F457053

General Info

Members Datasets Scaffolds Average Seq Length
509 303 409 364

Family's Representative Sequence

Representative Sequence 3300053090|Ga0500646_0000558|Ga0500646_0000558_5377_6402
Length 341
Sequence MGAVLAIAAVTGLAACGSGDSTSGSGSTEPVSLRLGHFPNLTHATALVGIEKGIFKQNLGSNVTLETKQYNAGPAAVEALFAGAIDATFIGPNPSISAFSQSKGKAVRIVAGAASGGVFFVVKPSITKPEDLKGKTIATPQLGNTQDVALRYWLKQKGYTTTKEGGGDVKIKPQDNAVTVDAFKSGAIDGAWVPEPTASRLVAAGGKVLVDERDLWPDKKFVITNLLVSTDFLTKHPDVVKQLIKGLVESNKFINANPADAQKAVSDGIEKLTGKPLDAKQTADAWKSITFLDDPLPSTLLDGAKHAQDVGLLDPTDLNGIYDLKLLNEVLKEAGEPEVKV

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
7 2643221548 Streptomyces sp. Root55 Isolate Unclassified
8 2643221578 Streptomyces sp. Root63 Isolate Unclassified
9 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
10 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
11 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
12 2643221647 Streptomyces sp. Root369 Isolate Unclassified
13 2643221670 Streptomyces sp. Root431 Isolate Unclassified
14 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
15 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
16 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
17 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
18 2643221714 Streptomyces sp. Root264 Isolate Unclassified
19 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
20 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
21 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
22 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
23 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
24 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
25 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
26 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
27 2808606448 Streptomyces sp. 193411 Isolate Unclassified
28 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
29 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
30 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
31 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
32 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
33 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
34 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
35 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
36 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
37 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
38 2862574272 Streptomyces sp. AcE210 Isolate Nodule
39 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
40 2867428634 Streptomyces sp. RP5T Isolate Unclassified
41 2867475112 Streptomyces sp. TM32 Isolate Unclassified
42 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
43 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
44 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
45 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
46 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
47 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
48 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
49 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
50 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
51 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
52 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
53 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
54 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
55 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
56 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
57 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
58 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
59 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
60 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
61 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
62 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
63 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
64 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
65 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
66 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
67 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
68 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
69 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
70 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
71 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
72 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
73 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
74 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
75 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
76 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
77 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
78 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
79 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
80 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
121 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
128 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
129 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
130 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
131 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
134 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
135 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
136 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
137 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
138 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
139 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
140 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
141 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
142 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
143 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
144 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
145 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
146 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
184 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
191 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
194 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
209 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
210 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
222 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
223 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
275 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
276 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
277 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
278 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
279 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
280 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
281 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
282 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
288 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
289 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
290 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
291 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
292 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
293 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
294 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
295 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
296 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
297 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
298 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
299 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
300 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
301 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
302 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
303 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.16
Metatranscriptomes 0.2
Isolates 19.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.27
Nodule 0.79
Rhizoplane 1.57
Rhizosphere 76.62
Stem 0
Stem Tuber 0
Unclassified 13.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10016889 3300001990 Bacteria 2354
2 JGI24738J21930_10008052 3300002075 Bacteria 2407
3 rootL2_10002140 3300003322 Bacteria 2605
4 rootH1_10041474 3300003323 Bacteria 4654
5 Ga0058861_11349195 3300004800 Bacteria 1506
6 Ga0070706_100000904 3300005467 Bacteria 32476
7 Ga0070717_10000207 3300006028 Bacteria 41225
8 Ga0075368_10000160 3300006042 Bacteria 18147
9 Ga0075368_10001601 3300006042 Bacteria 7275
10 Ga0075363_100029981 3300006048 Bacteria 2812
11 Ga0075363_100038348 3300006048 Bacteria 2520
12 Ga0075367_10000376 3300006178 Bacteria 16120
13 Ga0075367_10004295 3300006178 Bacteria 6926
14 Ga0075367_10113447 3300006178 Bacteria 1665
15 Ga0075370_10019283 3300006353 Bacteria 3714
16 Ga0099826_10075210 3300006948 Bacteria 2126
17 Ga0105251_10001559 3300009011 Bacteria 19639
18 Ga0105251_10046888 3300009011 Bacteria 2078
19 Ga0105250_10038535 3300009092 Bacteria 1916
20 Ga0105245_10515546 3300009098 Bacteria 1213
21 Ga0114129_10922588 3300009147 Bacteria 1105
22 Ga0105239_10324232 3300010375 Bacteria 1737
23 Ga0105246_10012579 3300011119 Bacteria 5285
24 Ga0157372_10277362 3300013307 Bacteria 1949
25 Ga0163163_10286826 3300014325 Bacteria 1698
26 Ga0182008_10000638 3300014497 Bacteria 25605
27 Ga0182007_10002397 3300015262 Bacteria 9368
28 Ga0183367_1001 3300015688 Bacteria 1225545
29 Ga0213875_10043022 3300021388 Bacteria 2121
30 Ga0209758_1003936 3300025297 Bacteria 12917
31 Ga0207426_1001177 3300025302 Bacteria 23399
32 Ga0207426_1002393 3300025302 Bacteria 12086
33 Ga0207426_1004988 3300025302 Bacteria 6249
34 Ga0207426_1007077 3300025302 Bacteria 4750
35 Ga0209051_1048492 3300025303 Bacteria 1439
36 Ga0207713_1003026 3300025735 Bacteria 11727
37 Ga0207684_10001528 3300025910 Bacteria 24761
38 Ga0207646_10103112 3300025922 Bacteria 2558
39 Ga0207639_10178164 3300026041 Bacteria 1806
40 Ga0207674_10189363 3300026116 Bacteria 2007
41 Ga0209371_1010719 3300027312 Bacteria 2788
42 Ga0209813_10000954 3300027866 Bacteria 6500
43 Ga0307517_10001330 3300028786 Bacteria 41532
44 Ga0307517_10004423 3300028786 Bacteria 21589
45 Ga0307515_10005358 3300028794 Bacteria 26039
46 Ga0268256_1011500 3300030500 Bacteria 2795
47 Ga0307511_10025158 3300030521 Bacteria 5493
48 Ga0307511_10034416 3300030521 Bacteria 4444
49 Ga0307512_10019335 3300030522 Bacteria 6202
50 Ga0307513_10020355 3300031456 Bacteria 7872
51 Ga0307509_10061480 3300031507 Bacteria 3964
52 Ga0307509_10148662 3300031507 Bacteria 2263
53 Ga0307509_10247178 3300031507 Bacteria 1570
54 Ga0307508_10003642 3300031616 Bacteria 15443
55 Ga0307508_10015847 3300031616 Bacteria 6868
56 Ga0307508_10025355 3300031616 Bacteria 5376
57 Ga0307508_10077824 3300031616 Bacteria 2895
58 Ga0307514_10007049 3300031649 Bacteria 9705
59 Ga0307516_10024881 3300031730 Bacteria 6108
60 Ga0307518_10034682 3300031838 Bacteria 3663
61 Ga0307507_10012766 3300033179 Bacteria 10316
62 Ga0307510_10052284 3300033180 Bacteria 4309
63 Ga0307510_10086725 3300033180 Bacteria 3000
64 Ga0395898_0003539 3300037466 Bacteria 17413
65 Ga0395898_0007192 3300037466 Bacteria 11816
66 Ga0395898_0082686 3300037466 Bacteria 3095
67 Ga0395905_0037417 3300037471 Bacteria 4556
68 Ga0436364_0369741 3300037853 Bacteria 15551
69 Ga0395901_0330350 3300038443 Bacteria 1576
70 Ga0439436_0000749 3300041404 Bacteria 8770
71 Ga0439436_0001359 3300041404 Bacteria 7040
72 Ga0439439_0004682 3300041406 Bacteria 3090
73 Ga0451789_0549449 3300041443 Bacteria 2429
74 Ga0451791_0277072 3300041451 Bacteria 2204
75 Ga0451837_0360886 3300041494 Bacteria 5230
76 Ga0451853_2163501 3300041512 Bacteria 3789
77 Ga0451853_2494226 3300041512 Bacteria 6513
78 Ga0451853_2639340 3300041512 Bacteria 1584
79 Ga0439433_0006478 3300041999 Bacteria 2519
80 Ga0439433_0010115 3300041999 Bacteria 2059
81 Ga0439448_0001874 3300042005 Bacteria 5585
82 Ga0439449_0001033 3300042007 Bacteria 10949
83 Ga0439449_0033221 3300042007 Bacteria 1922
84 Ga0439455_0002903 3300042012 Bacteria 3200
85 Ga0439457_000009 3300042014 Bacteria 41871
86 Ga0439457_000296 3300042014 Bacteria 13769
87 Ga0450894_000028 3300042131 Bacteria 21227
88 Ga0450895_001764 3300042132 Bacteria 1541
89 Ga0450896_000775 3300042133 Bacteria 3588
90 Ga0450898_000057 3300042134 Bacteria 9483
91 Ga0450899_001283 3300042135 Bacteria 2834
92 Ga0450903_000103 3300042138 Bacteria 17935
93 Ga0450903_000364 3300042138 Bacteria 9940
94 Ga0450906_000171 3300042145 Bacteria 12159
95 Ga0439458_0000381 3300042157 Bacteria 11160
96 Ga0439458_0004178 3300042157 Bacteria 3334
97 Ga0450908_003577 3300042184 Bacteria 3026
98 Ga0466969_0000738 3300044656 Bacteria 17688
99 Ga0466969_0009421 3300044656 Bacteria 5176
100 Ga0466969_0010792 3300044656 Bacteria 4840
101 Ga0466972_0015515 3300044658 Bacteria 3807
102 Ga0466972_0018510 3300044658 Bacteria 3483
103 Ga0466965_0000530 3300044683 Bacteria 13704
104 Ga0466965_0034622 3300044683 Bacteria 2471
105 Ga0466966_0000480 3300044684 Bacteria 25684
106 Ga0466966_0035372 3300044684 Bacteria 3227
107 Ga0466966_0044185 3300044684 Bacteria 2853
108 Ga0466966_0049313 3300044684 Bacteria 2682
109 Ga0466961_0000749 3300044693 Bacteria 20317
110 Ga0466961_0002230 3300044693 Bacteria 12066
111 Ga0466961_0028029 3300044693 Bacteria 3622
112 Ga0466961_0129619 3300044693 Bacteria 1581
113 Ga0466963_0000053 3300044694 Bacteria 38770
114 Ga0466963_0005253 3300044694 Bacteria 7563
115 Ga0466971_0000530 3300044719 Bacteria 15092
116 Ga0466971_0003353 3300044719 Bacteria 6841
117 Ga0466968_0047505 3300044735 Bacteria 1825
118 Ga0466970_0000077 3300044765 Bacteria 40147
119 Ga0466957_0000461 3300044842 Bacteria 20154
120 Ga0466960_0054542 3300044901 Bacteria 1941
121 Ga0466959_0002375 3300045049 Bacteria 12004
122 Ga0466959_0011593 3300045049 Bacteria 6335
123 Ga0466958_0000820 3300045836 Bacteria 13725
124 Ga0466967_0008174 3300045976 Bacteria 7639
125 Ga0466967_0013032 3300045976 Bacteria 6399
126 Ga0466967_0242278 3300045976 Bacteria 1720
127 Ga0495592_0000516 3300046454 Bacteria 27942
128 Ga0495592_0005101 3300046454 Bacteria 9674
129 Ga0495592_0010932 3300046454 Bacteria 6849
130 Ga0495603_0001903 3300046455 Bacteria 12314
131 Ga0495603_0003609 3300046455 Bacteria 9200
132 Ga0495603_0005503 3300046455 Bacteria 7553
133 Ga0495603_0013431 3300046455 Bacteria 4953
134 Ga0495603_0018244 3300046455 Bacteria 4244
135 Ga0495603_0029080 3300046455 Bacteria 3333
136 Ga0495603_0033598 3300046455 Bacteria 3086
137 Ga0495629_0000865 3300046459 Bacteria 24384
138 Ga0495629_0000982 3300046459 Bacteria 22889
139 Ga0495629_0008969 3300046459 Bacteria 7343
140 Ga0495629_0024180 3300046459 Bacteria 4326
141 Ga0495629_0107878 3300046459 Bacteria 1942
142 Ga0495629_0124063 3300046459 Bacteria 1799
143 Ga0495651_0001398 3300046462 Bacteria 18703
144 Ga0495651_0001623 3300046462 Bacteria 17420
145 Ga0495653_0001984 3300046463 Bacteria 16098
146 Ga0495580_0004484 3300046472 Bacteria 11732
147 Ga0495580_0041763 3300046472 Bacteria 3269
148 Ga0495582_0000745 3300046473 Bacteria 17987
149 Ga0495605_0009902 3300046474 Bacteria 5345
150 Ga0495639_0021657 3300046475 Bacteria 2815
151 Ga0495662_0000193 3300046476 Bacteria 25028
152 Ga0495662_0001632 3300046476 Bacteria 11161
153 Ga0495662_0025029 3300046476 Bacteria 2882
154 Ga0495662_0050146 3300046476 Bacteria 2014
155 Ga0495662_0052015 3300046476 Bacteria 1977
156 Ga0495664_0007164 3300046477 Bacteria 6181
157 Ga0495585_0006268 3300046492 Bacteria 7401
158 Ga0495585_0057438 3300046492 Bacteria 2147
159 Ga0495585_0084645 3300046492 Bacteria 1715
160 Ga0495594_0000910 3300046499 Bacteria 15347
161 Ga0495594_0023941 3300046499 Bacteria 3275
162 Ga0495594_0030554 3300046499 Bacteria 2916
163 Ga0495583_0047855 3300046506 Bacteria 1964
164 Ga0495606_0054607 3300046507 Bacteria 2586
165 Ga0495608_0002705 3300046511 Bacteria 12731
166 Ga0495616_0011276 3300046513 Bacteria 5130
167 Ga0495618_0081935 3300046514 Bacteria 2061
168 Ga0495618_0171083 3300046514 Bacteria 1382
169 Ga0495620_0012942 3300046515 Bacteria 4288
170 Ga0495628_0038437 3300046516 Bacteria 3831
171 Ga0495630_0105826 3300046517 Bacteria 2130
172 Ga0495631_0036346 3300046518 Bacteria 2199
173 Ga0495643_0005569 3300046522 Bacteria 8477
174 Ga0495643_0011691 3300046522 Bacteria 5329
175 Ga0495648_0102863 3300046524 Bacteria 1572
176 Ga0495666_0001602 3300046526 Bacteria 11137
177 Ga0495652_0008753 3300046529 Bacteria 9212
178 Ga0495652_0011409 3300046529 Bacteria 8037
179 Ga0495652_0019556 3300046529 Bacteria 6028
180 Ga0495652_0046370 3300046529 Bacteria 3732
181 Ga0495665_0003306 3300046531 Bacteria 8737
182 Ga0495640_0001279 3300046533 Bacteria 19733
183 Ga0495640_0008870 3300046533 Bacteria 7859
184 Ga0495640_0014365 3300046533 Bacteria 5996
185 Ga0495640_0057024 3300046533 Bacteria 2666
186 Ga0495587_0002276 3300046536 Bacteria 12855
187 Ga0495609_0015862 3300046538 Bacteria 3519
188 Ga0495597_0021606 3300046542 Bacteria 2990
189 Ga0495597_0037738 3300046542 Bacteria 2169
190 Ga0495645_0028301 3300046543 Bacteria 4072
191 Ga0495645_0036639 3300046543 Bacteria 3575
192 Ga0495622_0017929 3300046557 Bacteria 3296
193 Ga0495633_0045898 3300046558 Bacteria 2068
194 Ga0495667_0002401 3300046559 Bacteria 12523
195 Ga0495634_0022160 3300046642 Bacteria 4477
196 Ga0495611_0001810 3300046648 Bacteria 10249
197 Ga0495611_0019570 3300046648 Bacteria 2907
198 Ga0495625_0017631 3300046660 Bacteria 5587
199 Ga0495625_0037891 3300046660 Bacteria 3532
200 Ga0495625_0075219 3300046660 Bacteria 2363
201 Ga0495635_0008362 3300046663 Bacteria 7224
202 Ga0495635_0015189 3300046663 Bacteria 5386
203 Ga0495661_0025203 3300046665 Bacteria 3844
204 Ga0495588_0006216 3300046674 Bacteria 5368
205 Ga0495588_0086501 3300046674 Bacteria 1639
206 Ga0495657_0005021 3300046675 Bacteria 10512
207 Ga0495657_0014567 3300046675 Bacteria 5769
208 Ga0495657_0022132 3300046675 Bacteria 4557
209 Ga0495623_0014662 3300046679 Bacteria 5068
210 Ga0495623_0063632 3300046679 Bacteria 2309
211 Ga0495623_0119609 3300046679 Bacteria 1587
212 Ga0495623_0127059 3300046679 Bacteria 1530
213 Ga0495646_0005795 3300046680 Bacteria 7836
214 Ga0495646_0081611 3300046680 Bacteria 1883
215 Ga0495658_0014924 3300046683 Bacteria 3979
216 Ga0495658_0044407 3300046683 Bacteria 2490
217 Ga0495613_0001044 3300046689 Bacteria 21114
218 Ga0495613_0001245 3300046689 Bacteria 19433
219 Ga0495613_0001406 3300046689 Bacteria 18341
220 Ga0495613_0002824 3300046689 Bacteria 13032
221 Ga0495613_0003524 3300046689 Bacteria 11721
222 Ga0495613_0012095 3300046689 Bacteria 6414
223 Ga0495613_0111175 3300046689 Bacteria 1974
224 Ga0495613_0176185 3300046689 Bacteria 1516
225 Ga0495624_0094089 3300046690 Bacteria 1847
226 Ga0495624_0212101 3300046690 Bacteria 1174
227 Ga0495671_0002729 3300046692 Bacteria 11057
228 Ga0495671_0107262 3300046692 Bacteria 1364
229 Ga0495649_0038468 3300046694 Bacteria 2624
230 Ga0495589_0033496 3300046794 Bacteria 2580
231 Ga0495600_0001275 3300046809 Bacteria 13919
232 Ga0495600_0082185 3300046809 Bacteria 2102
233 Ga0495600_0082655 3300046809 Bacteria 2095
234 Ga0495660_0001436 3300046810 Bacteria 16320
235 Ga0495581_0001871 3300047315 Bacteria 11774
236 Ga0495581_0006410 3300047315 Bacteria 6829
237 Ga0495581_0022636 3300047315 Bacteria 3640
238 Ga0495581_0152559 3300047315 Bacteria 1350
239 Ga0495604_0000350 3300047317 Bacteria 41392
240 Ga0495604_0001021 3300047317 Bacteria 23344
241 Ga0495604_0008808 3300047317 Bacteria 7975
242 Ga0495604_0009563 3300047317 Bacteria 7668
243 Ga0495604_0035446 3300047317 Bacteria 3940
244 Ga0495636_0009320 3300047318 Bacteria 3864
245 Ga0495636_0045751 3300047318 Bacteria 1825
246 Ga0495672_0045000 3300047320 Bacteria 2645
247 Ga0495676_0001095 3300047321 Bacteria 22965
248 Ga0495676_0002556 3300047321 Bacteria 16196
249 Ga0495676_0002801 3300047321 Bacteria 15701
250 Ga0495676_0003837 3300047321 Bacteria 13668
251 Ga0495676_0040435 3300047321 Bacteria 3848
252 Ga0495676_0063571 3300047321 Bacteria 2875
253 Ga0495676_0088930 3300047321 Bacteria 2315
254 Ga0495680_0009068 3300047322 Bacteria 8981
255 Ga0495687_008873 3300047443 Bacteria 5694
256 Ga0495687_046555 3300047443 Bacteria 1871
257 Ga0495675_0001661 3300047444 Bacteria 13326
258 Ga0495675_0006762 3300047444 Bacteria 7034
259 Ga0495675_0050960 3300047444 Bacteria 2630
260 Ga0495675_0080806 3300047444 Bacteria 2047
261 Ga0495679_031457 3300047446 Bacteria 1712
262 Ga0495685_002783 3300047447 Bacteria 5514
263 Ga0495685_021675 3300047447 Bacteria 2211
264 Ga0495681_0002006 3300047470 Bacteria 14881
265 Ga0495681_0014197 3300047470 Bacteria 4581
266 Ga0495681_0019504 3300047470 Bacteria 3701
267 Ga0495684_0001530 3300047471 Bacteria 18530
268 Ga0495686_0014092 3300047472 Bacteria 5518
269 Ga0495686_0051317 3300047472 Bacteria 2588
270 Ga0495602_0024880 3300048088 Bacteria 5802
271 Ga0495602_0045427 3300048088 Bacteria 3974
272 Ga0495614_0000354 3300048089 Bacteria 18301
273 Ga0495614_0008176 3300048089 Bacteria 4652
274 Ga0495614_0008857 3300048089 Bacteria 4465
275 Ga0495614_0010779 3300048089 Bacteria 4026
276 Ga0495626_0034620 3300048091 Bacteria 2415
277 Ga0496100_0066525 3300048903 Bacteria 2391
278 Ga0496108_0004562 3300048911 Bacteria 11160
279 Ga0496109_0065631 3300048912 Bacteria 3323
280 Ga0496110_0091302 3300048913 Bacteria 2724
281 Ga0496112_0307371 3300048915 Bacteria 1531
282 Ga0496126_0070604 3300048929 Bacteria 3111
283 Ga0495678_037023 3300049459 Bacteria 1986
284 Ga0501031_0001175 3300049568 Bacteria 15939
285 Ga0501032_0002106 3300049569 Bacteria 15701
286 Ga0501032_0009630 3300049569 Bacteria 7000
287 Ga0501032_0021710 3300049569 Bacteria 4461
288 Ga0501032_0038020 3300049569 Bacteria 3279
289 Ga0501033_0001751 3300049570 Bacteria 19000
290 Ga0501033_0002047 3300049570 Bacteria 17529
291 Ga0501033_0003371 3300049570 Bacteria 13184
292 Ga0501033_0011503 3300049570 Bacteria 6774
293 Ga0501033_0018459 3300049570 Bacteria 5269
294 Ga0501033_0030295 3300049570 Bacteria 4066
295 Ga0501033_0122719 3300049570 Bacteria 1884
296 Ga0501033_0129464 3300049570 Bacteria 1829
297 Ga0501034_0001946 3300049571 Bacteria 26168
298 Ga0501034_0002364 3300049571 Bacteria 22917
299 Ga0501034_0010543 3300049571 Bacteria 9621
300 Ga0501034_0013287 3300049571 Bacteria 8484
301 Ga0501034_0024041 3300049571 Bacteria 6200
302 Ga0501034_0027763 3300049571 Bacteria 5755
303 Ga0501034_0037432 3300049571 Bacteria 4912
304 Ga0501034_0045621 3300049571 Bacteria 4428
305 Ga0501034_0279078 3300049571 Bacteria 1610
306 Ga0501036_0001036 3300049572 Bacteria 20979
307 Ga0501036_0003378 3300049572 Bacteria 12749
308 Ga0501036_0013133 3300049572 Bacteria 6879
309 Ga0501036_0014001 3300049572 Bacteria 6666
310 Ga0501036_0061981 3300049572 Bacteria 3167
311 Ga0501036_0127680 3300049572 Bacteria 2147
312 Ga0501037_0000583 3300049573 Bacteria 28693
313 Ga0501037_0119299 3300049573 Bacteria 1897
314 Ga0501037_0171193 3300049573 Bacteria 1543
315 Ga0501038_0011306 3300049574 Bacteria 8149
316 Ga0501038_0017056 3300049574 Bacteria 6568
317 Ga0501038_0045918 3300049574 Bacteria 3789
318 Ga0501038_0081760 3300049574 Bacteria 2721
319 Ga0501038_0086042 3300049574 Bacteria 2642
320 Ga0501038_0116083 3300049574 Bacteria 2212
321 Ga0501039_0006704 3300049575 Bacteria 8757
322 Ga0501039_0013863 3300049575 Bacteria 6167
323 Ga0501039_0029884 3300049575 Bacteria 4198
324 Ga0501040_0003664 3300049576 Bacteria 9951
325 Ga0501041_0002871 3300049577 Bacteria 9860
326 Ga0501042_0047730 3300049578 Bacteria 3053
327 Ga0501042_0146631 3300049578 Bacteria 1701
328 Ga0501043_0002709 3300049579 Bacteria 14837
329 Ga0501043_0006935 3300049579 Bacteria 9034
330 Ga0501043_0015689 3300049579 Bacteria 5938
331 Ga0501043_0220750 3300049579 Bacteria 1466
332 Ga0501046_0001733 3300049580 Bacteria 20807
333 Ga0501046_0010118 3300049580 Bacteria 8117
334 Ga0501046_0075432 3300049580 Bacteria 2614
335 Ga0501047_0000036 3300049581 Bacteria 195504
336 Ga0501047_0003115 3300049581 Bacteria 15734
337 Ga0501047_0010865 3300049581 Bacteria 8606
338 Ga0501047_0020128 3300049581 Bacteria 6406
339 Ga0501047_0042619 3300049581 Bacteria 4385
340 Ga0501047_0077129 3300049581 Bacteria 3206
341 Ga0501047_0123833 3300049581 Bacteria 2465
342 Ga0501047_0126683 3300049581 Bacteria 2434
343 Ga0501048_0004087 3300049582 Bacteria 11114
344 Ga0501048_0025636 3300049582 Bacteria 4297
345 Ga0501067_0002995 3300049583 Bacteria 9322
346 Ga0501068_0002766 3300049584 Bacteria 9318
347 Ga0501068_0042572 3300049584 Bacteria 2731
348 Ga0501069_0003069 3300049585 Bacteria 8556
349 Ga0501070_0004393 3300049586 Bacteria 12109
350 Ga0501070_0005095 3300049586 Bacteria 11198
351 Ga0501070_0006163 3300049586 Bacteria 10220
352 Ga0501070_0059000 3300049586 Bacteria 3181
353 Ga0501070_0091995 3300049586 Bacteria 2510
354 Ga0501071_0001130 3300049587 Bacteria 14911
355 Ga0501072_0000332 3300049588 Bacteria 33590
356 Ga0501073_0220664 3300049589 Bacteria 1309
357 Ga0501074_0003210 3300049590 Bacteria 11537
358 Ga0501076_0007436 3300049592 Bacteria 7974
359 Ga0501079_0001534 3300049741 Bacteria 16336
360 Ga0501080_0023718 3300049742 Bacteria 5684
361 Ga0501080_0032061 3300049742 Bacteria 4899
362 Ga0501083_0000304 3300049744 Bacteria 30994
363 Ga0501035_0003406 3300049822 Bacteria 15212
364 Ga0501035_0007566 3300049822 Bacteria 10150
365 Ga0501035_0008086 3300049822 Bacteria 9801
366 Ga0501035_0028212 3300049822 Bacteria 5123
367 Ga0501035_0055391 3300049822 Bacteria 3540
368 Ga0501035_0059604 3300049822 Bacteria 3399
369 Ga0501035_0183069 3300049822 Bacteria 1804
370 Ga0501044_0002714 3300049823 Bacteria 20128
371 Ga0501044_0002967 3300049823 Bacteria 19278
372 Ga0501044_0005423 3300049823 Bacteria 14168
373 Ga0501044_0013267 3300049823 Bacteria 8920
374 Ga0501044_0023126 3300049823 Bacteria 6616
375 Ga0501044_0052887 3300049823 Bacteria 4180
376 Ga0501044_0056040 3300049823 Bacteria 4047
377 Ga0501044_0335676 3300049823 Bacteria 1433
378 Ga0501045_0008479 3300049824 Bacteria 7164
379 nmdc:mga03n38_13312_c1 3300050490 Bacteria 3120
380 nmdc:mga03n38_15216_c1 3300050490 Bacteria 2966
381 nmdc:mga03n38_63733_c1 3300050490 Bacteria 1685
382 nmdc:mga06z11_13967_c1 3300050494 Bacteria 3542
383 nmdc:mga06z11_2228_c1 3300050494 Bacteria 7375
384 nmdc:mga06z11_3563_c2 3300050494 Bacteria 3585
385 nmdc:mga04h51_365_c1 3300050495 Bacteria 11132
386 nmdc:mga07m45_59688_c1 3300050496 Bacteria 2158
387 nmdc:mga0a205_351854_c1 3300050515 Bacteria 1340
388 Ga0495601_0016834 3300053077 Bacteria 4435
389 Ga0500610_0103602 3300053079 Bacteria 1470
390 Ga0495619_0016225 3300053085 Bacteria 4714
391 Ga0495619_0023735 3300053085 Bacteria 3932
392 Ga0500646_0000558 3300053090 Bacteria 10753
393 Ga0500583_0049983 3300053092 Bacteria 1937
394 Ga0500553_045144 3300053101 Bacteria 2139
395 Ga0500560_000373 3300053107 Bacteria 5957
396 Ga0500628_014993 3300053129 Bacteria 1474
397 Ga0500652_000523 3300053131 Bacteria 13547
398 Ga0500568_0001333 3300053139 Bacteria 16176
399 Ga0500586_051029 3300053145 Bacteria 1427
400 Ga0500600_0007714 3300053149 Bacteria 6476
401 Ga0500600_0042781 3300053149 Bacteria 2608
402 Ga0500616_0019763 3300053153 Bacteria 3792
403 Ga0500634_0071752 3300053161 Bacteria 1810
404 Ga0500634_0111325 3300053161 Bacteria 1350
405 Ga0501084_0006867 3300054114 Bacteria 9370
406 Ga0501082_0001940 3300060353 Bacteria 18203
407 Ga0466962_0000217 3300061719 Bacteria 23834
408 Ga0466962_0007904 3300061719 Bacteria 5099
409 Ga0466962_0053753 3300061719 Bacteria 1924

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025922 Ga0207646_10103112 Ga0207646_101031123 293
2 3300053145 Ga0500586_051029 Ga0500586_051029_380_1381 305
3 3300005467 Ga0070706_100000904 Ga0070706_10000090416 308
4 3300006028 Ga0070717_10000207 Ga0070717_1000020711 308
5 3300009147 Ga0114129_10922588 Ga0114129_109225882 308
6 3300025910 Ga0207684_10001528 Ga0207684_1000152813 308
7 3300050515 nmdc:mga0a205_351854_c1 nmdc:mga0a205_351854_c1_85_1020 308
8 iso_pu_bacteria 2862507626 2862515780 314
9 3300044684 Ga0466966_0035372 Ga0466966_0035372_2206_3156 316
10 3300044719 Ga0466971_0003353 Ga0466971_0003353_965_2095 321
11 3300061719 Ga0466962_0007904 Ga0466962_0007904_1553_2683 321
12 3300028786 Ga0307517_10001330 Ga0307517_1000133022 323
13 3300044656 Ga0466969_0000738 Ga0466969_0000738_1069_2208 326
14 3300044693 Ga0466961_0028029 Ga0466961_0028029_421_1560 326
15 3300045049 Ga0466959_0011593 Ga0466959_0011593_4089_5228 326
16 3300049578 Ga0501042_0146631 Ga0501042_0146631_57_1064 326
17 3300049571 Ga0501034_0027763 Ga0501034_0027763_2583_3728 328
18 3300049574 Ga0501038_0017056 Ga0501038_0017056_5295_6440 328
19 3300049581 Ga0501047_0010865 Ga0501047_0010865_4196_5341 328
20 3300049823 Ga0501044_0013267 Ga0501044_0013267_6776_7921 328
21 3300049570 Ga0501033_0122719 Ga0501033_0122719_551_1696 329
22 3300053092 Ga0500583_0049983 Ga0500583_0049983_299_1318 333
23 3300053090 Ga0500646_0000558 Ga0500646_0000558_5377_6402 335
24 3300049569 Ga0501032_0038020 Ga0501032_0038020_774_1919 336
25 3300049581 Ga0501047_0000036 Ga0501047_0000036_151803_152942 336
26 3300049822 Ga0501035_0059604 Ga0501035_0059604_766_1911 336
27 3300014325 Ga0163163_10286826 Ga0163163_102868262 337
28 3300025297 Ga0209758_1003936 Ga0209758_100393610 337
29 3300025303 Ga0209051_1048492 Ga0209051_10484921 337
30 3300044693 Ga0466961_0129619 Ga0466961_0129619_199_1335 339
31 3300049581 Ga0501047_0020128 Ga0501047_0020128_3593_4726 339
32 3300049584 Ga0501068_0042572 Ga0501068_0042572_1118_2251 339
33 3300046514 Ga0495618_0081935 Ga0495618_0081935_758_1906 340
34 3300046529 Ga0495652_0008753 Ga0495652_0008753_1295_2443 340
35 3300046533 Ga0495640_0014365 Ga0495640_0014365_2472_3620 340
36 3300046689 Ga0495613_0002824 Ga0495613_0002824_9213_10361 340
37 3300047317 Ga0495604_0035446 Ga0495604_0035446_787_1935 340
38 3300047321 Ga0495676_0001095 Ga0495676_0001095_1880_3028 340
39 3300049581 Ga0501047_0126683 Ga0501047_0126683_285_1376 340
40 3300049822 Ga0501035_0183069 Ga0501035_0183069_209_1300 340
41 3300046533 Ga0495640_0008870 Ga0495640_0008870_5674_6768 341
42 3300046689 Ga0495613_0176185 Ga0495613_0176185_102_1196 341
43 3300047317 Ga0495604_0009563 Ga0495604_0009563_766_1860 341
44 3300046533 Ga0495640_0057024 Ga0495640_0057024_1441_2556 343
45 3300046675 Ga0495657_0022132 Ga0495657_0022132_1299_2414 343
46 3300046689 Ga0495613_0012095 Ga0495613_0012095_5195_6310 343
47 3300046690 Ga0495624_0212101 Ga0495624_0212101_34_1149 343
48 3300030521 Ga0307511_10034416 Ga0307511_100344163 344
49 3300031507 Ga0307509_10061480 Ga0307509_100614803 344
50 3300031730 Ga0307516_10024881 Ga0307516_100248813 344
51 3300033180 Ga0307510_10086725 Ga0307510_100867253 344
52 3300047443 Ga0495687_008873 Ga0495687_008873_1242_2354 344
53 3300053139 Ga0500568_0001333 Ga0500568_0001333_9040_10155 344
54 3300021388 Ga0213875_10043022 Ga0213875_100430221 345
55 3300037853 Ga0436364_0369741 Ga0436364_0369741_1383_2546 345
56 3300049570 Ga0501033_0030295 Ga0501033_0030295_1264_2370 345
57 3300049571 Ga0501034_0002364 Ga0501034_0002364_19619_20725 345
58 3300049823 Ga0501044_0002714 Ga0501044_0002714_6443_7555 345
59 3300046679 Ga0495623_0063632 Ga0495623_0063632_1092_2240 346
60 3300047317 Ga0495604_0008808 Ga0495604_0008808_2596_3744 346
61 3300047444 Ga0495675_0050960 Ga0495675_0050960_970_2118 346
62 3300049572 Ga0501036_0014001 Ga0501036_0014001_1697_2842 346
63 3300049568 Ga0501031_0001175 Ga0501031_0001175_13354_14508 347
64 3300049569 Ga0501032_0002106 Ga0501032_0002106_6780_7934 347
65 3300049570 Ga0501033_0001751 Ga0501033_0001751_5070_6224 347
66 3300049571 Ga0501034_0001946 Ga0501034_0001946_10828_11982 347
67 3300049572 Ga0501036_0001036 Ga0501036_0001036_6451_7605 347
68 3300049573 Ga0501037_0000583 Ga0501037_0000583_6488_7642 347
69 3300049574 Ga0501038_0011306 Ga0501038_0011306_703_1857 347
70 3300049575 Ga0501039_0006704 Ga0501039_0006704_703_1857 347
71 3300049576 Ga0501040_0003664 Ga0501040_0003664_90_1244 347
72 3300049577 Ga0501041_0002871 Ga0501041_0002871_2534_3688 347
73 3300049579 Ga0501043_0002709 Ga0501043_0002709_6451_7605 347
74 3300049580 Ga0501046_0001733 Ga0501046_0001733_6279_7433 347
75 3300049581 Ga0501047_0003115 Ga0501047_0003115_7297_8451 347
76 3300049582 Ga0501048_0004087 Ga0501048_0004087_2664_3818 347
77 3300049583 Ga0501067_0002995 Ga0501067_0002995_7330_8484 347
78 3300049584 Ga0501068_0002766 Ga0501068_0002766_837_1991 347
79 3300049585 Ga0501069_0003069 Ga0501069_0003069_3638_4792 347
80 3300049586 Ga0501070_0005095 Ga0501070_0005095_6279_7433 347
81 3300049587 Ga0501071_0001130 Ga0501071_0001130_8163_9317 347
82 3300049588 Ga0501072_0000332 Ga0501072_0000332_18890_20044 347
83 3300049589 Ga0501073_0220664 Ga0501073_0220664_66_1220 347
84 3300049592 Ga0501076_0007436 Ga0501076_0007436_5299_6453 347
85 3300049741 Ga0501079_0001534 Ga0501079_0001534_8163_9317 347
86 3300049742 Ga0501080_0023718 Ga0501080_0023718_766_1920 347
87 3300049744 Ga0501083_0000304 Ga0501083_0000304_25963_27117 347
88 3300049822 Ga0501035_0007566 Ga0501035_0007566_8294_9448 347
89 3300049823 Ga0501044_0002967 Ga0501044_0002967_7297_8451 347
90 3300049824 Ga0501045_0008479 Ga0501045_0008479_394_1548 347
91 3300054114 Ga0501084_0006867 Ga0501084_0006867_703_1857 347
92 3300060353 Ga0501082_0001940 Ga0501082_0001940_14387_15541 347
93 3300046476 Ga0495662_0050146 Ga0495662_0050146_713_1840 348
94 3300046526 Ga0495666_0001602 Ga0495666_0001602_2903_4030 348
95 3300046543 Ga0495645_0036639 Ga0495645_0036639_1090_2217 348
96 3300047315 Ga0495581_0006410 Ga0495581_0006410_4095_5222 348
97 3300049586 Ga0501070_0006163 Ga0501070_0006163_8211_9344 348
98 3300042131 Ga0450894_000028 Ga0450894_000028_6217_7266 349
99 3300042132 Ga0450895_001764 Ga0450895_001764_48_1097 349
100 3300042133 Ga0450896_000775 Ga0450896_000775_2349_3398 349
101 3300042134 Ga0450898_000057 Ga0450898_000057_6595_7644 349
102 3300042135 Ga0450899_001283 Ga0450899_001283_931_1980 349
103 3300042145 Ga0450906_000171 Ga0450906_000171_119_1168 349
104 3300042184 Ga0450908_003577 Ga0450908_003577_1415_2464 349
105 3300047321 Ga0495676_0088930 Ga0495676_0088930_733_1839 349
106 3300053107 Ga0500560_000373 Ga0500560_000373_901_2007 349
107 3300046454 Ga0495592_0005101 Ga0495592_0005101_6993_8048 350
108 3300046529 Ga0495652_0019556 Ga0495652_0019556_4419_5474 350
109 3300046679 Ga0495623_0127059 Ga0495623_0127059_376_1431 350
110 3300047322 Ga0495680_0009068 Ga0495680_0009068_3424_4479 350
111 3300047444 Ga0495675_0080806 Ga0495675_0080806_330_1385 350
112 3300006178 Ga0075367_10113447 Ga0075367_101134472 351
113 3300031616 Ga0307508_10003642 Ga0307508_100036428 351
114 3300046459 Ga0495629_0124063 Ga0495629_0124063_203_1342 351
115 3300046522 Ga0495643_0011691 Ga0495643_0011691_2667_3806 351
116 3300046683 Ga0495658_0044407 Ga0495658_0044407_1040_2179 351
117 3300047470 Ga0495681_0014197 Ga0495681_0014197_914_2053 351
118 3300050494 nmdc:mga06z11_3563_c2 nmdc:mga06z11_3563_c2_491_1603 351
119 3300053129 Ga0500628_014993 Ga0500628_014993_289_1428 351
120 3300053131 Ga0500652_000523 Ga0500652_000523_12100_13239 351
121 3300053149 Ga0500600_0007714 Ga0500600_0007714_299_1438 351
122 3300053153 Ga0500616_0019763 Ga0500616_0019763_326_1465 351
123 3300053161 Ga0500634_0111325 Ga0500634_0111325_200_1339 351
124 3300046454 Ga0495592_0000516 Ga0495592_0000516_16836_17984 352
125 3300047315 Ga0495581_0152559 Ga0495581_0152559_81_1220 352
126 3300047446 Ga0495679_031457 Ga0495679_031457_489_1631 352
127 3300046533 Ga0495640_0001279 Ga0495640_0001279_14450_15532 353
128 3300046680 Ga0495646_0081611 Ga0495646_0081611_585_1667 353
129 3300049570 Ga0501033_0003371 Ga0501033_0003371_9046_10110 353
130 3300026116 Ga0207674_10189363 Ga0207674_101893632 354
131 3300031649 Ga0307514_10007049 Ga0307514_100070495 354
132 3300033180 Ga0307510_10052284 Ga0307510_100522843 354
133 3300041404 Ga0439436_0001359 Ga0439436_0001359_2910_3974 354
134 3300041406 Ga0439439_0004682 Ga0439439_0004682_269_1333 354
135 3300041999 Ga0439433_0006478 Ga0439433_0006478_265_1329 354
136 3300042014 Ga0439457_000296 Ga0439457_000296_7024_8088 354
137 3300031507 Ga0307509_10247178 Ga0307509_102471782 355
138 3300044656 Ga0466969_0009421 Ga0466969_0009421_2250_3317 355
139 3300044683 Ga0466965_0000530 Ga0466965_0000530_2536_3603 355
140 3300044684 Ga0466966_0000480 Ga0466966_0000480_22230_23297 355
141 3300044693 Ga0466961_0000749 Ga0466961_0000749_4327_5394 355
142 3300044694 Ga0466963_0000053 Ga0466963_0000053_3388_4455 355
143 3300044719 Ga0466971_0000530 Ga0466971_0000530_7438_8505 355
144 3300044765 Ga0466970_0000077 Ga0466970_0000077_2663_3730 355
145 3300044842 Ga0466957_0000461 Ga0466957_0000461_5701_6768 355
146 3300044901 Ga0466960_0054542 Ga0466960_0054542_138_1205 355
147 3300045049 Ga0466959_0002375 Ga0466959_0002375_6086_7153 355
148 3300045836 Ga0466958_0000820 Ga0466958_0000820_4327_5394 355
149 3300045976 Ga0466967_0008174 Ga0466967_0008174_4546_5613 355
150 3300046492 Ga0495585_0006268 Ga0495585_0006268_4828_5925 355
151 3300061719 Ga0466962_0000217 Ga0466962_0000217_14341_15408 355
152 iso_pu_bacteria 3006321560 3006327162 355
153 3300014497 Ga0182008_10000638 Ga0182008_1000063813 356
154 3300015262 Ga0182007_10002397 Ga0182007_1000239710 356
155 3300044656 Ga0466969_0010792 Ga0466969_0010792_3173_4243 356
156 3300044658 Ga0466972_0015515 Ga0466972_0015515_218_1330 356
157 3300044658 Ga0466972_0018510 Ga0466972_0018510_765_1835 356
158 3300044683 Ga0466965_0034622 Ga0466965_0034622_760_1830 356
159 3300044684 Ga0466966_0044185 Ga0466966_0044185_525_1595 356
160 3300044693 Ga0466961_0002230 Ga0466961_0002230_3384_4454 356
161 3300044735 Ga0466968_0047505 Ga0466968_0047505_394_1464 356
162 3300049571 Ga0501034_0045621 Ga0501034_0045621_2461_3576 356
163 3300049574 Ga0501038_0116083 Ga0501038_0116083_769_1884 356
164 iso_pu_bacteria 2808606375 2808917179 356
165 3300049823 Ga0501044_0005423 Ga0501044_0005423_1534_2607 357
166 3300049823 Ga0501044_0335676 Ga0501044_0335676_159_1307 357
167 iso_pu_bacteria 2582581313 2585311712 357
168 3300009098 Ga0105245_10515546 Ga0105245_105155461 358
169 iso_pu_bacteria 2811994917 2812478200 358
170 iso_pu_bacteria 8056447290 8056449463 358
171 3300049581 Ga0501047_0123833 Ga0501047_0123833_1095_2222 359
172 3300061719 Ga0466962_0053753 Ga0466962_0053753_109_1218 359
173 3300046522 Ga0495643_0005569 Ga0495643_0005569_4125_5240 360
174 3300047320 Ga0495672_0045000 Ga0495672_0045000_757_1872 360
175 3300047443 Ga0495687_046555 Ga0495687_046555_267_1382 360
176 iso_pu_bacteria 2818991463 2819698324 360
177 iso_pu_bacteria 2867475112 2867476541 360
178 iso_pu_bacteria 2997451912 2997459433 360
179 iso_pu_bacteria 8025478263 8025479876 360
180 iso_pu_bacteria 8054160619 8054163092 360
181 3300009011 Ga0105251_10001559 Ga0105251_100015596 361
182 3300025735 Ga0207713_1003026 Ga0207713_10030266 361
183 3300030521 Ga0307511_10025158 Ga0307511_100251583 361
184 3300046455 Ga0495603_0029080 Ga0495603_0029080_329_1423 361
185 3300046455 Ga0495603_0033598 Ga0495603_0033598_1324_2430 361
186 3300046459 Ga0495629_0000982 Ga0495629_0000982_14403_15509 361
187 3300046473 Ga0495582_0000745 Ga0495582_0000745_5988_7094 361
188 3300046476 Ga0495662_0001632 Ga0495662_0001632_5092_6198 361
189 3300046689 Ga0495613_0001044 Ga0495613_0001044_14481_15587 361
190 3300046689 Ga0495613_0001406 Ga0495613_0001406_15891_16985 361
191 3300047315 Ga0495581_0001871 Ga0495581_0001871_7172_8278 361
192 3300047321 Ga0495676_0002556 Ga0495676_0002556_13438_14532 361
193 3300048089 Ga0495614_0000354 Ga0495614_0000354_6373_7467 361
194 3300048089 Ga0495614_0010779 Ga0495614_0010779_1105_2211 361
195 3300048903 Ga0496100_0066525 Ga0496100_0066525_326_1432 361
196 3300048911 Ga0496108_0004562 Ga0496108_0004562_663_1769 361
197 3300048913 Ga0496110_0091302 Ga0496110_0091302_1398_2504 361
198 3300048915 Ga0496112_0307371 Ga0496112_0307371_247_1353 361
199 3300048929 Ga0496126_0070604 Ga0496126_0070604_1574_2680 361
200 iso_pu_bacteria 2643221587 2643943278 361
201 iso_pu_bacteria 2643221670 2644388258 361
202 iso_pu_bacteria 2643221677 2644430746 361
203 iso_pu_bacteria 2808606375 2808916638 361
204 iso_pu_bacteria 2808606982 2811843752 361
205 iso_pu_bacteria 2818991472 2819743426 361
206 iso_pu_bacteria 2862178590 2862182430 361
207 iso_pu_bacteria 2867428634 2867430029 361
208 iso_pu_bacteria 2918501144 2918507264 361
209 iso_pu_bacteria 2954682443 2954691455 361
210 iso_pu_bacteria 3006425503 3006427178 361
211 iso_pu_bacteria 8056667051 8056667122 361
212 3300025302 Ga0207426_1007077 Ga0207426_10070772 362
213 3300031616 Ga0307508_10015847 Ga0307508_100158473 362
214 iso_pu_bacteria 2643221601 2644014104 362
215 iso_pu_bacteria 2643221631 2644175502 362
216 iso_pu_bacteria 2643221714 2644629741 362
217 iso_pu_bacteria 2802429296 2804848671 362
218 iso_pu_bacteria 2862574272 2862576724 362
219 iso_pu_bacteria 2912715099 2912716830 362
220 iso_pu_bacteria 2912723979 2912729434 362
221 iso_pu_bacteria 2912757875 2912763667 362
222 iso_pu_bacteria 2946072368 2946072827 362
223 iso_pu_bacteria 2966598605 2966600091 362
224 iso_pu_bacteria 8025413630 8025417650 362
225 iso_pu_bacteria 8025530807 8025532849 362
226 3300025302 Ga0207426_1001177 Ga0207426_100117711 363
227 3300025302 Ga0207426_1002393 Ga0207426_100239310 363
228 3300025302 Ga0207426_1004988 Ga0207426_10049885 363
229 3300046462 Ga0495651_0001623 Ga0495651_0001623_12363_13487 363
230 3300046463 Ga0495653_0001984 Ga0495653_0001984_6029_7153 363
231 3300046472 Ga0495580_0004484 Ga0495580_0004484_2631_3755 363
232 3300046511 Ga0495608_0002705 Ga0495608_0002705_5183_6307 363
233 3300046529 Ga0495652_0011409 Ga0495652_0011409_287_1411 363
234 3300046531 Ga0495665_0003306 Ga0495665_0003306_46_1170 363
235 3300046536 Ga0495587_0002276 Ga0495587_0002276_1919_3043 363
236 3300046559 Ga0495667_0002401 Ga0495667_0002401_5103_6227 363
237 3300046642 Ga0495634_0022160 Ga0495634_0022160_3179_4303 363
238 3300046663 Ga0495635_0015189 Ga0495635_0015189_3976_5100 363
239 3300046675 Ga0495657_0005021 Ga0495657_0005021_4975_6099 363
240 3300046679 Ga0495623_0014662 Ga0495623_0014662_3934_5058 363
241 3300046689 Ga0495613_0003524 Ga0495613_0003524_6425_7549 363
242 3300046809 Ga0495600_0001275 Ga0495600_0001275_8822_9946 363
243 3300047317 Ga0495604_0001021 Ga0495604_0001021_18287_19411 363
244 3300047444 Ga0495675_0001661 Ga0495675_0001661_4975_6099 363
245 3300047471 Ga0495684_0001530 Ga0495684_0001530_5901_7025 363
246 3300048088 Ga0495602_0024880 Ga0495602_0024880_1996_3120 363
247 3300053077 Ga0495601_0016834 Ga0495601_0016834_1995_3119 363
248 3300053085 Ga0495619_0016225 Ga0495619_0016225_2171_3295 363
249 iso_pu_bacteria 2547132111 2547407537 363
250 iso_pu_bacteria 2582581312 2585298718 363
251 iso_pu_bacteria 2616644941 2616902475 363
252 iso_pu_bacteria 2643221548 2643761852 363
253 iso_pu_bacteria 2643221578 2643904068 363
254 iso_pu_bacteria 2643221647 2644264741 363
255 iso_pu_bacteria 2643221673 2644402423 363
256 iso_pu_bacteria 2643221682 2644460721 363
257 iso_pu_bacteria 2784132148 2784591254 363
258 iso_pu_bacteria 2786546132 2786673469 363
259 iso_pu_bacteria 2808606448 2809234826 363
260 iso_pu_bacteria 2811994879 2812355182 363
261 iso_pu_bacteria 2811994917 2812477915 363
262 iso_pu_bacteria 2818991463 2819699515 363
263 iso_pu_bacteria 2862281513 2862283744 363
264 iso_pu_bacteria 2862507626 2862511091 363
265 iso_pu_bacteria 2867428634 2867432175 363
266 iso_pu_bacteria 2875391855 2875397445 363
267 iso_pu_bacteria 2946045630 2946047064 363
268 iso_pu_bacteria 2946064051 2946070710 363
269 iso_pu_bacteria 2947224130 2947226086 363
270 iso_pu_bacteria 2954380949 2954383231 363
271 iso_pu_bacteria 2954673503 2954679774 363
272 iso_pu_bacteria 2954682443 2954684379 363
273 iso_pu_bacteria 2954691527 2954693941 363
274 iso_pu_bacteria 2954701450 2954709047 363
275 iso_pu_bacteria 2954711539 2954713552 363
276 iso_pu_bacteria 2954721474 2954723515 363
277 iso_pu_bacteria 2954731030 2954738315 363
278 iso_pu_bacteria 2954740390 2954742420 363
279 iso_pu_bacteria 2954749733 2954757176 363
280 iso_pu_bacteria 2954759201 2954761389 363
281 iso_pu_bacteria 3006486233 3006493745 363
282 iso_pu_bacteria 3006493962 3006500678 363
283 iso_pu_bacteria 8023623736 8023630246 363
284 3300004800 Ga0058861_11349195 Ga0058861_113491951 364
285 3300006042 Ga0075368_10001601 Ga0075368_100016013 364
286 3300006178 Ga0075367_10000376 Ga0075367_1000037612 364
287 3300026041 Ga0207639_10178164 Ga0207639_101781642 364
288 3300027866 Ga0209813_10000954 Ga0209813_100009543 364
289 3300037466 Ga0395898_0007192 Ga0395898_0007192_4310_5416 364
290 3300042007 Ga0439449_0001033 Ga0439449_0001033_858_1964 364
291 3300042138 Ga0450903_000103 Ga0450903_000103_666_1772 364
292 3300042157 Ga0439458_0004178 Ga0439458_0004178_953_2059 364
293 3300046455 Ga0495603_0003609 Ga0495603_0003609_6218_7330 364
294 3300046455 Ga0495603_0005503 Ga0495603_0005503_6282_7397 364
295 3300046455 Ga0495603_0013431 Ga0495603_0013431_438_1544 364
296 3300046459 Ga0495629_0000865 Ga0495629_0000865_11960_13072 364
297 3300046459 Ga0495629_0008969 Ga0495629_0008969_3046_4152 364
298 3300046475 Ga0495639_0021657 Ga0495639_0021657_218_1324 364
299 3300046476 Ga0495662_0025029 Ga0495662_0025029_668_1774 364
300 3300046492 Ga0495585_0057438 Ga0495585_0057438_272_1387 364
301 3300046499 Ga0495594_0000910 Ga0495594_0000910_8262_9374 364
302 3300046674 Ga0495588_0086501 Ga0495588_0086501_166_1272 364
303 3300047321 Ga0495676_0003837 Ga0495676_0003837_8353_9465 364
304 3300047321 Ga0495676_0063571 Ga0495676_0063571_1298_2413 364
305 3300047447 Ga0495685_021675 Ga0495685_021675_810_1916 364
306 3300049823 Ga0501044_0056040 Ga0501044_0056040_2000_3106 364
307 3300050494 nmdc:mga06z11_13967_c1 nmdc:mga06z11_13967_c1_1686_2795 364
308 3300050495 nmdc:mga04h51_365_c1 nmdc:mga04h51_365_c1_8754_9863 364
309 iso_pu_bacteria 2582581313 2585311707 364
310 iso_pu_bacteria 2784746763 2785340432 364
311 iso_pu_bacteria 2784746768 2785372332 364
312 iso_pu_bacteria 2852635781 2852638686 364
313 iso_pu_bacteria 2862382967 2862384902 364
314 iso_pu_bacteria 2863404153 2863409413 364
315 iso_pu_bacteria 2877676314 2877678318 364
316 iso_pu_bacteria 2935390628 2935391207 364
317 iso_pu_bacteria 2990059506 2990067582 364
318 iso_pu_bacteria 3006393351 3006393644 364
319 iso_pu_bacteria 8008558824 8008563697 364
320 iso_pu_bacteria 8048406513 8048411747 364
321 iso_pu_bacteria 8056829672 8056829815 364
322 3300031507 Ga0307509_10148662 Ga0307509_101486622 365
323 3300041494 Ga0451837_0360886 Ga0451837_0360886_798_1901 365
324 3300046492 Ga0495585_0084645 Ga0495585_0084645_398_1513 365
325 3300046648 Ga0495611_0019570 Ga0495611_0019570_20_1135 365
326 3300046794 Ga0495589_0033496 Ga0495589_0033496_1177_2292 365
327 3300049569 Ga0501032_0021710 Ga0501032_0021710_911_2029 365
328 3300049570 Ga0501033_0002047 Ga0501033_0002047_14416_15519 365
329 3300049570 Ga0501033_0018459 Ga0501033_0018459_2033_3166 365
330 3300049570 Ga0501033_0129464 Ga0501033_0129464_213_1331 365
331 3300049571 Ga0501034_0024041 Ga0501034_0024041_2105_3238 365
332 3300049571 Ga0501034_0037432 Ga0501034_0037432_1162_2280 365
333 3300049572 Ga0501036_0013133 Ga0501036_0013133_5665_6798 365
334 3300049572 Ga0501036_0127680 Ga0501036_0127680_861_1979 365
335 3300049573 Ga0501037_0119299 Ga0501037_0119299_74_1207 365
336 3300049573 Ga0501037_0171193 Ga0501037_0171193_388_1506 365
337 3300049574 Ga0501038_0086042 Ga0501038_0086042_393_1511 365
338 3300049575 Ga0501039_0029884 Ga0501039_0029884_1569_2702 365
339 3300049578 Ga0501042_0047730 Ga0501042_0047730_504_1622 365
340 3300049579 Ga0501043_0015689 Ga0501043_0015689_3932_5065 365
341 3300049579 Ga0501043_0220750 Ga0501043_0220750_65_1183 365
342 3300049580 Ga0501046_0010118 Ga0501046_0010118_6606_7724 365
343 3300049581 Ga0501047_0077129 Ga0501047_0077129_1679_2797 365
344 3300049582 Ga0501048_0025636 Ga0501048_0025636_2456_3574 365
345 3300049822 Ga0501035_0028212 Ga0501035_0028212_3831_4964 365
346 3300049823 Ga0501044_0052887 Ga0501044_0052887_1427_2560 365
347 iso_pu_bacteria 2582581314 2585316661 365
348 iso_pu_bacteria 2616644814 2616699793 365
349 iso_pu_bacteria 2643221678 2644442591 365
350 iso_pu_bacteria 2643221714 2644626736 365
351 iso_pu_bacteria 2808606359 2808844767 365
352 iso_pu_bacteria 2919468124 2919472736 365
353 iso_pu_bacteria 2946072368 2946078427 365
354 iso_pu_bacteria 2954002825 2954010258 365
355 iso_pu_bacteria 8008574985 8008576435 365
356 iso_pu_bacteria 8048127548 8048132480 365
357 3300006042 Ga0075368_10000160 Ga0075368_1000016016 366
358 3300006048 Ga0075363_100038348 Ga0075363_1000383482 366
359 3300006178 Ga0075367_10004295 Ga0075367_100042956 366
360 3300006353 Ga0075370_10019283 Ga0075370_100192834 366
361 3300006948 Ga0099826_10075210 Ga0099826_100752103 366
362 3300009011 Ga0105251_10046888 Ga0105251_100468882 366
363 3300041451 Ga0451791_0277072 Ga0451791_0277072_40_1149 366
364 3300042005 Ga0439448_0001874 Ga0439448_0001874_3987_5090 366
365 3300042012 Ga0439455_0002903 Ga0439455_0002903_1717_2820 366
366 3300042138 Ga0450903_000364 Ga0450903_000364_3385_4488 366
367 3300042157 Ga0439458_0000381 Ga0439458_0000381_6447_7550 366
368 3300044694 Ga0466963_0005253 Ga0466963_0005253_3805_4932 366
369 3300046542 Ga0495597_0037738 Ga0495597_0037738_97_1227 366
370 3300046648 Ga0495611_0001810 Ga0495611_0001810_6409_7539 366
371 3300046660 Ga0495625_0037891 Ga0495625_0037891_1186_2316 366
372 3300046660 Ga0495625_0075219 Ga0495625_0075219_887_1993 366
373 3300046810 Ga0495660_0001436 Ga0495660_0001436_14228_15358 366
374 3300047447 Ga0495685_002783 Ga0495685_002783_2778_3881 366
375 3300049822 Ga0501035_0008086 Ga0501035_0008086_8307_9440 366
376 3300049823 Ga0501044_0023126 Ga0501044_0023126_5170_6303 366
377 3300050490 nmdc:mga03n38_13312_c1 nmdc:mga03n38_13312_c1_965_2068 366
378 3300050494 nmdc:mga06z11_2228_c1 nmdc:mga06z11_2228_c1_4771_5874 366
379 3300050496 nmdc:mga07m45_59688_c1 nmdc:mga07m45_59688_c1_144_1247 366
380 3300053149 Ga0500600_0042781 Ga0500600_0042781_554_1657 366
381 iso_pu_bacteria 2873151551 2873153346 366
382 3300006048 Ga0075363_100029981 Ga0075363_1000299813 367
383 3300027312 Ga0209371_1010719 Ga0209371_10107193 367
384 3300030500 Ga0268256_1011500 Ga0268256_10115003 367
385 3300030522 Ga0307512_10019335 Ga0307512_100193354 367
386 3300031616 Ga0307508_10025355 Ga0307508_100253552 367
387 3300037466 Ga0395898_0003539 Ga0395898_0003539_3579_4688 367
388 3300037466 Ga0395898_0082686 Ga0395898_0082686_381_1490 367
389 3300037471 Ga0395905_0037417 Ga0395905_0037417_1167_2276 367
390 3300038443 Ga0395901_0330350 Ga0395901_0330350_282_1391 367
391 3300041404 Ga0439436_0000749 Ga0439436_0000749_3274_4383 367
392 3300041512 Ga0451853_2494226 Ga0451853_2494226_4903_6012 367
393 3300041999 Ga0439433_0010115 Ga0439433_0010115_88_1197 367
394 3300042007 Ga0439449_0033221 Ga0439449_0033221_149_1258 367
395 3300042014 Ga0439457_000009 Ga0439457_000009_19669_20778 367
396 3300045976 Ga0466967_0013032 Ga0466967_0013032_4019_5128 367
397 3300046459 Ga0495629_0024180 Ga0495629_0024180_1528_2646 367
398 3300046675 Ga0495657_0014567 Ga0495657_0014567_1327_2445 367
399 3300046689 Ga0495613_0111175 Ga0495613_0111175_295_1398 367
400 3300046809 Ga0495600_0082185 Ga0495600_0082185_602_1720 367
401 3300047318 Ga0495636_0045751 Ga0495636_0045751_455_1564 367
402 3300048912 Ga0496109_0065631 Ga0496109_0065631_829_1947 367
403 3300049569 Ga0501032_0009630 Ga0501032_0009630_1904_3052 367
404 3300049571 Ga0501034_0013287 Ga0501034_0013287_5518_6666 367
405 3300049572 Ga0501036_0061981 Ga0501036_0061981_1381_2526 367
406 3300049574 Ga0501038_0045918 Ga0501038_0045918_858_2006 367
407 3300049580 Ga0501046_0075432 Ga0501046_0075432_1095_2222 367
408 3300049581 Ga0501047_0042619 Ga0501047_0042619_1552_2700 367
409 3300049586 Ga0501070_0059000 Ga0501070_0059000_1046_2194 367
410 3300049586 Ga0501070_0091995 Ga0501070_0091995_943_2058 367
411 3300049742 Ga0501080_0032061 Ga0501080_0032061_552_1667 367
412 3300049822 Ga0501035_0055391 Ga0501035_0055391_1551_2699 367
413 3300050490 nmdc:mga03n38_15216_c1 nmdc:mga03n38_15216_c1_892_1995 367
414 3300050490 nmdc:mga03n38_63733_c1 nmdc:mga03n38_63733_c1_59_1168 367
415 iso_pu_bacteria 2791355406 2793984924 367
416 iso_pu_bacteria 2997600082 2997602035 367
417 iso_pu_bacteria 8047893842 8047895446 367
418 iso_pu_bacteria 8048356638 8048363508 367
419 iso_pu_bacteria 8048369669 8048372471 367
420 iso_pu_bacteria 8048379754 8048381405 367
421 3300001990 JGI24737J22298_10016889 JGI24737J22298_100168892 368
422 3300002075 JGI24738J21930_10008052 JGI24738J21930_100080524 368
423 3300003322 rootL2_10002140 rootL2_100021402 368
424 3300003323 rootH1_10041474 rootH1_100414744 368
425 3300009092 Ga0105250_10038535 Ga0105250_100385351 368
426 3300010375 Ga0105239_10324232 Ga0105239_103242323 368
427 3300011119 Ga0105246_10012579 Ga0105246_100125793 368
428 3300013307 Ga0157372_10277362 Ga0157372_102773621 368
429 3300015688 Ga0183367_1001 Ga0183367_1001292 368
430 3300028786 Ga0307517_10004423 Ga0307517_100044237 368
431 3300028794 Ga0307515_10005358 Ga0307515_100053588 368
432 3300031456 Ga0307513_10020355 Ga0307513_100203557 368
433 3300031616 Ga0307508_10077824 Ga0307508_100778243 368
434 3300031838 Ga0307518_10034682 Ga0307518_100346823 368
435 3300033179 Ga0307507_10012766 Ga0307507_100127664 368
436 3300041443 Ga0451789_0549449 Ga0451789_0549449_60_1172 368
437 3300041512 Ga0451853_2163501 Ga0451853_2163501_753_1865 368
438 3300041512 Ga0451853_2639340 Ga0451853_2639340_256_1368 368
439 3300044684 Ga0466966_0049313 Ga0466966_0049313_666_1778 368
440 3300045976 Ga0466967_0242278 Ga0466967_0242278_567_1685 368
441 3300046454 Ga0495592_0010932 Ga0495592_0010932_2127_3239 368
442 3300046455 Ga0495603_0001903 Ga0495603_0001903_5384_6505 368
443 3300046455 Ga0495603_0018244 Ga0495603_0018244_1467_2582 368
444 3300046459 Ga0495629_0107878 Ga0495629_0107878_752_1867 368
445 3300046462 Ga0495651_0001398 Ga0495651_0001398_15408_16520 368
446 3300046472 Ga0495580_0041763 Ga0495580_0041763_25_1140 368
447 3300046474 Ga0495605_0009902 Ga0495605_0009902_2205_3320 368
448 3300046476 Ga0495662_0000193 Ga0495662_0000193_2218_3330 368
449 3300046476 Ga0495662_0052015 Ga0495662_0052015_678_1799 368
450 3300046477 Ga0495664_0007164 Ga0495664_0007164_1974_3086 368
451 3300046499 Ga0495594_0023941 Ga0495594_0023941_729_1844 368
452 3300046499 Ga0495594_0030554 Ga0495594_0030554_266_1387 368
453 3300046506 Ga0495583_0047855 Ga0495583_0047855_471_1586 368
454 3300046507 Ga0495606_0054607 Ga0495606_0054607_1110_2225 368
455 3300046513 Ga0495616_0011276 Ga0495616_0011276_895_2010 368
456 3300046514 Ga0495618_0171083 Ga0495618_0171083_202_1314 368
457 3300046515 Ga0495620_0012942 Ga0495620_0012942_1042_2157 368
458 3300046516 Ga0495628_0038437 Ga0495628_0038437_1037_2149 368
459 3300046517 Ga0495630_0105826 Ga0495630_0105826_875_1987 368
460 3300046518 Ga0495631_0036346 Ga0495631_0036346_614_1729 368
461 3300046524 Ga0495648_0102863 Ga0495648_0102863_279_1394 368
462 3300046529 Ga0495652_0046370 Ga0495652_0046370_578_1690 368
463 3300046538 Ga0495609_0015862 Ga0495609_0015862_1616_2731 368
464 3300046542 Ga0495597_0021606 Ga0495597_0021606_374_1489 368
465 3300046543 Ga0495645_0028301 Ga0495645_0028301_1537_2649 368
466 3300046557 Ga0495622_0017929 Ga0495622_0017929_471_1586 368
467 3300046558 Ga0495633_0045898 Ga0495633_0045898_225_1346 368
468 3300046660 Ga0495625_0017631 Ga0495625_0017631_2461_3573 368
469 3300046663 Ga0495635_0008362 Ga0495635_0008362_3658_4770 368
470 3300046665 Ga0495661_0025203 Ga0495661_0025203_868_1983 368
471 3300046674 Ga0495588_0006216 Ga0495588_0006216_2321_3433 368
472 3300046679 Ga0495623_0119609 Ga0495623_0119609_110_1222 368
473 3300046680 Ga0495646_0005795 Ga0495646_0005795_2332_3444 368
474 3300046683 Ga0495658_0014924 Ga0495658_0014924_1734_2846 368
475 3300046689 Ga0495613_0001245 Ga0495613_0001245_4539_5651 368
476 3300046690 Ga0495624_0094089 Ga0495624_0094089_474_1589 368
477 3300046692 Ga0495671_0002729 Ga0495671_0002729_7947_9059 368
478 3300046692 Ga0495671_0107262 Ga0495671_0107262_212_1327 368
479 3300046694 Ga0495649_0038468 Ga0495649_0038468_363_1478 368
480 3300046809 Ga0495600_0082655 Ga0495600_0082655_262_1374 368
481 3300047315 Ga0495581_0022636 Ga0495581_0022636_887_1999 368
482 3300047317 Ga0495604_0000350 Ga0495604_0000350_38508_39620 368
483 3300047318 Ga0495636_0009320 Ga0495636_0009320_546_1661 368
484 3300047321 Ga0495676_0002801 Ga0495676_0002801_12110_13222 368
485 3300047321 Ga0495676_0040435 Ga0495676_0040435_1023_2138 368
486 3300047444 Ga0495675_0006762 Ga0495675_0006762_4375_5487 368
487 3300047470 Ga0495681_0002006 Ga0495681_0002006_11057_12169 368
488 3300047470 Ga0495681_0019504 Ga0495681_0019504_586_1701 368
489 3300047472 Ga0495686_0014092 Ga0495686_0014092_3939_5054 368
490 3300047472 Ga0495686_0051317 Ga0495686_0051317_301_1413 368
491 3300048088 Ga0495602_0045427 Ga0495602_0045427_1053_2165 368
492 3300048089 Ga0495614_0008176 Ga0495614_0008176_1414_2526 368
493 3300048089 Ga0495614_0008857 Ga0495614_0008857_1123_2235 368
494 3300048091 Ga0495626_0034620 Ga0495626_0034620_958_2073 368
495 3300049459 Ga0495678_037023 Ga0495678_037023_520_1635 368
496 3300049570 Ga0501033_0011503 Ga0501033_0011503_2327_3475 368
497 3300049571 Ga0501034_0010543 Ga0501034_0010543_1211_2359 368
498 3300049571 Ga0501034_0279078 Ga0501034_0279078_270_1418 368
499 3300049572 Ga0501036_0003378 Ga0501036_0003378_11226_12374 368
500 3300049574 Ga0501038_0081760 Ga0501038_0081760_1017_2165 368
501 3300049575 Ga0501039_0013863 Ga0501039_0013863_2253_3401 368
502 3300049579 Ga0501043_0006935 Ga0501043_0006935_1641_2789 368
503 3300049586 Ga0501070_0004393 Ga0501070_0004393_3982_5130 368
504 3300049590 Ga0501074_0003210 Ga0501074_0003210_5185_6333 368
505 3300049822 Ga0501035_0003406 Ga0501035_0003406_10697_11845 368
506 3300053079 Ga0500610_0103602 Ga0500610_0103602_215_1327 368
507 3300053085 Ga0495619_0023735 Ga0495619_0023735_1634_2746 368
508 3300053101 Ga0500553_045144 Ga0500553_045144_114_1226 368
509 3300053161 Ga0500634_0071752 Ga0500634_0071752_318_1430 368

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

26

267

0.92

PF09084

NMT1

NMT1/THI5 like

40

261

0.85

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

54

241

0.78

PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

32

271

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8412 45 351
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8305 45 351
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8227 44 336
2g29-assembly1.cif.gz_A crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 0.7914 50 353
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.7913 44 336
ID Description Score Start End Superfamily
3e4rA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8868 51 130 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8192 134 237 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8093 137 242 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8049 134 237 3.40.190.10
af_Q2FUT7_92_169_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7912 137 232 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6B3C809-F1-model_v4 ABC transporter substrate-binding protein 0.9955 68 251
AF-A0A0M8V010-F1-model_v4 deleted 0.993 87 262
AF-A0A6B1KEH5-F1-model_v4 ABC transporter substrate-binding protein 0.9925 96 368
AF-A0A3A9ZVF7-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9889 135 368
AF-A0A7K3D6D6-F1-model_v4 ABC transporter substrate-binding protein 0.9855 194 368

Feature Viewer

pLDDT pTM Quality
91.03 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map