10492194 Ga0207707_104921942 107
249 3300025913 Ga0207695_10054084 Ga0207695_100540841 107
250 3300025917 Ga0207660_10018452 Ga0207660_100184523 107
251 3300025917 Ga0207660_10153091 Ga0207660_101530913 107
252 3300025919 Ga0207657_10015074 Ga0207657_100150742 107
253 3300025919 Ga0207657_10017727 Ga0207657_100177274 107
254 3300025919 Ga0207657_10019447 Ga0207657_100194474 107
255 3300025919 Ga0207657_10024051 Ga0207657_100240515 107
256 3300025919 Ga0207657_10099732 Ga0207657_100997323 107
257 3300025919 Ga0207657_10115797 Ga0207657_101157972 107
258 3300025919 Ga0207657_10119177 Ga0207657_101191773 107
259 3300025919 Ga0207657_10380358 Ga0207657_103803582 107
260 3300025920 Ga0207649_10006562 Ga0207649_100065622 107
261 3300025920 Ga0207649_10016768 Ga0207649_100167684 107
262 3300025920 Ga0207649_10118625 Ga0207649_101186251 107
263 3300025920 Ga0207649_10161232 Ga0207649_101612323 107
264 3300025920 Ga0207649_11637149 Ga0207649_116371491 107
265 3300025921 Ga0207652_10237593 Ga0207652_102375933 107
266 3300025924 Ga0207694_10290603 Ga0207694_102906032 107
267 3300025925 Ga0207650_10008406 Ga0207650_100084069 107
268 3300025925 Ga0207650_10019734 Ga0207650_100197344 107
269 3300025929 Ga0207664_10180937 Ga0207664_101809372 107
270 3300025931 Ga0207644_10127555 Ga0207644_101275552 107
271 3300025931 Ga0207644_10131930 Ga0207644_101319302 107
272 3300025931 Ga0207644_10316221 Ga0207644_103162212 107
273 3300025931 Ga0207644_10855829 Ga0207644_108558291 107
274 3300025932 Ga0207690_10011515 Ga0207690_100115154 107
275 3300025932 Ga0207690_10089723 Ga0207690_100897233 107
276 3300025932 Ga0207690_10180826 Ga0207690_101808262 107
277 3300025932 Ga0207690_10187250 Ga0207690_101872502 107
278 3300025932 Ga0207690_10504493 Ga0207690_105044932 107
279 3300025932 Ga0207690_11246438 Ga0207690_112464382 107
280 3300025933 Ga0207706_10030010 Ga0207706_100300104 107
281 3300025933 Ga0207706_10071113 Ga0207706_100711132 107
282 3300025933 Ga0207706_10107825 Ga0207706_101078253 107
283 3300025933 Ga0207706_10188658 Ga0207706_101886583 107
284 3300025933 Ga0207706_10428909 Ga0207706_104289091 107
285 3300025933 Ga0207706_10465898 Ga0207706_104658982 107
286 3300025937 Ga0207669_10040752 Ga0207669_100407523 107
287 3300025937 Ga0207669_10248477 Ga0207669_102484772 107
288 3300025940 Ga0207691_10020592 Ga0207691_100205925 107
289 3300025940 Ga0207691_10112299 Ga0207691_101122992 107
290 3300025941 Ga0207711_10047439 Ga0207711_100474394 107
291 3300025941 Ga0207711_10062194 Ga0207711_100621943 107
292 3300025941 Ga0207711_10156963 Ga0207711_101569632 107
293 3300025942 Ga0207689_10417661 Ga0207689_104176612 107
294 3300025944 Ga0207661_10096808 Ga0207661_100968084 107
295 3300025944 Ga0207661_10957164 Ga0207661_109571642 107
296 3300025944 Ga0207661_10958307 Ga0207661_109583072 107
297 3300025945 Ga0207679_10014539 Ga0207679_100145395 107
298 3300025945 Ga0207679_10079626 Ga0207679_100796262 107
299 3300025945 Ga0207679_10140032 Ga0207679_101400322 107
300 3300025945 Ga0207679_10180220 Ga0207679_101802202 107
301 3300025949 Ga0207667_10000187 Ga0207667_1000018737 107
302 3300025949 Ga0207667_10045302 Ga0207667_100453022 107
303 3300025949 Ga0207667_10228646 Ga0207667_102286462 107
304 3300025949 Ga0207667_10274210 Ga0207667_102742104 107
305 3300025949 Ga0207667_10962239 Ga0207667_109622392 107
306 3300025949 Ga0207667_11197073 Ga0207667_111970732 107
307 3300025949 Ga0207667_11198234 Ga0207667_111982342 107
308 3300025960 Ga0207651_10204897 Ga0207651_102048972 107
309 3300025981 Ga0207640_10011228 Ga0207640_100112284 107
310 3300025981 Ga0207640_10017533 Ga0207640_100175332 107
311 3300025981 Ga0207640_10171799 Ga0207640_101717992 107
312 3300025986 Ga0207658_10164856 Ga0207658_101648562 107
313 3300025986 Ga0207658_10575623 Ga0207658_105756232 107
314 3300025986 Ga0207658_11203767 Ga0207658_112037672 107
315 3300026023 Ga0207677_10321831 Ga0207677_103218312 107
316 3300026023 Ga0207677_11280862 Ga0207677_112808622 107
317 3300026035 Ga0207703_10019038 Ga0207703_100190383 107
318 3300026035 Ga0207703_10527594 Ga0207703_105275941 107
319 3300026041 Ga0207639_10050351 Ga0207639_100503513 107
320 3300026041 Ga0207639_10540937 Ga0207639_105409372 107
321 3300026041 Ga0207639_10951386 Ga0207639_109513861 107
322 3300026067 Ga0207678_10004644 Ga0207678_100046442 107
323 3300026067 Ga0207678_10009292 Ga0207678_100092925 107
324 3300026067 Ga0207678_10022133 Ga0207678_100221334 107
325 3300026067 Ga0207678_10043850 Ga0207678_100438502 107
326 3300026067 Ga0207678_10091304 Ga0207678_100913043 107
327 3300026067 Ga0207678_10124331 Ga0207678_101243312 107
328 3300026067 Ga0207678_10335585 Ga0207678_103355852 107
329 3300026078 Ga0207702_10031269 Ga0207702_100312696 107
330 3300026078 Ga0207702_10038036 Ga0207702_100380361 107
331 3300026078 Ga0207702_10081828 Ga0207702_100818283 107
332 3300026078 Ga0207702_10106643 Ga0207702_101066433 107
333 3300026078 Ga0207702_11297105 Ga0207702_112971052 107
334 3300026088 Ga0207641_10463973 Ga0207641_104639732 107
335 3300026089 Ga0207648_10940786 Ga0207648_109407861 107
336 3300026095 Ga0207676_10369741 Ga0207676_103697412 107
337 3300026116 Ga0207674_10022291 Ga0207674_100222914 107
338 3300026116 Ga0207674_10028200 Ga0207674_100282004 107
339 3300026116 Ga0207674_10138189 Ga0207674_101381892 107
340 3300026121 Ga0207683_10009904 Ga0207683_100099047 107
341 3300026121 Ga0207683_10037087 Ga0207683_100370874 107
342 3300026121 Ga0207683_10106819 Ga0207683_101068192 107
343 3300026121 Ga0207683_10318516 Ga0207683_103185162 107
344 3300026142 Ga0207698_10015640 Ga0207698_100156407 107
345 3300026142 Ga0207698_10603149 Ga0207698_106031492 107
346 3300026142 Ga0207698_11547129 Ga0207698_115471291 107
347 3300026142 Ga0207698_11710724 Ga0207698_117107242 107
348 3300028381 Ga0268264_10895540 Ga0268264_108955401 107
349 3300028381 Ga0268264_11385248 Ga0268264_113852482 107
350 3300031548 Ga0307408_100230139 Ga0307408_1002301393 107
351 3300031548 Ga0307408_101359096 Ga0307408_1013590961 107
352 3300031731 Ga0307405_10691456 Ga0307405_106914562 107
353 3300031824 Ga0307413_10026869 Ga0307413_100268692 107
354 3300031824 Ga0307413_10288129 Ga0307413_102881292 107
355 3300031824 Ga0307413_10636962 Ga0307413_106369622 107
356 3300031852 Ga0307410_10011551 Ga0307410_100115514 107
357 3300031852 Ga0307410_10034816 Ga0307410_100348162 107
358 3300031852 Ga0307410_10415900 Ga0307410_104159002 107
359 3300031901 Ga0307406_10975944 Ga0307406_109759442 107
360 3300031903 Ga0307407_10011499 Ga0307407_100114992 107
361 3300031903 Ga0307407_10093305 Ga0307407_100933053 107
362 3300031903 Ga0307407_11079663 Ga0307407_110796632 107
363 3300031911 Ga0307412_10300961 Ga0307412_103009612 107
364 3300031911 Ga0307412_10832721 Ga0307412_108327212 107
365 3300031995 Ga0307409_100024010 Ga0307409_1000240101 107
366 3300031995 Ga0307409_100209241 Ga0307409_1002092412 107
367 3300031995 Ga0307409_100622327 Ga0307409_1006223271 107
368 3300031995 Ga0307409_101562803 Ga0307409_1015628032 107
369 3300031995 Ga0307409_101773282 Ga0307409_1017732822 107
370 3300032002 Ga0307416_100000663 Ga0307416_1000006634 107
371 3300032002 Ga0307416_100278866 Ga0307416_1002788662 107
372 3300032002 Ga0307416_100794429 Ga0307416_1007944292 107
373 3300032002 Ga0307416_102076048 Ga0307416_1020760481 107
374 3300032002 Ga0307416_102955032 Ga0307416_1029550322 107
375 3300032004 Ga0307414_10225049 Ga0307414_102250492 107
376 3300032004 Ga0307414_11312921 Ga0307414_113129212 107
377 3300032005 Ga0307411_10161564 Ga0307411_101615643 107
378 3300032005 Ga0307411_10372128 Ga0307411_103721282 107
379 3300032005 Ga0307411_11553226 Ga0307411_115532262 107
380 3300032005 Ga0307411_11652458 Ga0307411_116524582 107
381 3300032126 Ga0307415_100317668 Ga0307415_1003176682 107
382 3300032126 Ga0307415_100785645 Ga0307415_1007856452 107
383 3300037312 Ga0395899_0000255 Ga0395899_0000255_49448_49774 107
384 3300037312 Ga0395899_0001175 Ga0395899_0001175_2768_3091 107
385 3300037312 Ga0395899_0018840 Ga0395899_0018840_2974_3300 107
386 3300037312 Ga0395899_0039015 Ga0395899_0039015_2511_2834 107
387 3300037312 Ga0395899_0048357 Ga0395899_0048357_1562_1885 107
388 3300037312 Ga0395899_0063466 Ga0395899_0063466_2257_2580 107
389 3300037312 Ga0395899_0223744 Ga0395899_0223744_237_560 107
390 3300037312 Ga0395899_0237338 Ga0395899_0237338_862_1185 107
391 3300037312 Ga0395899_0297687 Ga0395899_0297687_55_378 107
392 3300037312 Ga0395899_0315813 Ga0395899_0315813_386_709 107
393 3300037312 Ga0395899_0347737 Ga0395899_0347737_105_428 107
394 3300037312 Ga0395899_0360876 Ga0395899_0360876_558_881 107
395 3300037418 Ga0395900_0000126 Ga0395900_0000126_69879_70202 107
396 3300037418 Ga0395900_0000308 Ga0395900_0000308_33594_33920 107
397 3300037418 Ga0395900_0017288 Ga0395900_0017288_138_470 107
398 3300037418 Ga0395900_0017999 Ga0395900_0017999_4147_4473 107
399 3300037418 Ga0395900_0030881 Ga0395900_0030881_181_504 107
400 3300037418 Ga0395900_0044421 Ga0395900_0044421_158_481 107
401 3300037418 Ga0395900_0097951 Ga0395900_0097951_1387_1710 107
402 3300037418 Ga0395900_0148893 Ga0395900_0148893_106_429 107
403 3300037418 Ga0395900_0174097 Ga0395900_0174097_579_902 107
404 3300037418 Ga0395900_0291559 Ga0395900_0291559_997_1320 107
405 3300037418 Ga0395900_0511714 Ga0395900_0511714_776_1099 107
406 3300037418 Ga0395900_0624549 Ga0395900_0624549_242_565 107
407 3300037418 Ga0395900_0861993 Ga0395900_0861993_206_532 107
408 3300037466 Ga0395898_0001096 Ga0395898_0001096_34909_35235 107
409 3300037466 Ga0395898_0016515 Ga0395898_0016515_2780_3103 107
410 3300037466 Ga0395898_0023751 Ga0395898_0023751_2863_3186 107
411 3300037466 Ga0395898_0024175 Ga0395898_0024175_1944_2270 107
412 3300037466 Ga0395898_0079169 Ga0395898_0079169_36_359 107
413 3300037466 Ga0395898_0225834 Ga0395898_0225834_656_979 107
414 3300037466 Ga0395898_0353269 Ga0395898_0353269_705_1028 107
415 3300037466 Ga0395898_0422343 Ga0395898_0422343_341_664 107
416 3300037466 Ga0395898_0551138 Ga0395898_0551138_26_349 107
417 3300037466 Ga0395898_0732263 Ga0395898_0732263_367_690 107
418 3300037466 Ga0395898_1506601 Ga0395898_1506601_134_457 107
419 3300037471 Ga0395905_0000005 Ga0395905_0000005_507367_507693 107
420 3300037471 Ga0395905_0000735 Ga0395905_0000735_11182_11505 107
421 3300037471 Ga0395905_0008998 Ga0395905_0008998_7914_8240 107
422 3300037471 Ga0395905_0063025 Ga0395905_0063025_1214_1537 107
423 3300037471 Ga0395905_0073352 Ga0395905_0073352_732_1055 107
424 3300037471 Ga0395905_0090633 Ga0395905_0090633_1516_1839 107
425 3300037471 Ga0395905_0106812 Ga0395905_0106812_2275_2607 107
426 3300037471 Ga0395905_0117878 Ga0395905_0117878_1230_1553 107
427 3300037471 Ga0395905_0194643 Ga0395905_0194643_75_398 107
428 3300037471 Ga0395905_0224556 Ga0395905_0224556_677_1000 107
429 3300037471 Ga0395905_0305746 Ga0395905_0305746_268_609 107
430 3300037471 Ga0395905_0387974 Ga0395905_0387974_393_770 107
431 3300037471 Ga0395905_0515521 Ga0395905_0515521_93_419 107
432 3300037471 Ga0395905_0584053 Ga0395905_0584053_143_478 107
433 3300037471 Ga0395905_1348833 Ga0395905_1348833_167_490 107
434 3300037471 Ga0395905_1713143 Ga0395905_1713143_43_366 107
435 3300038443 Ga0395901_0000147 Ga0395901_0000147_88471_88794 107
436 3300038443 Ga0395901_0001666 Ga0395901_0001666_17943_18266 107
437 3300038443 Ga0395901_0004383 Ga0395901_0004383_2206_2532 107
438 3300038443 Ga0395901_0016131 Ga0395901_0016131_5526_5849 107
439 3300038443 Ga0395901_0021747 Ga0395901_0021747_6069_6392 107
440 3300038443 Ga0395901_0030989 Ga0395901_0030989_2866_3189 107
441 3300038443 Ga0395901_0050158 Ga0395901_0050158_106_429 107
442 3300038443 Ga0395901_0067462 Ga0395901_0067462_341_664 107
443 3300038443 Ga0395901_0098377 Ga0395901_0098377_1669_1995 107
444 3300038443 Ga0395901_0206724 Ga0395901_0206724_925_1248 107
445 3300038443 Ga0395901_0243381 Ga0395901_0243381_194_577 107
446 3300038443 Ga0395901_0461041 Ga0395901_0461041_441_764 107
447 3300038443 Ga0395901_0539248 Ga0395901_0539248_119_451 107
448 3300038443 Ga0395901_0565352 Ga0395901_0565352_683_1006 107
449 3300038443 Ga0395901_0725492 Ga0395901_0725492_216_593 107
450 3300038443 Ga0395901_1078928 Ga0395901_1078928_429_761 107
451 3300039437 Ga0436365_0822316 Ga0436365_0822316_12656_12979 107
452 3300041413 Ga0439465_0012942 Ga0439465_0012942_1837_2163 107
453 3300041413 Ga0439465_0231384 Ga0439465_0231384_31_363 107
454 3300041509 Ga0451843_1665004 Ga0451843_1665004_194_520 107
455 3300042006 Ga0439432_010307 Ga0439432_010307_2219_2545 107
456 3300042007 Ga0439449_0119690 Ga0439449_0119690_77_403 107
457 3300042135 Ga0450899_047028 Ga0450899_047028_95_421 107
458 3300042157 Ga0439458_0002234 Ga0439458_0002234_1634_1960 107
459 3300044684 Ga0466966_0007349 Ga0466966_0007349_2813_3136 107
460 3300044684 Ga0466966_0365713 Ga0466966_0365713_153_476 107
461 3300044684 Ga0466966_0438304 Ga0466966_0438304_412_735 107
462 3300044684 Ga0466966_0702177 Ga0466966_0702177_153_476 107
463 3300044693 Ga0466961_0015016 Ga0466961_0015016_21_344 107
464 3300044693 Ga0466961_0114941 Ga0466961_0114941_498_821 107
465 3300044694 Ga0466963_0011371 Ga0466963_0011371_986_1309 107
466 3300044694 Ga0466963_0378691 Ga0466963_0378691_275_598 107
467 3300044694 Ga0466963_0473938 Ga0466963_0473938_129_452 107
468 3300044706 Ga0466964_0141874 Ga0466964_0141874_23_346 107
469 3300044719 Ga0466971_0025016 Ga0466971_0025016_1480_1803 107
470 3300044719 Ga0466971_0087648 Ga0466971_0087648_803_1126 107
471 3300044765 Ga0466970_0056857 Ga0466970_0056857_1147_1470 107
472 3300044842 Ga0466957_0024811 Ga0466957_0024811_813_1136 107
473 3300044842 Ga0466957_0437850 Ga0466957_0437850_442_765 107
474 3300044901 Ga0466960_0186924 Ga0466960_0186924_98_424 107
475 3300045049 Ga0466959_0027863 Ga0466959_0027863_3400_3723 107
476 3300045049 Ga0466959_0120935 Ga0466959_0120935_1364_1687 107
477 3300045836 Ga0466958_0008145 Ga0466958_0008145_2409_2732 107
478 3300045836 Ga0466958_0390388 Ga0466958_0390388_154_477 107
479 3300045976 Ga0466967_0028204 Ga0466967_0028204_852_1175 107
480 3300045976 Ga0466967_0373726 Ga0466967_0373726_705_1028 107
481 3300046522 Ga0495643_0266460 Ga0495643_0266460_172_501 107
482 3300048903 Ga0496100_0078290 Ga0496100_0078290_100_429 107
483 3300048904 Ga0496101_0322394 Ga0496101_0322394_638_967 107
484 3300048904 Ga0496101_0495155 Ga0496101_0495155_232_561 107
485 3300048905 Ga0496102_0031799 Ga0496102_0031799_652_993 107
486 3300048906 Ga0496103_0182878 Ga0496103_0182878_369_710 107
487 3300048909 Ga0496106_0083352 Ga0496106_0083352_679_1008 107
488 3300048910 Ga0496107_0044653 Ga0496107_0044653_1048_1377 107
489 3300048911 Ga0496108_0006540 Ga0496108_0006540_148_477 107
490 3300048911 Ga0496108_0131090 Ga0496108_0131090_657_998 107
491 3300048912 Ga0496109_0022315 Ga0496109_0022315_233_562 107
492 3300048913 Ga0496110_0530507 Ga0496110_0530507_310_651 107
493 3300048913 Ga0496110_0698797 Ga0496110_0698797_562_891 107
494 3300048914 Ga0496111_0007165 Ga0496111_0007165_1286_1627 107
495 3300048914 Ga0496111_0054692 Ga0496111_0054692_306_635 107
496 3300048914 Ga0496111_0115273 Ga0496111_0115273_322_651 107
497 3300048915 Ga0496112_0054252 Ga0496112_0054252_3114_3443 107
498 3300048916 Ga0496113_0587068 Ga0496113_0587068_277_606 107
499 3300048917 Ga0496114_0073452 Ga0496114_0073452_2516_2845 107
500 3300048918 Ga0496115_0100755 Ga0496115_0100755_382_711 107
501 3300049583 Ga0501067_0027658 Ga0501067_0027658_2548_2886 107
502 3300049585 Ga0501069_0083408 Ga0501069_0083408_674_1012 107
503 3300049656 Ga0501209_126530 Ga0501209_126530_152_478 107
504 3300049679 Ga0501249_119736 Ga0501249_119736_162_488 107
505 3300049705 Ga0501225_0037804 Ga0501225_0037804_236_562 107
506 3300049760 Ga0501263_016851 Ga0501263_016851_460_786 107
507 3300049765 Ga0501268_001196 Ga0501268_001196_2751_3077 107
508 3300049770 Ga0501273_028915 Ga0501273_028915_236_562 107
509 3300061719 Ga0466962_0024157 Ga0466962_0024157_1762_2085 107
510 3300061719 Ga0466962_0480951 Ga0466962_0480951_236_559 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08883

DOPA_dioxygen

Dopa 4,5-dioxygenase family

29

129

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2peb-assembly1.cif.gz_B crystal structure of a putative dioxygenase (npun_f1925) from nostoc punctiforme pcc 73102 at 1.46 a resolution 0.9665 2 104
2p8i-assembly1.cif.gz_A crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.40 a resolution 0.9416 2 107
2p8i-assembly1.cif.gz_A crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.40 a resolution 0.925 2 107
2peb-assembly1.cif.gz_B crystal structure of a putative dioxygenase (npun_f1925) from nostoc punctiforme pcc 73102 at 1.46 a resolution 0.923 2 104
1jjh-assembly1.cif.gz_A-2 e2 dna-binding domain from bovine papillomavirus type 1 0.7171 4 83
ID Description Score Start End Superfamily
2pebB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.9652 2 104 3.30.70.1240
2p8iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.9289 2 107 3.30.70.1240
2p8iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.9125 2 107 3.30.70.1240
2pebB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.9044 2 104 3.30.70.1240
af_Q59TT2_5_125_3.30.70.1240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.897 2 104 3.30.70.1240
ID Description Score Start End GO Terms
AF-A0A7H0G3F5-F1-model_v4 deleted 1 1 106
AF-A0A158S0L2-F1-model_v4 DOPA 4,5-dioxygenase 0.9952 2 107
AF-A0A1I5MYA2-F1-model_v4 DOPA 4,5-dioxygenase 0.9893 2 107 GO:0051213
AF-A0A2U1CHG1-F1-model_v4 DOPA 4,5-dioxygenase 0.9877 1 104 GO:0051213
AF-A0A485H1K8-F1-model_v4 deleted 0.9863 35 105

Feature Viewer

pLDDT pTM Quality
96.98 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map