F456992
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 509 | 216 | 509 | 165 |
Family's Representative Sequence
| Representative Sequence | 3300025940|Ga0207691_10010650|Ga0207691_100106502 |
| Length | 186 |
| Sequence | LYSVQGFWGLPVGTSINLAICLTSLLALKGKSYLCRMDLLQNWEKKSQDHQKEYKRYLQRAGKNHVLRNQHVFHEEAFEKVNKNYSPRFKTPDIKRISKLLKMKEGDFIQTYLRLDEEGDYVARSKPCPFLGDDNACSIYDQRPSDCSRFPYTDEDVLYKRQALTLKNSSFCPIVYYVIEKLMTVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 144 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 146 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 147 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 149 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 150 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 151 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 152 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 153 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 154 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 155 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 159 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 160 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 161 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 162 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 163 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 164 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 165 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 166 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 167 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 168 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 169 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 202 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 203 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 206 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 209 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 212 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 213 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 214 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.98 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 97.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10087488 | 3300003320 | Bacteria | 3499 |
| 2 | rootL2_10064875 | 3300003322 | Bacteria | 7982 |
| 3 | Ga0070658_10043686 | 3300005327 | Bacteria | 3620 |
| 4 | Ga0070658_10061316 | 3300005327 | Bacteria | 3064 |
| 5 | Ga0070658_10068609 | 3300005327 | Bacteria | 2899 |
| 6 | Ga0070658_10436159 | 3300005327 | Bacteria | 1128 |
| 7 | Ga0070658_10830043 | 3300005327 | Bacteria | 803 |
| 8 | Ga0070658_11254747 | 3300005327 | Bacteria | 644 |
| 9 | Ga0070676_10619534 | 3300005328 | Unclassified | 782 |
| 10 | Ga0070676_11175403 | 3300005328 | Bacteria | 582 |
| 11 | Ga0070683_100052913 | 3300005329 | Bacteria | 3762 |
| 12 | Ga0070683_100177446 | 3300005329 | Bacteria | 2022 |
| 13 | Ga0070683_100223616 | 3300005329 | Bacteria | 1789 |
| 14 | Ga0070683_100571453 | 3300005329 | Archaea | 1081 |
| 15 | Ga0070690_100040602 | 3300005330 | Bacteria | 2943 |
| 16 | Ga0070690_100335719 | 3300005330 | Bacteria | 1093 |
| 17 | Ga0070670_100466189 | 3300005331 | Unclassified | 1121 |
| 18 | Ga0070670_100779551 | 3300005331 | Bacteria | 863 |
| 19 | Ga0070677_10062039 | 3300005333 | Bacteria | 1545 |
| 20 | Ga0068869_100034416 | 3300005334 | Unclassified | 3583 |
| 21 | Ga0068869_100546648 | 3300005334 | Bacteria | 972 |
| 22 | Ga0070666_10015364 | 3300005335 | Bacteria | 4882 |
| 23 | Ga0070680_100006070 | 3300005336 | Bacteria | 9148 |
| 24 | Ga0070680_100481268 | 3300005336 | Bacteria | 1061 |
| 25 | Ga0070682_100001134 | 3300005337 | Bacteria | 15189 |
| 26 | Ga0070682_100012005 | 3300005337 | Bacteria | 4956 |
| 27 | Ga0070682_100013837 | 3300005337 | Bacteria | 4652 |
| 28 | Ga0070682_100063243 | 3300005337 | Bacteria | 2346 |
| 29 | Ga0068868_100016170 | 3300005338 | Bacteria | 5535 |
| 30 | Ga0068868_100066319 | 3300005338 | Bacteria | 2869 |
| 31 | Ga0068868_100147445 | 3300005338 | Bacteria | 1936 |
| 32 | Ga0070660_100005499 | 3300005339 | Bacteria | 8776 |
| 33 | Ga0070660_100014059 | 3300005339 | Bacteria | 5761 |
| 34 | Ga0070660_100023642 | 3300005339 | Bacteria | 4554 |
| 35 | Ga0070660_100040633 | 3300005339 | Bacteria | 3541 |
| 36 | Ga0070660_100539006 | 3300005339 | Bacteria | 973 |
| 37 | Ga0070689_100855817 | 3300005340 | Bacteria | 802 |
| 38 | Ga0070691_10002118 | 3300005341 | Bacteria | 8779 |
| 39 | Ga0070661_100004914 | 3300005344 | Bacteria | 9202 |
| 40 | Ga0070661_100352303 | 3300005344 | Archaea | 1155 |
| 41 | Ga0070669_100390722 | 3300005353 | Bacteria | 1136 |
| 42 | Ga0070675_100014996 | 3300005354 | Bacteria | 6121 |
| 43 | Ga0070675_100127665 | 3300005354 | Bacteria | 2165 |
| 44 | Ga0070671_100013240 | 3300005355 | Bacteria | 6646 |
| 45 | Ga0070671_100113381 | 3300005355 | Bacteria | 2278 |
| 46 | Ga0070673_100035269 | 3300005364 | Bacteria | 3792 |
| 47 | Ga0070673_100121772 | 3300005364 | Bacteria | 2177 |
| 48 | Ga0070688_100244028 | 3300005365 | Bacteria | 1276 |
| 49 | Ga0070688_100579435 | 3300005365 | Bacteria | 856 |
| 50 | Ga0070659_100005352 | 3300005366 | Bacteria | 9211 |
| 51 | Ga0070667_100001521 | 3300005367 | Bacteria | 20766 |
| 52 | Ga0070667_100008567 | 3300005367 | Bacteria | 8475 |
| 53 | Ga0070667_100712816 | 3300005367 | Unclassified | 929 |
| 54 | Ga0070700_100706483 | 3300005441 | Bacteria | 802 |
| 55 | Ga0070694_100545011 | 3300005444 | Unclassified | 928 |
| 56 | Ga0070663_100151454 | 3300005455 | Unclassified | 1779 |
| 57 | Ga0070678_100019337 | 3300005456 | Bacteria | 4437 |
| 58 | Ga0070678_100603339 | 3300005456 | Bacteria | 980 |
| 59 | Ga0070678_100676638 | 3300005456 | Bacteria | 928 |
| 60 | Ga0070662_100006981 | 3300005457 | Bacteria | 7307 |
| 61 | Ga0070662_100756511 | 3300005457 | Bacteria | 824 |
| 62 | Ga0070681_10070892 | 3300005458 | Bacteria | 3449 |
| 63 | Ga0070681_10216029 | 3300005458 | Bacteria | 1833 |
| 64 | Ga0070681_10513165 | 3300005458 | Bacteria | 1112 |
| 65 | Ga0068867_100204309 | 3300005459 | Bacteria | 1583 |
| 66 | Ga0070685_10062766 | 3300005466 | Unclassified | 2179 |
| 67 | Ga0070679_100000158 | 3300005530 | Bacteria | 54895 |
| 68 | Ga0070679_100000684 | 3300005530 | Bacteria | 29020 |
| 69 | Ga0070679_100049146 | 3300005530 | Bacteria | 4201 |
| 70 | Ga0070679_100159630 | 3300005530 | Bacteria | 2229 |
| 71 | Ga0070679_100161022 | 3300005530 | Bacteria | 2219 |
| 72 | Ga0070679_101137678 | 3300005530 | Bacteria | 725 |
| 73 | Ga0070684_100009329 | 3300005535 | Bacteria | 7723 |
| 74 | Ga0070684_100336725 | 3300005535 | Bacteria | 1387 |
| 75 | Ga0070684_100343145 | 3300005535 | Bacteria | 1373 |
| 76 | Ga0070684_100438856 | 3300005535 | Unclassified | 1206 |
| 77 | Ga0068853_100000197 | 3300005539 | Bacteria | 42626 |
| 78 | Ga0068853_100033260 | 3300005539 | Bacteria | 4373 |
| 79 | Ga0068853_100230718 | 3300005539 | Bacteria | 1693 |
| 80 | Ga0068853_100482221 | 3300005539 | Bacteria | 1169 |
| 81 | Ga0070672_100028585 | 3300005543 | Bacteria | 4172 |
| 82 | Ga0070672_100085657 | 3300005543 | Bacteria | 2533 |
| 83 | Ga0070672_100453183 | 3300005543 | Bacteria | 1105 |
| 84 | Ga0070672_100522258 | 3300005543 | Bacteria | 1029 |
| 85 | Ga0070686_100155697 | 3300005544 | Bacteria | 1604 |
| 86 | Ga0070693_100060508 | 3300005547 | Unclassified | 2198 |
| 87 | Ga0070693_100205561 | 3300005547 | Unclassified | 1282 |
| 88 | Ga0070665_101179616 | 3300005548 | Bacteria | 777 |
| 89 | Ga0068855_100002992 | 3300005563 | Bacteria | 20656 |
| 90 | Ga0068855_100005888 | 3300005563 | Bacteria | 14948 |
| 91 | Ga0068855_100017175 | 3300005563 | Bacteria | 8707 |
| 92 | Ga0068855_100102486 | 3300005563 | Bacteria | 3294 |
| 93 | Ga0068855_100109802 | 3300005563 | Bacteria | 3166 |
| 94 | Ga0068855_100145564 | 3300005563 | Bacteria | 2698 |
| 95 | Ga0068855_100182049 | 3300005563 | Unclassified | 2375 |
| 96 | Ga0068855_100194900 | 3300005563 | Bacteria | 2283 |
| 97 | Ga0068855_100329030 | 3300005563 | Bacteria | 1687 |
| 98 | Ga0068855_100441910 | 3300005563 | Bacteria | 1420 |
| 99 | Ga0070664_100000950 | 3300005564 | Bacteria | 22641 |
| 100 | Ga0068857_100057032 | 3300005577 | Bacteria | 3466 |
| 101 | Ga0068857_101619928 | 3300005577 | Bacteria | 632 |
| 102 | Ga0068854_100073685 | 3300005578 | Bacteria | 2503 |
| 103 | Ga0068854_100336052 | 3300005578 | Unclassified | 1232 |
| 104 | Ga0068854_100781931 | 3300005578 | Unclassified | 830 |
| 105 | Ga0068856_100048103 | 3300005614 | Bacteria | 4202 |
| 106 | Ga0068856_100083452 | 3300005614 | Bacteria | 3173 |
| 107 | Ga0068856_100375173 | 3300005614 | Bacteria | 1441 |
| 108 | Ga0068856_100632479 | 3300005614 | Bacteria | 1091 |
| 109 | Ga0068852_100001739 | 3300005616 | Bacteria | 14830 |
| 110 | Ga0068852_100024208 | 3300005616 | Bacteria | 4904 |
| 111 | Ga0068852_100127596 | 3300005616 | Bacteria | 2338 |
| 112 | Ga0068852_100299872 | 3300005616 | Bacteria | 1555 |
| 113 | Ga0068852_101055341 | 3300005616 | Bacteria | 832 |
| 114 | Ga0068852_102253150 | 3300005616 | Unclassified | 566 |
| 115 | Ga0068859_100000106 | 3300005617 | Bacteria | 78128 |
| 116 | Ga0068859_100011757 | 3300005617 | Bacteria | 8793 |
| 117 | Ga0068859_100064691 | 3300005617 | Bacteria | 3690 |
| 118 | Ga0068859_100142962 | 3300005617 | Bacteria | 2466 |
| 119 | Ga0068864_100009738 | 3300005618 | Bacteria | 7925 |
| 120 | Ga0068864_100066191 | 3300005618 | Bacteria | 3136 |
| 121 | Ga0068864_100114482 | 3300005618 | Bacteria | 2405 |
| 122 | Ga0068864_100269881 | 3300005618 | Bacteria | 1585 |
| 123 | Ga0068861_100592422 | 3300005719 | Bacteria | 1016 |
| 124 | Ga0068851_10028829 | 3300005834 | Bacteria | 2744 |
| 125 | Ga0068851_10080692 | 3300005834 | Bacteria | 1698 |
| 126 | Ga0068863_100000567 | 3300005841 | Bacteria | 37587 |
| 127 | Ga0068863_100017497 | 3300005841 | Bacteria | 6871 |
| 128 | Ga0068863_100902052 | 3300005841 | Unclassified | 884 |
| 129 | Ga0068858_100320417 | 3300005842 | Bacteria | 1481 |
| 130 | Ga0068858_101195948 | 3300005842 | Bacteria | 747 |
| 131 | Ga0068860_100003819 | 3300005843 | Bacteria | 15494 |
| 132 | Ga0068860_100005157 | 3300005843 | Bacteria | 13283 |
| 133 | Ga0068860_100019538 | 3300005843 | Bacteria | 6568 |
| 134 | Ga0068860_100030900 | 3300005843 | Bacteria | 5150 |
| 135 | Ga0068860_100041189 | 3300005843 | Unclassified | 4412 |
| 136 | Ga0068860_100547409 | 3300005843 | Bacteria | 1159 |
| 137 | Ga0068862_100185151 | 3300005844 | Bacteria | 1871 |
| 138 | Ga0068862_100394342 | 3300005844 | Bacteria | 1294 |
| 139 | Ga0068862_100960039 | 3300005844 | Bacteria | 843 |
| 140 | Ga0081539_10001226 | 3300005985 | Bacteria | 45853 |
| 141 | Ga0075366_10159807 | 3300006195 | Unclassified | 1365 |
| 142 | Ga0097621_100006863 | 3300006237 | Bacteria | 8099 |
| 143 | Ga0097621_100063023 | 3300006237 | Unclassified | 3045 |
| 144 | Ga0097621_100289477 | 3300006237 | Bacteria | 1444 |
| 145 | Ga0097621_100314087 | 3300006237 | Unclassified | 1387 |
| 146 | Ga0097621_100351570 | 3300006237 | Bacteria | 1311 |
| 147 | Ga0068871_100003787 | 3300006358 | Bacteria | 10416 |
| 148 | Ga0068871_100010171 | 3300006358 | Bacteria | 6852 |
| 149 | Ga0068871_100019773 | 3300006358 | Bacteria | 5146 |
| 150 | Ga0068871_100207190 | 3300006358 | Bacteria | 1695 |
| 151 | Ga0068871_100264827 | 3300006358 | Unclassified | 1500 |
| 152 | Ga0068871_100487338 | 3300006358 | Bacteria | 1110 |
| 153 | Ga0075428_100193784 | 3300006844 | Unclassified | 2198 |
| 154 | Ga0075430_100355123 | 3300006846 | Unclassified | 1210 |
| 155 | Ga0075431_100020645 | 3300006847 | Bacteria | 6731 |
| 156 | Ga0068865_100490979 | 3300006881 | Bacteria | 1022 |
| 157 | Ga0097620_100000106 | 3300006931 | Bacteria | 78128 |
| 158 | Ga0097620_100011757 | 3300006931 | Bacteria | 8793 |
| 159 | Ga0097620_100064693 | 3300006931 | Bacteria | 3690 |
| 160 | Ga0097620_100142962 | 3300006931 | Bacteria | 2466 |
| 161 | Ga0105240_10002290 | 3300009093 | Bacteria | 31019 |
| 162 | Ga0105240_10008150 | 3300009093 | Bacteria | 15026 |
| 163 | Ga0105240_10024327 | 3300009093 | Bacteria | 7987 |
| 164 | Ga0105240_10104502 | 3300009093 | Unclassified | 3440 |
| 165 | Ga0105240_11125669 | 3300009093 | Bacteria | 834 |
| 166 | Ga0105245_10172951 | 3300009098 | Bacteria | 2058 |
| 167 | Ga0105245_10253669 | 3300009098 | Bacteria | 1710 |
| 168 | Ga0105247_10019635 | 3300009101 | Unclassified | 4057 |
| 169 | Ga0114129_10084409 | 3300009147 | Bacteria | 4410 |
| 170 | Ga0105243_11055129 | 3300009148 | Bacteria | 818 |
| 171 | Ga0105241_10001224 | 3300009174 | Bacteria | 19641 |
| 172 | Ga0105241_10002476 | 3300009174 | Bacteria | 13891 |
| 173 | Ga0105241_10131388 | 3300009174 | Unclassified | 2028 |
| 174 | Ga0105241_10218074 | 3300009174 | Bacteria | 1602 |
| 175 | Ga0105242_10542644 | 3300009176 | Unclassified | 1113 |
| 176 | Ga0105242_10630168 | 3300009176 | Bacteria | 1040 |
| 177 | Ga0105237_10003683 | 3300009545 | Bacteria | 18058 |
| 178 | Ga0105237_10008043 | 3300009545 | Bacteria | 11467 |
| 179 | Ga0105237_10009512 | 3300009545 | Bacteria | 10407 |
| 180 | Ga0105237_10012937 | 3300009545 | Bacteria | 8765 |
| 181 | Ga0105237_10121782 | 3300009545 | Bacteria | 2603 |
| 182 | Ga0105237_12324160 | 3300009545 | Unclassified | 546 |
| 183 | Ga0105238_10074065 | 3300009551 | Bacteria | 3398 |
| 184 | Ga0105238_10128549 | 3300009551 | Bacteria | 2512 |
| 185 | Ga0105249_10002874 | 3300009553 | Bacteria | 14864 |
| 186 | Ga0105249_10997829 | 3300009553 | Bacteria | 906 |
| 187 | Ga0105249_11417340 | 3300009553 | Bacteria | 767 |
| 188 | Ga0099796_10113634 | 3300010159 | Unclassified | 1033 |
| 189 | Ga0105239_10000760 | 3300010375 | Bacteria | 45542 |
| 190 | Ga0105239_10002155 | 3300010375 | Bacteria | 25331 |
| 191 | Ga0105239_10025615 | 3300010375 | Bacteria | 6495 |
| 192 | Ga0105239_10060501 | 3300010375 | Unclassified | 4157 |
| 193 | Ga0105239_10077689 | 3300010375 | Bacteria | 3653 |
| 194 | Ga0105239_10194993 | 3300010375 | Bacteria | 2268 |
| 195 | Ga0105239_10301860 | 3300010375 | Bacteria | 1803 |
| 196 | Ga0105239_10545314 | 3300010375 | Bacteria | 1320 |
| 197 | Ga0105246_10019431 | 3300011119 | Unclassified | 4341 |
| 198 | Ga0105246_10085903 | 3300011119 | Bacteria | 2254 |
| 199 | Ga0105246_10186652 | 3300011119 | Bacteria | 1601 |
| 200 | Ga0157373_10005254 | 3300013100 | Bacteria | 9723 |
| 201 | Ga0157373_10006304 | 3300013100 | Bacteria | 8862 |
| 202 | Ga0157373_10033843 | 3300013100 | Bacteria | 3672 |
| 203 | Ga0157373_10055735 | 3300013100 | Unclassified | 2808 |
| 204 | Ga0157373_10435931 | 3300013100 | Bacteria | 942 |
| 205 | Ga0157371_10000231 | 3300013102 | Bacteria | 79811 |
| 206 | Ga0157371_10001159 | 3300013102 | Bacteria | 28365 |
| 207 | Ga0157371_10003438 | 3300013102 | Bacteria | 14365 |
| 208 | Ga0157371_10007512 | 3300013102 | Bacteria | 8820 |
| 209 | Ga0157371_10024064 | 3300013102 | Bacteria | 4449 |
| 210 | Ga0157371_10030010 | 3300013102 | Bacteria | 3924 |
| 211 | Ga0157371_10036236 | 3300013102 | Bacteria | 3533 |
| 212 | Ga0157371_10371717 | 3300013102 | Bacteria | 1043 |
| 213 | Ga0157371_10643113 | 3300013102 | Bacteria | 791 |
| 214 | Ga0157371_10838192 | 3300013102 | Unclassified | 695 |
| 215 | Ga0157371_11395017 | 3300013102 | Bacteria | 544 |
| 216 | Ga0157370_10004240 | 3300013104 | Bacteria | 16570 |
| 217 | Ga0157370_10004630 | 3300013104 | Bacteria | 15729 |
| 218 | Ga0157370_10019132 | 3300013104 | Bacteria | 6884 |
| 219 | Ga0157370_10036554 | 3300013104 | Bacteria | 4764 |
| 220 | Ga0157370_10104499 | 3300013104 | Bacteria | 2651 |
| 221 | Ga0157370_10169571 | 3300013104 | Archaea | 2029 |
| 222 | Ga0157370_10192331 | 3300013104 | Bacteria | 1894 |
| 223 | Ga0157370_10328199 | 3300013104 | Bacteria | 1411 |
| 224 | Ga0157370_10422643 | 3300013104 | Bacteria | 1226 |
| 225 | Ga0157370_10521704 | 3300013104 | Bacteria | 1090 |
| 226 | Ga0157370_11078328 | 3300013104 | Bacteria | 726 |
| 227 | Ga0157369_10008917 | 3300013105 | Bacteria | 11491 |
| 228 | Ga0157369_10015498 | 3300013105 | Bacteria | 8589 |
| 229 | Ga0157369_10043924 | 3300013105 | Bacteria | 4868 |
| 230 | Ga0157369_10050745 | 3300013105 | Bacteria | 4491 |
| 231 | Ga0157369_10053730 | 3300013105 | Bacteria | 4352 |
| 232 | Ga0157369_10167210 | 3300013105 | Bacteria | 2319 |
| 233 | Ga0157369_10228452 | 3300013105 | Bacteria | 1946 |
| 234 | Ga0157369_10549196 | 3300013105 | Bacteria | 1194 |
| 235 | Ga0157369_10610701 | 3300013105 | Bacteria | 1125 |
| 236 | Ga0157374_10000002 | 3300013296 | Bacteria | 1054226 |
| 237 | Ga0157374_10032223 | 3300013296 | Bacteria | 4770 |
| 238 | Ga0157374_10360233 | 3300013296 | Bacteria | 1446 |
| 239 | Ga0157374_10668410 | 3300013296 | Unclassified | 1051 |
| 240 | Ga0157374_11503109 | 3300013296 | Unclassified | 697 |
| 241 | Ga0157378_10008134 | 3300013297 | Bacteria | 9153 |
| 242 | Ga0157378_10296177 | 3300013297 | Unclassified | 1564 |
| 243 | Ga0157378_10667953 | 3300013297 | Unclassified | 1056 |
| 244 | Ga0157378_10816196 | 3300013297 | Unclassified | 959 |
| 245 | Ga0157378_10827880 | 3300013297 | Bacteria | 953 |
| 246 | Ga0163162_10000972 | 3300013306 | Bacteria | 26646 |
| 247 | Ga0163162_10059671 | 3300013306 | Bacteria | 3847 |
| 248 | Ga0163162_10079020 | 3300013306 | Bacteria | 3356 |
| 249 | Ga0163162_10181279 | 3300013306 | Bacteria | 2232 |
| 250 | Ga0163162_10241057 | 3300013306 | Bacteria | 1939 |
| 251 | Ga0163162_10664778 | 3300013306 | Bacteria | 1165 |
| 252 | Ga0157372_10009422 | 3300013307 | Bacteria | 10390 |
| 253 | Ga0157372_10011158 | 3300013307 | Bacteria | 9557 |
| 254 | Ga0157372_10050163 | 3300013307 | Unclassified | 4643 |
| 255 | Ga0157372_10069336 | 3300013307 | Unclassified | 3966 |
| 256 | Ga0157372_10092527 | 3300013307 | Bacteria | 3440 |
| 257 | Ga0157372_10122871 | 3300013307 | Bacteria | 2984 |
| 258 | Ga0157372_10146224 | 3300013307 | Bacteria | 2726 |
| 259 | Ga0157372_10170081 | 3300013307 | Bacteria | 2521 |
| 260 | Ga0157372_10527422 | 3300013307 | Bacteria | 1376 |
| 261 | Ga0157372_11502729 | 3300013307 | Bacteria | 776 |
| 262 | Ga0157372_11976833 | 3300013307 | Bacteria | 670 |
| 263 | Ga0157375_10046462 | 3300013308 | Bacteria | 4233 |
| 264 | Ga0157375_10117318 | 3300013308 | Bacteria | 2767 |
| 265 | Ga0157375_11550859 | 3300013308 | Unclassified | 782 |
| 266 | Ga0163163_10334406 | 3300014325 | Unclassified | 1569 |
| 267 | Ga0163163_10765924 | 3300014325 | Bacteria | 1029 |
| 268 | Ga0163163_10884256 | 3300014325 | Bacteria | 957 |
| 269 | Ga0157380_10187138 | 3300014326 | Bacteria | 1825 |
| 270 | Ga0157377_10061600 | 3300014745 | Bacteria | 2145 |
| 271 | Ga0157377_10629706 | 3300014745 | Unclassified | 769 |
| 272 | Ga0157379_10547664 | 3300014968 | Unclassified | 1076 |
| 273 | Ga0157379_10667911 | 3300014968 | Bacteria | 974 |
| 274 | Ga0157379_11042177 | 3300014968 | Bacteria | 781 |
| 275 | Ga0157376_10001744 | 3300014969 | Bacteria | 14472 |
| 276 | Ga0157376_10041214 | 3300014969 | Bacteria | 3779 |
| 277 | Ga0157376_10186090 | 3300014969 | Bacteria | 1901 |
| 278 | Ga0157376_10228294 | 3300014969 | Bacteria | 1728 |
| 279 | Ga0163161_10319545 | 3300017792 | Unclassified | 1227 |
| 280 | Ga0163161_10950830 | 3300017792 | Unclassified | 731 |
| 281 | Ga0207656_10064115 | 3300025321 | Bacteria | 1619 |
| 282 | Ga0207682_10081943 | 3300025893 | Bacteria | 1385 |
| 283 | Ga0207642_10188569 | 3300025899 | Bacteria | 1129 |
| 284 | Ga0207710_10010011 | 3300025900 | Unclassified | 3988 |
| 285 | Ga0207680_10021255 | 3300025903 | Unclassified | 3509 |
| 286 | Ga0207647_10014949 | 3300025904 | Bacteria | 5334 |
| 287 | Ga0207647_10208757 | 3300025904 | Bacteria | 1128 |
| 288 | Ga0207643_10139946 | 3300025908 | Bacteria | 1445 |
| 289 | Ga0207705_10015146 | 3300025909 | Bacteria | 5542 |
| 290 | Ga0207705_10017824 | 3300025909 | Bacteria | 5078 |
| 291 | Ga0207705_10039758 | 3300025909 | Bacteria | 3371 |
| 292 | Ga0207705_10160955 | 3300025909 | Bacteria | 1686 |
| 293 | Ga0207705_10280507 | 3300025909 | Bacteria | 1275 |
| 294 | Ga0207705_10425614 | 3300025909 | Unclassified | 1028 |
| 295 | Ga0207705_10702403 | 3300025909 | Unclassified | 786 |
| 296 | Ga0207654_10002232 | 3300025911 | Bacteria | 9946 |
| 297 | Ga0207654_10010152 | 3300025911 | Bacteria | 4791 |
| 298 | Ga0207654_10293169 | 3300025911 | Unclassified | 1104 |
| 299 | Ga0207707_10001194 | 3300025912 | Bacteria | 24438 |
| 300 | Ga0207707_10332535 | 3300025912 | Archaea | 1311 |
| 301 | Ga0207707_10544669 | 3300025912 | Bacteria | 986 |
| 302 | Ga0207707_10632508 | 3300025912 | Bacteria | 903 |
| 303 | Ga0207695_10000016 | 3300025913 | Bacteria | 771991 |
| 304 | Ga0207695_10000296 | 3300025913 | Bacteria | 123322 |
| 305 | Ga0207695_10014807 | 3300025913 | Bacteria | 9213 |
| 306 | Ga0207695_10027822 | 3300025913 | Bacteria | 6287 |
| 307 | Ga0207695_10036297 | 3300025913 | Bacteria | 5330 |
| 308 | Ga0207695_10050912 | 3300025913 | Unclassified | 4353 |
| 309 | Ga0207671_10001029 | 3300025914 | Bacteria | 33967 |
| 310 | Ga0207671_10011496 | 3300025914 | Bacteria | 7195 |
| 311 | Ga0207671_10016235 | 3300025914 | Bacteria | 5795 |
| 312 | Ga0207671_10077204 | 3300025914 | Bacteria | 2493 |
| 313 | Ga0207671_10089454 | 3300025914 | Unclassified | 2317 |
| 314 | Ga0207660_10001003 | 3300025917 | Bacteria | 18710 |
| 315 | Ga0207660_10012933 | 3300025917 | Bacteria | 5466 |
| 316 | Ga0207660_10332170 | 3300025917 | Unclassified | 1215 |
| 317 | Ga0207660_10461622 | 3300025917 | Unclassified | 1028 |
| 318 | Ga0207657_10004992 | 3300025919 | Bacteria | 13947 |
| 319 | Ga0207657_10006170 | 3300025919 | Bacteria | 12459 |
| 320 | Ga0207657_10026230 | 3300025919 | Bacteria | 5358 |
| 321 | Ga0207657_10134790 | 3300025919 | Bacteria | 2021 |
| 322 | Ga0207649_10023819 | 3300025920 | Bacteria | 3550 |
| 323 | Ga0207652_10000013 | 3300025921 | Bacteria | 222247 |
| 324 | Ga0207652_10002368 | 3300025921 | Bacteria | 15936 |
| 325 | Ga0207652_10005901 | 3300025921 | Bacteria | 9905 |
| 326 | Ga0207652_10036890 | 3300025921 | Bacteria | 4134 |
| 327 | Ga0207652_10042375 | 3300025921 | Bacteria | 3874 |
| 328 | Ga0207652_10155714 | 3300025921 | Bacteria | 2047 |
| 329 | Ga0207652_10211212 | 3300025921 | Bacteria | 1747 |
| 330 | Ga0207652_10554025 | 3300025921 | Bacteria | 1033 |
| 331 | Ga0207652_10736152 | 3300025921 | Bacteria | 878 |
| 332 | Ga0207681_10322417 | 3300025923 | Bacteria | 1229 |
| 333 | Ga0207694_10093751 | 3300025924 | Bacteria | 2372 |
| 334 | Ga0207694_10135391 | 3300025924 | Bacteria | 1978 |
| 335 | Ga0207650_10079862 | 3300025925 | Bacteria | 2478 |
| 336 | Ga0207650_10666110 | 3300025925 | Bacteria | 878 |
| 337 | Ga0207659_10194337 | 3300025926 | Bacteria | 1616 |
| 338 | Ga0207659_11116375 | 3300025926 | Bacteria | 678 |
| 339 | Ga0207687_10392114 | 3300025927 | Unclassified | 1140 |
| 340 | Ga0207644_10218405 | 3300025931 | Bacteria | 1510 |
| 341 | Ga0207644_10330205 | 3300025931 | Bacteria | 1235 |
| 342 | Ga0207690_10042718 | 3300025932 | Bacteria | 2979 |
| 343 | Ga0207706_10005696 | 3300025933 | Bacteria | 11606 |
| 344 | Ga0207686_10070326 | 3300025934 | Unclassified | 2248 |
| 345 | Ga0207670_10169744 | 3300025936 | Bacteria | 1635 |
| 346 | Ga0207669_10835805 | 3300025937 | Unclassified | 766 |
| 347 | Ga0207691_10010650 | 3300025940 | Bacteria | 8824 |
| 348 | Ga0207691_10104179 | 3300025940 | Bacteria | 2529 |
| 349 | Ga0207691_10129293 | 3300025940 | Bacteria | 2232 |
| 350 | Ga0207689_10000853 | 3300025942 | Bacteria | 29374 |
| 351 | Ga0207689_11053744 | 3300025942 | Unclassified | 686 |
| 352 | Ga0207661_10322149 | 3300025944 | Bacteria | 1390 |
| 353 | Ga0207661_10434737 | 3300025944 | Bacteria | 1193 |
| 354 | Ga0207661_10509389 | 3300025944 | Archaea | 1100 |
| 355 | Ga0207679_10171795 | 3300025945 | Bacteria | 1785 |
| 356 | Ga0207679_10797070 | 3300025945 | Bacteria | 861 |
| 357 | Ga0207667_10000583 | 3300025949 | Bacteria | 47418 |
| 358 | Ga0207667_10001138 | 3300025949 | Bacteria | 33456 |
| 359 | Ga0207667_10083362 | 3300025949 | Bacteria | 3310 |
| 360 | Ga0207667_10110926 | 3300025949 | Bacteria | 2829 |
| 361 | Ga0207667_10148492 | 3300025949 | Unclassified | 2413 |
| 362 | Ga0207667_10153264 | 3300025949 | Bacteria | 2371 |
| 363 | Ga0207667_10176610 | 3300025949 | Bacteria | 2194 |
| 364 | Ga0207667_10233454 | 3300025949 | Bacteria | 1883 |
| 365 | Ga0207651_10035846 | 3300025960 | Bacteria | 3232 |
| 366 | Ga0207651_10479788 | 3300025960 | Bacteria | 1071 |
| 367 | Ga0207712_10002069 | 3300025961 | Bacteria | 13179 |
| 368 | Ga0207668_10085857 | 3300025972 | Bacteria | 2298 |
| 369 | Ga0207668_10313711 | 3300025972 | Bacteria | 1299 |
| 370 | Ga0207640_10166727 | 3300025981 | Bacteria | 1636 |
| 371 | Ga0207640_10427772 | 3300025981 | Unclassified | 1085 |
| 372 | Ga0207658_10009067 | 3300025986 | Bacteria | 6747 |
| 373 | Ga0207658_10010441 | 3300025986 | Bacteria | 6307 |
| 374 | Ga0207658_10348834 | 3300025986 | Bacteria | 1288 |
| 375 | Ga0207677_10003369 | 3300026023 | Bacteria | 8455 |
| 376 | Ga0207677_10031649 | 3300026023 | Bacteria | 3390 |
| 377 | Ga0207677_10307959 | 3300026023 | Bacteria | 1311 |
| 378 | Ga0207703_10003904 | 3300026035 | Bacteria | 12380 |
| 379 | Ga0207703_10907799 | 3300026035 | Bacteria | 843 |
| 380 | Ga0207639_10023498 | 3300026041 | Bacteria | 4453 |
| 381 | Ga0207639_10076414 | 3300026041 | Bacteria | 2637 |
| 382 | Ga0207639_10148486 | 3300026041 | Bacteria | 1961 |
| 383 | Ga0207639_10332934 | 3300026041 | Bacteria | 1351 |
| 384 | Ga0207639_11385088 | 3300026041 | Bacteria | 660 |
| 385 | Ga0207678_10230143 | 3300026067 | Bacteria | 1587 |
| 386 | Ga0207702_10029450 | 3300026078 | Bacteria | 4568 |
| 387 | Ga0207702_10086907 | 3300026078 | Bacteria | 2728 |
| 388 | Ga0207702_10087567 | 3300026078 | Bacteria | 2719 |
| 389 | Ga0207702_10165092 | 3300026078 | Bacteria | 2025 |
| 390 | Ga0207641_10000082 | 3300026088 | Bacteria | 138385 |
| 391 | Ga0207641_10784131 | 3300026088 | Unclassified | 942 |
| 392 | Ga0207648_10470528 | 3300026089 | Bacteria | 1147 |
| 393 | Ga0207676_10005134 | 3300026095 | Bacteria | 9267 |
| 394 | Ga0207676_10286694 | 3300026095 | Bacteria | 1497 |
| 395 | Ga0207676_11499950 | 3300026095 | Bacteria | 671 |
| 396 | Ga0207674_10034788 | 3300026116 | Bacteria | 5263 |
| 397 | Ga0207675_100411993 | 3300026118 | Bacteria | 1333 |
| 398 | Ga0207675_100949999 | 3300026118 | Bacteria | 877 |
| 399 | Ga0207675_101113695 | 3300026118 | Unclassified | 809 |
| 400 | Ga0207683_10093471 | 3300026121 | Bacteria | 2680 |
| 401 | Ga0207683_10713034 | 3300026121 | Unclassified | 930 |
| 402 | Ga0207698_10004508 | 3300026142 | Bacteria | 8495 |
| 403 | Ga0207698_10074014 | 3300026142 | Bacteria | 2715 |
| 404 | Ga0207698_10251970 | 3300026142 | Bacteria | 1616 |
| 405 | Ga0209974_10059969 | 3300027876 | Unclassified | 1287 |
| 406 | Ga0268265_10023924 | 3300028380 | Bacteria | 4314 |
| 407 | Ga0268264_10006272 | 3300028381 | Bacteria | 10027 |
| 408 | Ga0268264_10006312 | 3300028381 | Bacteria | 9993 |
| 409 | Ga0268264_10006818 | 3300028381 | Bacteria | 9594 |
| 410 | Ga0268264_10012637 | 3300028381 | Bacteria | 6954 |
| 411 | Ga0268264_10030257 | 3300028381 | Unclassified | 4438 |
| 412 | Ga0307517_10021498 | 3300028786 | Bacteria | 8145 |
| 413 | Ga0265338_10941828 | 3300028800 | Bacteria | 586 |
| 414 | Ga0265316_10482424 | 3300031344 | Bacteria | 887 |
| 415 | Ga0307509_10121639 | 3300031507 | Bacteria | 2586 |
| 416 | Ga0265313_10118642 | 3300031595 | Unclassified | 1156 |
| 417 | Ga0307516_10001379 | 3300031730 | Bacteria | 33641 |
| 418 | Ga0307414_10861600 | 3300032004 | Bacteria | 829 |
| 419 | Ga0307510_10003610 | 3300033180 | Bacteria | 18060 |
| 420 | Ga0373926_0096882 | 3300035083 | Bacteria | 1101 |
| 421 | Ga0373936_0101579 | 3300035113 | Bacteria | 1214 |
| 422 | Ga0373957_0384137 | 3300035120 | Bacteria | 603 |
| 423 | Ga0373924_0058123 | 3300035410 | Unclassified | 1614 |
| 424 | Ga0373935_0182666 | 3300035692 | Unclassified | 1441 |
| 425 | Ga0373933_0133334 | 3300035724 | Unclassified | 1563 |
| 426 | Ga0373937_0153103 | 3300036401 | Bacteria | 2160 |
| 427 | Ga0395899_0000528 | 3300037312 | Bacteria | 41982 |
| 428 | Ga0395899_0005868 | 3300037312 | Bacteria | 9529 |
| 429 | Ga0395899_0061355 | 3300037312 | Bacteria | 2769 |
| 430 | Ga0395899_0189490 | 3300037312 | Bacteria | 1439 |
| 431 | Ga0395900_0002692 | 3300037418 | Bacteria | 19416 |
| 432 | Ga0395900_0010753 | 3300037418 | Bacteria | 9361 |
| 433 | Ga0395900_0039526 | 3300037418 | Bacteria | 4860 |
| 434 | Ga0395900_0390237 | 3300037418 | Bacteria | 1358 |
| 435 | Ga0395900_0776360 | 3300037418 | Bacteria | 887 |
| 436 | Ga0395898_0000595 | 3300037466 | Bacteria | 67162 |
| 437 | Ga0395898_0053435 | 3300037466 | Bacteria | 3945 |
| 438 | Ga0395898_0075689 | 3300037466 | Bacteria | 3251 |
| 439 | Ga0395898_1353893 | 3300037466 | Bacteria | 640 |
| 440 | Ga0395905_0007136 | 3300037471 | Bacteria | 11170 |
| 441 | Ga0395905_0528286 | 3300037471 | Bacteria | 1080 |
| 442 | Ga0395901_0005353 | 3300038443 | Bacteria | 12971 |
| 443 | Ga0395901_0047717 | 3300038443 | Bacteria | 4446 |
| 444 | Ga0395901_0174479 | 3300038443 | Bacteria | 2255 |
| 445 | Ga0395901_0789469 | 3300038443 | Bacteria | 939 |
| 446 | Ga0395901_1051080 | 3300038443 | Bacteria | 787 |
| 447 | Ga0466961_0016976 | 3300044693 | Bacteria | 4675 |
| 448 | Ga0466964_0329776 | 3300044706 | Bacteria | 778 |
| 449 | Ga0466971_0016800 | 3300044719 | Unclassified | 3233 |
| 450 | Ga0466959_0004171 | 3300045049 | Bacteria | 9628 |
| 451 | Ga0466959_0727761 | 3300045049 | Bacteria | 664 |
| 452 | Ga0466958_0260844 | 3300045836 | Bacteria | 1109 |
| 453 | Ga0466967_0080611 | 3300045976 | Bacteria | 2938 |
| 454 | Ga0495638_0071960 | 3300046460 | Bacteria | 2114 |
| 455 | Ga0495653_0100476 | 3300046463 | Unclassified | 2097 |
| 456 | Ga0495650_0119793 | 3300046471 | Unclassified | 970 |
| 457 | Ga0495580_0394411 | 3300046472 | Bacteria | 934 |
| 458 | Ga0495580_0682212 | 3300046472 | Bacteria | 674 |
| 459 | Ga0495606_0008778 | 3300046507 | Bacteria | 8679 |
| 460 | Ga0495608_0083467 | 3300046511 | Bacteria | 2074 |
| 461 | Ga0495618_0046549 | 3300046514 | Unclassified | 2738 |
| 462 | Ga0495628_0181606 | 3300046516 | Bacteria | 1591 |
| 463 | Ga0495630_0034594 | 3300046517 | Unclassified | 3773 |
| 464 | Ga0495587_0024806 | 3300046536 | Bacteria | 3671 |
| 465 | Ga0495667_0190088 | 3300046559 | Unclassified | 1316 |
| 466 | Ga0495611_0000983 | 3300046648 | Bacteria | 15159 |
| 467 | Ga0495625_0600043 | 3300046660 | Bacteria | 661 |
| 468 | Ga0495658_0248580 | 3300046683 | Bacteria | 1118 |
| 469 | Ga0495649_0369252 | 3300046694 | Unclassified | 723 |
| 470 | Ga0495600_0104490 | 3300046809 | Bacteria | 1846 |
| 471 | Ga0495674_0286954 | 3300047319 | Bacteria | 1347 |
| 472 | Ga0495676_0330225 | 3300047321 | Unclassified | 1023 |
| 473 | Ga0495684_0024797 | 3300047471 | Bacteria | 4612 |
| 474 | Ga0495686_0000016 | 3300047472 | Bacteria | 443701 |
| 475 | Ga0501033_0010981 | 3300049570 | Bacteria | 6940 |
| 476 | Ga0501033_0031125 | 3300049570 | Bacteria | 4012 |
| 477 | Ga0501034_0027873 | 3300049571 | Bacteria | 5744 |
| 478 | Ga0501034_0037584 | 3300049571 | Bacteria | 4903 |
| 479 | Ga0501034_0178622 | 3300049571 | Bacteria | 2088 |
| 480 | Ga0501038_0205683 | 3300049574 | Unclassified | 1578 |
| 481 | Ga0501039_0254150 | 3300049575 | Bacteria | 1382 |
| 482 | Ga0501046_0304168 | 3300049580 | Unclassified | 1164 |
| 483 | Ga0501047_0112205 | 3300049581 | Bacteria | 2609 |
| 484 | Ga0501067_0006335 | 3300049583 | Bacteria | 6561 |
| 485 | Ga0501068_0513740 | 3300049584 | Unclassified | 778 |
| 486 | Ga0501070_0124607 | 3300049586 | Bacteria | 2129 |
| 487 | Ga0501070_0131161 | 3300049586 | Bacteria | 2070 |
| 488 | Ga0501072_0627396 | 3300049588 | Bacteria | 847 |
| 489 | Ga0501073_0121334 | 3300049589 | Bacteria | 1811 |
| 490 | Ga0501074_0653992 | 3300049590 | Unclassified | 742 |
| 491 | Ga0501219_000085 | 3300049703 | Bacteria | 15993 |
| 492 | Ga0501225_0048200 | 3300049705 | Bacteria | 1183 |
| 493 | Ga0501079_0093112 | 3300049741 | Bacteria | 2335 |
| 494 | Ga0501083_0037903 | 3300049744 | Bacteria | 3279 |
| 495 | Ga0501241_016123 | 3300049758 | Bacteria | 1362 |
| 496 | Ga0501035_1104770 | 3300049822 | Unclassified | 619 |
| 497 | Ga0501044_0074228 | 3300049823 | Unclassified | 3456 |
| 498 | Ga0501044_0111919 | 3300049823 | Bacteria | 2737 |
| 499 | Ga0501044_0119837 | 3300049823 | Bacteria | 2633 |
| 500 | Ga0501284_00074 | 3300050005 | Bacteria | 28202 |
| 501 | nmdc:mga05p37_143831_c1 | 3300050507 | Unclassified | 2921 |
| 502 | nmdc:mga06r32_7936_c1 | 3300050510 | Bacteria | 9541 |
| 503 | Ga0500646_0018484 | 3300053090 | Bacteria | 1836 |
| 504 | Ga0500646_0137592 | 3300053090 | Unclassified | 799 |
| 505 | Ga0500588_0014745 | 3300053146 | Bacteria | 1988 |
| 506 | Ga0500637_0479009 | 3300053178 | Unclassified | 623 |
| 507 | Ga0501084_0203069 | 3300054114 | Bacteria | 1672 |
| 508 | Ga0501082_1087301 | 3300060353 | Bacteria | 699 |
| 509 | Ga0466962_0003550 | 3300061719 | Bacteria | 7429 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005539 | Ga0068853_100482221 | Ga0068853_1004822212 | 137 |
| 2 | 3300005563 | Ga0068855_100329030 | Ga0068855_1003290302 | 137 |
| 3 | 3300005334 | Ga0068869_100546648 | Ga0068869_1005466482 | 143 |
| 4 | 3300013297 | Ga0157378_10816196 | Ga0157378_108161961 | 143 |
| 5 | 3300025942 | Ga0207689_11053744 | Ga0207689_110537441 | 143 |
| 6 | 3300026023 | Ga0207677_10307959 | Ga0207677_103079592 | 143 |
| 7 | 3300026041 | Ga0207639_10148486 | Ga0207639_101484862 | 148 |
| 8 | 3300025937 | Ga0207669_10835805 | Ga0207669_108358051 | 150 |
| 9 | 3300005456 | Ga0070678_100676638 | Ga0070678_1006766382 | 152 |
| 10 | 3300006358 | Ga0068871_100487338 | Ga0068871_1004873382 | 152 |
| 11 | 3300025908 | Ga0207643_10139946 | Ga0207643_101399462 | 152 |
| 12 | 3300025940 | Ga0207691_10010650 | Ga0207691_100106502 | 152 |
| 13 | 3300026121 | Ga0207683_10713034 | Ga0207683_107130341 | 152 |
| 14 | 3300005333 | Ga0070677_10062039 | Ga0070677_100620392 | 153 |
| 15 | 3300005364 | Ga0070673_100035269 | Ga0070673_1000352692 | 153 |
| 16 | 3300005543 | Ga0070672_100028585 | Ga0070672_1000285853 | 153 |
| 17 | 3300013308 | Ga0157375_10046462 | Ga0157375_100464623 | 153 |
| 18 | 3300014326 | Ga0157380_10187138 | Ga0157380_101871381 | 153 |
| 19 | 3300017792 | Ga0163161_10319545 | Ga0163161_103195452 | 153 |
| 20 | 3300025893 | Ga0207682_10081943 | Ga0207682_100819431 | 153 |
| 21 | 3300025960 | Ga0207651_10035846 | Ga0207651_100358462 | 153 |
| 22 | 3300026089 | Ga0207648_10470528 | Ga0207648_104705282 | 154 |
| 23 | 3300003322 | rootL2_10064875 | rootL2_100648752 | 155 |
| 24 | 3300006237 | Ga0097621_100351570 | Ga0097621_1003515702 | 155 |
| 25 | 3300005327 | Ga0070658_10436159 | Ga0070658_104361592 | 157 |
| 26 | 3300005337 | Ga0070682_100063243 | Ga0070682_1000632432 | 157 |
| 27 | 3300005339 | Ga0070660_100023642 | Ga0070660_1000236424 | 157 |
| 28 | 3300005458 | Ga0070681_10513165 | Ga0070681_105131651 | 157 |
| 29 | 3300005530 | Ga0070679_100049146 | Ga0070679_1000491465 | 157 |
| 30 | 3300005535 | Ga0070684_100343145 | Ga0070684_1003431452 | 157 |
| 31 | 3300005563 | Ga0068855_100441910 | Ga0068855_1004419102 | 157 |
| 32 | 3300005614 | Ga0068856_100375173 | Ga0068856_1003751731 | 157 |
| 33 | 3300005616 | Ga0068852_100024208 | Ga0068852_1000242082 | 157 |
| 34 | 3300005616 | Ga0068852_100299872 | Ga0068852_1002998722 | 157 |
| 35 | 3300009093 | Ga0105240_10104502 | Ga0105240_101045025 | 157 |
| 36 | 3300009174 | Ga0105241_10218074 | Ga0105241_102180741 | 157 |
| 37 | 3300009545 | Ga0105237_10121782 | Ga0105237_101217822 | 157 |
| 38 | 3300013100 | Ga0157373_10006304 | Ga0157373_100063045 | 157 |
| 39 | 3300013102 | Ga0157371_10000231 | Ga0157371_1000023152 | 157 |
| 40 | 3300013102 | Ga0157371_10371717 | Ga0157371_103717171 | 157 |
| 41 | 3300013105 | Ga0157369_10008917 | Ga0157369_100089177 | 157 |
| 42 | 3300013105 | Ga0157369_10610701 | Ga0157369_106107012 | 157 |
| 43 | 3300025911 | Ga0207654_10293169 | Ga0207654_102931691 | 157 |
| 44 | 3300025912 | Ga0207707_10632508 | Ga0207707_106325081 | 157 |
| 45 | 3300025914 | Ga0207671_10077204 | Ga0207671_100772041 | 157 |
| 46 | 3300025921 | Ga0207652_10211212 | Ga0207652_102112122 | 157 |
| 47 | 3300025949 | Ga0207667_10083362 | Ga0207667_100833622 | 157 |
| 48 | 3300026041 | Ga0207639_10332934 | Ga0207639_103329342 | 157 |
| 49 | 3300026078 | Ga0207702_10029450 | Ga0207702_100294502 | 157 |
| 50 | 3300026142 | Ga0207698_10251970 | Ga0207698_102519701 | 157 |
| 51 | 3300053090 | Ga0500646_0018484 | Ga0500646_0018484_979_1476 | 157 |
| 52 | 3300005331 | Ga0070670_100779551 | Ga0070670_1007795512 | 158 |
| 53 | 3300005353 | Ga0070669_100390722 | Ga0070669_1003907221 | 158 |
| 54 | 3300005354 | Ga0070675_100127665 | Ga0070675_1001276652 | 158 |
| 55 | 3300005367 | Ga0070667_100712816 | Ga0070667_1007128161 | 158 |
| 56 | 3300005456 | Ga0070678_100603339 | Ga0070678_1006033392 | 158 |
| 57 | 3300005459 | Ga0068867_100204309 | Ga0068867_1002043091 | 158 |
| 58 | 3300005563 | Ga0068855_100194900 | Ga0068855_1001949002 | 158 |
| 59 | 3300005617 | Ga0068859_100011757 | Ga0068859_1000117572 | 158 |
| 60 | 3300005618 | Ga0068864_100066191 | Ga0068864_1000661913 | 158 |
| 61 | 3300005618 | Ga0068864_100114482 | Ga0068864_1001144822 | 158 |
| 62 | 3300005843 | Ga0068860_100003819 | Ga0068860_1000038198 | 158 |
| 63 | 3300005844 | Ga0068862_100185151 | Ga0068862_1001851512 | 158 |
| 64 | 3300006237 | Ga0097621_100289477 | Ga0097621_1002894772 | 158 |
| 65 | 3300006931 | Ga0097620_100011757 | Ga0097620_1000117572 | 158 |
| 66 | 3300009553 | Ga0105249_11417340 | Ga0105249_114173401 | 158 |
| 67 | 3300013102 | Ga0157371_10003438 | Ga0157371_1000343814 | 158 |
| 68 | 3300013102 | Ga0157371_10036236 | Ga0157371_100362363 | 158 |
| 69 | 3300013104 | Ga0157370_10004240 | Ga0157370_100042406 | 158 |
| 70 | 3300013306 | Ga0163162_10241057 | Ga0163162_102410571 | 158 |
| 71 | 3300013306 | Ga0163162_10664778 | Ga0163162_106647782 | 158 |
| 72 | 3300013307 | Ga0157372_10011158 | Ga0157372_100111586 | 158 |
| 73 | 3300013307 | Ga0157372_11502729 | Ga0157372_115027291 | 158 |
| 74 | 3300014325 | Ga0163163_10765924 | Ga0163163_107659242 | 158 |
| 75 | 3300014745 | Ga0157377_10629706 | Ga0157377_106297061 | 158 |
| 76 | 3300025923 | Ga0207681_10322417 | Ga0207681_103224172 | 158 |
| 77 | 3300025925 | Ga0207650_10666110 | Ga0207650_106661101 | 158 |
| 78 | 3300025926 | Ga0207659_10194337 | Ga0207659_101943372 | 158 |
| 79 | 3300025945 | Ga0207679_10797070 | Ga0207679_107970702 | 158 |
| 80 | 3300025949 | Ga0207667_10153264 | Ga0207667_101532643 | 158 |
| 81 | 3300025972 | Ga0207668_10085857 | Ga0207668_100858572 | 158 |
| 82 | 3300025986 | Ga0207658_10348834 | Ga0207658_103488341 | 158 |
| 83 | 3300026041 | Ga0207639_11385088 | Ga0207639_113850881 | 158 |
| 84 | 3300026095 | Ga0207676_10286694 | Ga0207676_102866942 | 158 |
| 85 | 3300026095 | Ga0207676_11499950 | Ga0207676_114999501 | 158 |
| 86 | 3300028380 | Ga0268265_10023924 | Ga0268265_100239241 | 158 |
| 87 | 3300028381 | Ga0268264_10006272 | Ga0268264_100062723 | 158 |
| 88 | 3300049570 | Ga0501033_0010981 | Ga0501033_0010981_1984_2460 | 158 |
| 89 | 3300049571 | Ga0501034_0027873 | Ga0501034_0027873_592_1068 | 158 |
| 90 | 3300049574 | Ga0501038_0205683 | Ga0501038_0205683_168_644 | 158 |
| 91 | 3300049586 | Ga0501070_0131161 | Ga0501070_0131161_857_1333 | 158 |
| 92 | 3300049823 | Ga0501044_0111919 | Ga0501044_0111919_1237_1713 | 158 |
| 93 | 3300005327 | Ga0070658_11254747 | Ga0070658_112547471 | 159 |
| 94 | 3300005329 | Ga0070683_100177446 | Ga0070683_1001774462 | 159 |
| 95 | 3300005530 | Ga0070679_100159630 | Ga0070679_1001596301 | 159 |
| 96 | 3300005563 | Ga0068855_100109802 | Ga0068855_1001098021 | 159 |
| 97 | 3300005843 | Ga0068860_100547409 | Ga0068860_1005474091 | 159 |
| 98 | 3300006195 | Ga0075366_10159807 | Ga0075366_101598073 | 159 |
| 99 | 3300013102 | Ga0157371_10643113 | Ga0157371_106431131 | 159 |
| 100 | 3300013104 | Ga0157370_11078328 | Ga0157370_110783281 | 159 |
| 101 | 3300013306 | Ga0163162_10181279 | Ga0163162_101812793 | 159 |
| 102 | 3300025914 | Ga0207671_10089454 | Ga0207671_100894542 | 159 |
| 103 | 3300025919 | Ga0207657_10026230 | Ga0207657_100262304 | 159 |
| 104 | 3300025921 | Ga0207652_10155714 | Ga0207652_101557141 | 159 |
| 105 | 3300025944 | Ga0207661_10322149 | Ga0207661_103221492 | 159 |
| 106 | 3300025949 | Ga0207667_10233454 | Ga0207667_102334542 | 159 |
| 107 | 3300037312 | Ga0395899_0000528 | Ga0395899_0000528_29148_29627 | 159 |
| 108 | 3300037418 | Ga0395900_0002692 | Ga0395900_0002692_63_542 | 159 |
| 109 | 3300037466 | Ga0395898_0000595 | Ga0395898_0000595_27161_27640 | 159 |
| 110 | 3300038443 | Ga0395901_0005353 | Ga0395901_0005353_2232_2711 | 159 |
| 111 | 3300046660 | Ga0495625_0600043 | Ga0495625_0600043_49_531 | 159 |
| 112 | 3300049570 | Ga0501033_0031125 | Ga0501033_0031125_2086_2565 | 159 |
| 113 | 3300049571 | Ga0501034_0037584 | Ga0501034_0037584_2081_2560 | 159 |
| 114 | 3300049575 | Ga0501039_0254150 | Ga0501039_0254150_409_888 | 159 |
| 115 | 3300005539 | Ga0068853_100000197 | Ga0068853_10000019727 | 160 |
| 116 | 3300005563 | Ga0068855_100182049 | Ga0068855_1001820492 | 160 |
| 117 | 3300005614 | Ga0068856_100083452 | Ga0068856_1000834524 | 160 |
| 118 | 3300005843 | Ga0068860_100005157 | Ga0068860_1000051571 | 160 |
| 119 | 3300006844 | Ga0075428_100193784 | Ga0075428_1001937843 | 160 |
| 120 | 3300006846 | Ga0075430_100355123 | Ga0075430_1003551231 | 160 |
| 121 | 3300006847 | Ga0075431_100020645 | Ga0075431_1000206453 | 160 |
| 122 | 3300009093 | Ga0105240_10024327 | Ga0105240_100243272 | 160 |
| 123 | 3300009147 | Ga0114129_10084409 | Ga0114129_100844094 | 160 |
| 124 | 3300009174 | Ga0105241_10131388 | Ga0105241_101313882 | 160 |
| 125 | 3300009545 | Ga0105237_10008043 | Ga0105237_100080437 | 160 |
| 126 | 3300009545 | Ga0105237_10009512 | Ga0105237_100095124 | 160 |
| 127 | 3300009545 | Ga0105237_10012937 | Ga0105237_100129374 | 160 |
| 128 | 3300009551 | Ga0105238_10074065 | Ga0105238_100740653 | 160 |
| 129 | 3300009551 | Ga0105238_10128549 | Ga0105238_101285492 | 160 |
| 130 | 3300010375 | Ga0105239_10000760 | Ga0105239_1000076011 | 160 |
| 131 | 3300010375 | Ga0105239_10002155 | Ga0105239_100021557 | 160 |
| 132 | 3300010375 | Ga0105239_10025615 | Ga0105239_100256152 | 160 |
| 133 | 3300010375 | Ga0105239_10077689 | Ga0105239_100776893 | 160 |
| 134 | 3300010375 | Ga0105239_10301860 | Ga0105239_103018602 | 160 |
| 135 | 3300010375 | Ga0105239_10545314 | Ga0105239_105453143 | 160 |
| 136 | 3300013296 | Ga0157374_10000002 | Ga0157374_10000002244 | 160 |
| 137 | 3300013296 | Ga0157374_10668410 | Ga0157374_106684101 | 160 |
| 138 | 3300013306 | Ga0163162_10000972 | Ga0163162_1000097217 | 160 |
| 139 | 3300013307 | Ga0157372_10050163 | Ga0157372_100501632 | 160 |
| 140 | 3300014969 | Ga0157376_10001744 | Ga0157376_100017443 | 160 |
| 141 | 3300025913 | Ga0207695_10000016 | Ga0207695_1000001679 | 160 |
| 142 | 3300025913 | Ga0207695_10000296 | Ga0207695_1000029672 | 160 |
| 143 | 3300025913 | Ga0207695_10036297 | Ga0207695_100362973 | 160 |
| 144 | 3300025913 | Ga0207695_10050912 | Ga0207695_100509126 | 160 |
| 145 | 3300025914 | Ga0207671_10011496 | Ga0207671_100114964 | 160 |
| 146 | 3300025914 | Ga0207671_10016235 | Ga0207671_100162353 | 160 |
| 147 | 3300025924 | Ga0207694_10093751 | Ga0207694_100937512 | 160 |
| 148 | 3300025924 | Ga0207694_10135391 | Ga0207694_101353912 | 160 |
| 149 | 3300025949 | Ga0207667_10148492 | Ga0207667_101484923 | 160 |
| 150 | 3300026041 | Ga0207639_10076414 | Ga0207639_100764142 | 160 |
| 151 | 3300026078 | Ga0207702_10087567 | Ga0207702_100875671 | 160 |
| 152 | 3300027876 | Ga0209974_10059969 | Ga0209974_100599692 | 160 |
| 153 | 3300028381 | Ga0268264_10006312 | Ga0268264_1000631210 | 160 |
| 154 | 3300031507 | Ga0307509_10121639 | Ga0307509_101216392 | 160 |
| 155 | 3300031595 | Ga0265313_10118642 | Ga0265313_101186422 | 160 |
| 156 | 3300044693 | Ga0466961_0016976 | Ga0466961_0016976_3123_3617 | 160 |
| 157 | 3300044706 | Ga0466964_0329776 | Ga0466964_0329776_53_547 | 160 |
| 158 | 3300044719 | Ga0466971_0016800 | Ga0466971_0016800_2063_2557 | 160 |
| 159 | 3300045049 | Ga0466959_0004171 | Ga0466959_0004171_2438_2932 | 160 |
| 160 | 3300045049 | Ga0466959_0727761 | Ga0466959_0727761_91_585 | 160 |
| 161 | 3300045836 | Ga0466958_0260844 | Ga0466958_0260844_98_592 | 160 |
| 162 | 3300046460 | Ga0495638_0071960 | Ga0495638_0071960_1088_1582 | 160 |
| 163 | 3300046472 | Ga0495580_0394411 | Ga0495580_0394411_109_591 | 160 |
| 164 | 3300046648 | Ga0495611_0000983 | Ga0495611_0000983_10582_11076 | 160 |
| 165 | 3300046694 | Ga0495649_0369252 | Ga0495649_0369252_208_702 | 160 |
| 166 | 3300047472 | Ga0495686_0000016 | Ga0495686_0000016_130684_131178 | 160 |
| 167 | 3300050507 | nmdc:mga05p37_143831_c1 | nmdc:mga05p37_143831_c1_1068_1580 | 160 |
| 168 | 3300050510 | nmdc:mga06r32_7936_c1 | nmdc:mga06r32_7936_c1_1186_1698 | 160 |
| 169 | 3300053146 | Ga0500588_0014745 | Ga0500588_0014745_714_1208 | 160 |
| 170 | 3300053178 | Ga0500637_0479009 | Ga0500637_0479009_10_504 | 160 |
| 171 | 3300061719 | Ga0466962_0003550 | Ga0466962_0003550_3531_4025 | 160 |
| 172 | 3300005327 | Ga0070658_10830043 | Ga0070658_108300431 | 161 |
| 173 | 3300005328 | Ga0070676_10619534 | Ga0070676_106195342 | 161 |
| 174 | 3300005329 | Ga0070683_100223616 | Ga0070683_1002236162 | 161 |
| 175 | 3300005331 | Ga0070670_100466189 | Ga0070670_1004661892 | 161 |
| 176 | 3300005336 | Ga0070680_100006070 | Ga0070680_1000060706 | 161 |
| 177 | 3300005337 | Ga0070682_100001134 | Ga0070682_10000113418 | 161 |
| 178 | 3300005338 | Ga0068868_100016170 | Ga0068868_1000161705 | 161 |
| 179 | 3300005339 | Ga0070660_100040633 | Ga0070660_1000406332 | 161 |
| 180 | 3300005341 | Ga0070691_10002118 | Ga0070691_100021183 | 161 |
| 181 | 3300005365 | Ga0070688_100244028 | Ga0070688_1002440282 | 161 |
| 182 | 3300005367 | Ga0070667_100008567 | Ga0070667_1000085672 | 161 |
| 183 | 3300005455 | Ga0070663_100151454 | Ga0070663_1001514542 | 161 |
| 184 | 3300005458 | Ga0070681_10070892 | Ga0070681_100708924 | 161 |
| 185 | 3300005466 | Ga0070685_10062766 | Ga0070685_100627662 | 161 |
| 186 | 3300005530 | Ga0070679_100000158 | Ga0070679_1000001585 | 161 |
| 187 | 3300005530 | Ga0070679_100161022 | Ga0070679_1001610221 | 161 |
| 188 | 3300005530 | Ga0070679_101137678 | Ga0070679_1011376781 | 161 |
| 189 | 3300005535 | Ga0070684_100336725 | Ga0070684_1003367252 | 161 |
| 190 | 3300005539 | Ga0068853_100033260 | Ga0068853_1000332603 | 161 |
| 191 | 3300005543 | Ga0070672_100522258 | Ga0070672_1005222582 | 161 |
| 192 | 3300005547 | Ga0070693_100060508 | Ga0070693_1000605083 | 161 |
| 193 | 3300005563 | Ga0068855_100002992 | Ga0068855_10000299212 | 161 |
| 194 | 3300005563 | Ga0068855_100005888 | Ga0068855_10000588814 | 161 |
| 195 | 3300005563 | Ga0068855_100017175 | Ga0068855_1000171752 | 161 |
| 196 | 3300005563 | Ga0068855_100145564 | Ga0068855_1001455643 | 161 |
| 197 | 3300005577 | Ga0068857_101619928 | Ga0068857_1016199281 | 161 |
| 198 | 3300005578 | Ga0068854_100073685 | Ga0068854_1000736853 | 161 |
| 199 | 3300005578 | Ga0068854_100336052 | Ga0068854_1003360524 | 161 |
| 200 | 3300005614 | Ga0068856_100632479 | Ga0068856_1006324791 | 161 |
| 201 | 3300005616 | Ga0068852_101055341 | Ga0068852_1010553411 | 161 |
| 202 | 3300005617 | Ga0068859_100064691 | Ga0068859_1000646912 | 161 |
| 203 | 3300005617 | Ga0068859_100142962 | Ga0068859_1001429622 | 161 |
| 204 | 3300005618 | Ga0068864_100269881 | Ga0068864_1002698813 | 161 |
| 205 | 3300005719 | Ga0068861_100592422 | Ga0068861_1005924222 | 161 |
| 206 | 3300005834 | Ga0068851_10080692 | Ga0068851_100806923 | 161 |
| 207 | 3300005841 | Ga0068863_100017497 | Ga0068863_1000174974 | 161 |
| 208 | 3300005843 | Ga0068860_100019538 | Ga0068860_1000195384 | 161 |
| 209 | 3300005843 | Ga0068860_100030900 | Ga0068860_1000309006 | 161 |
| 210 | 3300005844 | Ga0068862_100960039 | Ga0068862_1009600392 | 161 |
| 211 | 3300006237 | Ga0097621_100063023 | Ga0097621_1000630232 | 161 |
| 212 | 3300006237 | Ga0097621_100314087 | Ga0097621_1003140872 | 161 |
| 213 | 3300006358 | Ga0068871_100003787 | Ga0068871_1000037871 | 161 |
| 214 | 3300006358 | Ga0068871_100207190 | Ga0068871_1002071902 | 161 |
| 215 | 3300006358 | Ga0068871_100264827 | Ga0068871_1002648273 | 161 |
| 216 | 3300006881 | Ga0068865_100490979 | Ga0068865_1004909791 | 161 |
| 217 | 3300006931 | Ga0097620_100064693 | Ga0097620_1000646932 | 161 |
| 218 | 3300006931 | Ga0097620_100142962 | Ga0097620_1001429622 | 161 |
| 219 | 3300009093 | Ga0105240_10002290 | Ga0105240_1000229019 | 161 |
| 220 | 3300009093 | Ga0105240_10008150 | Ga0105240_100081502 | 161 |
| 221 | 3300009093 | Ga0105240_11125669 | Ga0105240_111256692 | 161 |
| 222 | 3300009098 | Ga0105245_10172951 | Ga0105245_101729514 | 161 |
| 223 | 3300009174 | Ga0105241_10001224 | Ga0105241_100012245 | 161 |
| 224 | 3300009176 | Ga0105242_10542644 | Ga0105242_105426441 | 161 |
| 225 | 3300009553 | Ga0105249_10997829 | Ga0105249_109978292 | 161 |
| 226 | 3300010159 | Ga0099796_10113634 | Ga0099796_101136341 | 161 |
| 227 | 3300011119 | Ga0105246_10186652 | Ga0105246_101866522 | 161 |
| 228 | 3300013100 | Ga0157373_10033843 | Ga0157373_100338432 | 161 |
| 229 | 3300013100 | Ga0157373_10435931 | Ga0157373_104359312 | 161 |
| 230 | 3300013102 | Ga0157371_10001159 | Ga0157371_1000115917 | 161 |
| 231 | 3300013102 | Ga0157371_10007512 | Ga0157371_100075122 | 161 |
| 232 | 3300013102 | Ga0157371_10838192 | Ga0157371_108381921 | 161 |
| 233 | 3300013104 | Ga0157370_10004630 | Ga0157370_100046306 | 161 |
| 234 | 3300013104 | Ga0157370_10019132 | Ga0157370_100191322 | 161 |
| 235 | 3300013104 | Ga0157370_10036554 | Ga0157370_100365546 | 161 |
| 236 | 3300013104 | Ga0157370_10192331 | Ga0157370_101923313 | 161 |
| 237 | 3300013104 | Ga0157370_10328199 | Ga0157370_103281992 | 161 |
| 238 | 3300013104 | Ga0157370_10422643 | Ga0157370_104226432 | 161 |
| 239 | 3300013104 | Ga0157370_10521704 | Ga0157370_105217042 | 161 |
| 240 | 3300013105 | Ga0157369_10053730 | Ga0157369_100537306 | 161 |
| 241 | 3300013105 | Ga0157369_10167210 | Ga0157369_101672102 | 161 |
| 242 | 3300013105 | Ga0157369_10228452 | Ga0157369_102284523 | 161 |
| 243 | 3300013105 | Ga0157369_10549196 | Ga0157369_105491962 | 161 |
| 244 | 3300013296 | Ga0157374_11503109 | Ga0157374_115031092 | 161 |
| 245 | 3300013297 | Ga0157378_10296177 | Ga0157378_102961773 | 161 |
| 246 | 3300013297 | Ga0157378_10827880 | Ga0157378_108278802 | 161 |
| 247 | 3300013306 | Ga0163162_10079020 | Ga0163162_100790202 | 161 |
| 248 | 3300013307 | Ga0157372_10009422 | Ga0157372_1000942210 | 161 |
| 249 | 3300013307 | Ga0157372_10122871 | Ga0157372_101228714 | 161 |
| 250 | 3300013307 | Ga0157372_10146224 | Ga0157372_101462243 | 161 |
| 251 | 3300013307 | Ga0157372_10170081 | Ga0157372_101700812 | 161 |
| 252 | 3300013308 | Ga0157375_11550859 | Ga0157375_115508591 | 161 |
| 253 | 3300014325 | Ga0163163_10334406 | Ga0163163_103344062 | 161 |
| 254 | 3300014325 | Ga0163163_10884256 | Ga0163163_108842562 | 161 |
| 255 | 3300014968 | Ga0157379_10547664 | Ga0157379_105476641 | 161 |
| 256 | 3300014968 | Ga0157379_10667911 | Ga0157379_106679112 | 161 |
| 257 | 3300014969 | Ga0157376_10041214 | Ga0157376_100412144 | 161 |
| 258 | 3300014969 | Ga0157376_10228294 | Ga0157376_102282942 | 161 |
| 259 | 3300025899 | Ga0207642_10188569 | Ga0207642_101885692 | 161 |
| 260 | 3300025909 | Ga0207705_10017824 | Ga0207705_100178244 | 161 |
| 261 | 3300025909 | Ga0207705_10039758 | Ga0207705_100397581 | 161 |
| 262 | 3300025909 | Ga0207705_10280507 | Ga0207705_102805072 | 161 |
| 263 | 3300025909 | Ga0207705_10425614 | Ga0207705_104256142 | 161 |
| 264 | 3300025911 | Ga0207654_10010152 | Ga0207654_100101528 | 161 |
| 265 | 3300025912 | Ga0207707_10001194 | Ga0207707_1000119422 | 161 |
| 266 | 3300025912 | Ga0207707_10544669 | Ga0207707_105446692 | 161 |
| 267 | 3300025913 | Ga0207695_10014807 | Ga0207695_1001480712 | 161 |
| 268 | 3300025913 | Ga0207695_10027822 | Ga0207695_100278224 | 161 |
| 269 | 3300025917 | Ga0207660_10001003 | Ga0207660_1000100314 | 161 |
| 270 | 3300025917 | Ga0207660_10012933 | Ga0207660_100129335 | 161 |
| 271 | 3300025919 | Ga0207657_10134790 | Ga0207657_101347902 | 161 |
| 272 | 3300025921 | Ga0207652_10000013 | Ga0207652_1000001310 | 161 |
| 273 | 3300025921 | Ga0207652_10002368 | Ga0207652_1000236815 | 161 |
| 274 | 3300025921 | Ga0207652_10036890 | Ga0207652_100368902 | 161 |
| 275 | 3300025921 | Ga0207652_10736152 | Ga0207652_107361522 | 161 |
| 276 | 3300025925 | Ga0207650_10079862 | Ga0207650_100798622 | 161 |
| 277 | 3300025926 | Ga0207659_11116375 | Ga0207659_111163751 | 161 |
| 278 | 3300025931 | Ga0207644_10330205 | Ga0207644_103302052 | 161 |
| 279 | 3300025940 | Ga0207691_10129293 | Ga0207691_101292932 | 161 |
| 280 | 3300025949 | Ga0207667_10001138 | Ga0207667_1000113810 | 161 |
| 281 | 3300025949 | Ga0207667_10110926 | Ga0207667_101109262 | 161 |
| 282 | 3300025981 | Ga0207640_10427772 | Ga0207640_104277722 | 161 |
| 283 | 3300025986 | Ga0207658_10009067 | Ga0207658_100090677 | 161 |
| 284 | 3300026023 | Ga0207677_10003369 | Ga0207677_100033692 | 161 |
| 285 | 3300026067 | Ga0207678_10230143 | Ga0207678_102301432 | 161 |
| 286 | 3300026078 | Ga0207702_10086907 | Ga0207702_100869073 | 161 |
| 287 | 3300026118 | Ga0207675_100411993 | Ga0207675_1004119932 | 161 |
| 288 | 3300026118 | Ga0207675_100949999 | Ga0207675_1009499991 | 161 |
| 289 | 3300028381 | Ga0268264_10006818 | Ga0268264_100068186 | 161 |
| 290 | 3300028381 | Ga0268264_10012637 | Ga0268264_100126374 | 161 |
| 291 | 3300028786 | Ga0307517_10021498 | Ga0307517_100214987 | 161 |
| 292 | 3300028800 | Ga0265338_10941828 | Ga0265338_109418282 | 161 |
| 293 | 3300031344 | Ga0265316_10482424 | Ga0265316_104824241 | 161 |
| 294 | 3300031730 | Ga0307516_10001379 | Ga0307516_1000137917 | 161 |
| 295 | 3300032004 | Ga0307414_10861600 | Ga0307414_108616002 | 161 |
| 296 | 3300033180 | Ga0307510_10003610 | Ga0307510_100036104 | 161 |
| 297 | 3300035113 | Ga0373936_0101579 | Ga0373936_0101579_526_1011 | 161 |
| 298 | 3300037312 | Ga0395899_0005868 | Ga0395899_0005868_5077_5562 | 161 |
| 299 | 3300037312 | Ga0395899_0061355 | Ga0395899_0061355_1947_2432 | 161 |
| 300 | 3300037312 | Ga0395899_0189490 | Ga0395899_0189490_717_1202 | 161 |
| 301 | 3300037418 | Ga0395900_0010753 | Ga0395900_0010753_3909_4394 | 161 |
| 302 | 3300037418 | Ga0395900_0039526 | Ga0395900_0039526_2914_3399 | 161 |
| 303 | 3300037418 | Ga0395900_0390237 | Ga0395900_0390237_384_869 | 161 |
| 304 | 3300037418 | Ga0395900_0776360 | Ga0395900_0776360_136_621 | 161 |
| 305 | 3300037466 | Ga0395898_0053435 | Ga0395898_0053435_1271_1756 | 161 |
| 306 | 3300037466 | Ga0395898_0075689 | Ga0395898_0075689_826_1311 | 161 |
| 307 | 3300037466 | Ga0395898_1353893 | Ga0395898_1353893_97_582 | 161 |
| 308 | 3300037471 | Ga0395905_0007136 | Ga0395905_0007136_9729_10214 | 161 |
| 309 | 3300037471 | Ga0395905_0528286 | Ga0395905_0528286_291_776 | 161 |
| 310 | 3300038443 | Ga0395901_0047717 | Ga0395901_0047717_2367_2852 | 161 |
| 311 | 3300038443 | Ga0395901_0174479 | Ga0395901_0174479_329_814 | 161 |
| 312 | 3300038443 | Ga0395901_0789469 | Ga0395901_0789469_253_738 | 161 |
| 313 | 3300038443 | Ga0395901_1051080 | Ga0395901_1051080_44_529 | 161 |
| 314 | 3300046471 | Ga0495650_0119793 | Ga0495650_0119793_172_657 | 161 |
| 315 | 3300046507 | Ga0495606_0008778 | Ga0495606_0008778_4245_4742 | 161 |
| 316 | 3300049571 | Ga0501034_0178622 | Ga0501034_0178622_761_1255 | 161 |
| 317 | 3300049580 | Ga0501046_0304168 | Ga0501046_0304168_440_934 | 161 |
| 318 | 3300049581 | Ga0501047_0112205 | Ga0501047_0112205_408_902 | 161 |
| 319 | 3300049583 | Ga0501067_0006335 | Ga0501067_0006335_411_905 | 161 |
| 320 | 3300049584 | Ga0501068_0513740 | Ga0501068_0513740_227_721 | 161 |
| 321 | 3300049586 | Ga0501070_0124607 | Ga0501070_0124607_808_1302 | 161 |
| 322 | 3300049588 | Ga0501072_0627396 | Ga0501072_0627396_215_709 | 161 |
| 323 | 3300049589 | Ga0501073_0121334 | Ga0501073_0121334_1218_1712 | 161 |
| 324 | 3300049590 | Ga0501074_0653992 | Ga0501074_0653992_19_513 | 161 |
| 325 | 3300049703 | Ga0501219_000085 | Ga0501219_000085_2413_2931 | 161 |
| 326 | 3300049705 | Ga0501225_0048200 | Ga0501225_0048200_323_841 | 161 |
| 327 | 3300049741 | Ga0501079_0093112 | Ga0501079_0093112_1764_2258 | 161 |
| 328 | 3300049744 | Ga0501083_0037903 | Ga0501083_0037903_2004_2498 | 161 |
| 329 | 3300049758 | Ga0501241_016123 | Ga0501241_016123_152_670 | 161 |
| 330 | 3300049822 | Ga0501035_1104770 | Ga0501035_1104770_17_502 | 161 |
| 331 | 3300049823 | Ga0501044_0119837 | Ga0501044_0119837_1883_2377 | 161 |
| 332 | 3300050005 | Ga0501284_00074 | Ga0501284_00074_7543_8061 | 161 |
| 333 | 3300053090 | Ga0500646_0137592 | Ga0500646_0137592_206_691 | 161 |
| 334 | 3300054114 | Ga0501084_0203069 | Ga0501084_0203069_130_624 | 161 |
| 335 | 3300060353 | Ga0501082_1087301 | Ga0501082_1087301_64_558 | 161 |
| 336 | 3300005339 | Ga0070660_100539006 | Ga0070660_1005390062 | 162 |
| 337 | 3300005548 | Ga0070665_101179616 | Ga0070665_1011796161 | 162 |
| 338 | 3300025972 | Ga0207668_10313711 | Ga0207668_103137111 | 162 |
| 339 | 3300049823 | Ga0501044_0074228 | Ga0501044_0074228_95_583 | 162 |
| 340 | 3300005330 | Ga0070690_100335719 | Ga0070690_1003357191 | 163 |
| 341 | 3300005334 | Ga0068869_100034416 | Ga0068869_1000344163 | 163 |
| 342 | 3300005335 | Ga0070666_10015364 | Ga0070666_100153643 | 163 |
| 343 | 3300005338 | Ga0068868_100147445 | Ga0068868_1001474453 | 163 |
| 344 | 3300005340 | Ga0070689_100855817 | Ga0070689_1008558171 | 163 |
| 345 | 3300005355 | Ga0070671_100013240 | Ga0070671_1000132405 | 163 |
| 346 | 3300005365 | Ga0070688_100579435 | Ga0070688_1005794352 | 163 |
| 347 | 3300005367 | Ga0070667_100001521 | Ga0070667_1000015218 | 163 |
| 348 | 3300005543 | Ga0070672_100085657 | Ga0070672_1000856573 | 163 |
| 349 | 3300005616 | Ga0068852_100127596 | Ga0068852_1001275964 | 163 |
| 350 | 3300005617 | Ga0068859_100000106 | Ga0068859_10000010618 | 163 |
| 351 | 3300005618 | Ga0068864_100009738 | Ga0068864_1000097386 | 163 |
| 352 | 3300005834 | Ga0068851_10028829 | Ga0068851_100288293 | 163 |
| 353 | 3300005841 | Ga0068863_100000567 | Ga0068863_10000056712 | 163 |
| 354 | 3300005842 | Ga0068858_100320417 | Ga0068858_1003204172 | 163 |
| 355 | 3300005843 | Ga0068860_100041189 | Ga0068860_1000411893 | 163 |
| 356 | 3300005844 | Ga0068862_100394342 | Ga0068862_1003943422 | 163 |
| 357 | 3300006358 | Ga0068871_100019773 | Ga0068871_1000197736 | 163 |
| 358 | 3300006931 | Ga0097620_100000106 | Ga0097620_10000010618 | 163 |
| 359 | 3300009098 | Ga0105245_10253669 | Ga0105245_102536692 | 163 |
| 360 | 3300009101 | Ga0105247_10019635 | Ga0105247_100196352 | 163 |
| 361 | 3300009148 | Ga0105243_11055129 | Ga0105243_110551291 | 163 |
| 362 | 3300009174 | Ga0105241_10002476 | Ga0105241_100024764 | 163 |
| 363 | 3300009176 | Ga0105242_10630168 | Ga0105242_106301682 | 163 |
| 364 | 3300009545 | Ga0105237_10003683 | Ga0105237_1000368317 | 163 |
| 365 | 3300009553 | Ga0105249_10002874 | Ga0105249_1000287416 | 163 |
| 366 | 3300010375 | Ga0105239_10060501 | Ga0105239_100605013 | 163 |
| 367 | 3300011119 | Ga0105246_10019431 | Ga0105246_100194312 | 163 |
| 368 | 3300011119 | Ga0105246_10085903 | Ga0105246_100859033 | 163 |
| 369 | 3300013296 | Ga0157374_10360233 | Ga0157374_103602332 | 163 |
| 370 | 3300013297 | Ga0157378_10667953 | Ga0157378_106679532 | 163 |
| 371 | 3300013308 | Ga0157375_10117318 | Ga0157375_101173182 | 163 |
| 372 | 3300014968 | Ga0157379_11042177 | Ga0157379_110421772 | 163 |
| 373 | 3300025321 | Ga0207656_10064115 | Ga0207656_100641152 | 163 |
| 374 | 3300025900 | Ga0207710_10010011 | Ga0207710_100100114 | 163 |
| 375 | 3300025903 | Ga0207680_10021255 | Ga0207680_100212553 | 163 |
| 376 | 3300025911 | Ga0207654_10002232 | Ga0207654_100022327 | 163 |
| 377 | 3300025914 | Ga0207671_10001029 | Ga0207671_100010295 | 163 |
| 378 | 3300025927 | Ga0207687_10392114 | Ga0207687_103921141 | 163 |
| 379 | 3300025934 | Ga0207686_10070326 | Ga0207686_100703262 | 163 |
| 380 | 3300025936 | Ga0207670_10169744 | Ga0207670_101697441 | 163 |
| 381 | 3300025940 | Ga0207691_10104179 | Ga0207691_101041792 | 163 |
| 382 | 3300025942 | Ga0207689_10000853 | Ga0207689_1000085317 | 163 |
| 383 | 3300025961 | Ga0207712_10002069 | Ga0207712_1000206913 | 163 |
| 384 | 3300025986 | Ga0207658_10010441 | Ga0207658_100104413 | 163 |
| 385 | 3300026023 | Ga0207677_10031649 | Ga0207677_100316492 | 163 |
| 386 | 3300026035 | Ga0207703_10003904 | Ga0207703_1000390412 | 163 |
| 387 | 3300026088 | Ga0207641_10000082 | Ga0207641_1000008270 | 163 |
| 388 | 3300026095 | Ga0207676_10005134 | Ga0207676_100051348 | 163 |
| 389 | 3300026118 | Ga0207675_101113695 | Ga0207675_1011136951 | 163 |
| 390 | 3300026142 | Ga0207698_10074014 | Ga0207698_100740143 | 163 |
| 391 | 3300028381 | Ga0268264_10030257 | Ga0268264_100302573 | 163 |
| 392 | 3300005327 | Ga0070658_10043686 | Ga0070658_100436862 | 164 |
| 393 | 3300005329 | Ga0070683_100571453 | Ga0070683_1005714532 | 164 |
| 394 | 3300005337 | Ga0070682_100012005 | Ga0070682_1000120052 | 164 |
| 395 | 3300005339 | Ga0070660_100014059 | Ga0070660_1000140592 | 164 |
| 396 | 3300005344 | Ga0070661_100352303 | Ga0070661_1003523031 | 164 |
| 397 | 3300005457 | Ga0070662_100756511 | Ga0070662_1007565111 | 164 |
| 398 | 3300005530 | Ga0070679_100000684 | Ga0070679_1000006848 | 164 |
| 399 | 3300005616 | Ga0068852_100001739 | Ga0068852_1000017395 | 164 |
| 400 | 3300005616 | Ga0068852_102253150 | Ga0068852_1022531501 | 164 |
| 401 | 3300005985 | Ga0081539_10001226 | Ga0081539_1000122623 | 164 |
| 402 | 3300009545 | Ga0105237_12324160 | Ga0105237_123241601 | 164 |
| 403 | 3300010375 | Ga0105239_10194993 | Ga0105239_101949932 | 164 |
| 404 | 3300013104 | Ga0157370_10169571 | Ga0157370_101695712 | 164 |
| 405 | 3300013105 | Ga0157369_10050745 | Ga0157369_100507453 | 164 |
| 406 | 3300013307 | Ga0157372_10092527 | Ga0157372_100925272 | 164 |
| 407 | 3300025909 | Ga0207705_10015146 | Ga0207705_100151465 | 164 |
| 408 | 3300025912 | Ga0207707_10332535 | Ga0207707_103325352 | 164 |
| 409 | 3300025919 | Ga0207657_10006170 | Ga0207657_100061706 | 164 |
| 410 | 3300025921 | Ga0207652_10005901 | Ga0207652_100059014 | 164 |
| 411 | 3300025944 | Ga0207661_10509389 | Ga0207661_105093892 | 164 |
| 412 | 3300026142 | Ga0207698_10004508 | Ga0207698_100045082 | 164 |
| 413 | 3300035083 | Ga0373926_0096882 | Ga0373926_0096882_233_742 | 164 |
| 414 | 3300035120 | Ga0373957_0384137 | Ga0373957_0384137_31_540 | 164 |
| 415 | 3300035410 | Ga0373924_0058123 | Ga0373924_0058123_702_1211 | 164 |
| 416 | 3300035692 | Ga0373935_0182666 | Ga0373935_0182666_365_874 | 164 |
| 417 | 3300035724 | Ga0373933_0133334 | Ga0373933_0133334_689_1198 | 164 |
| 418 | 3300036401 | Ga0373937_0153103 | Ga0373937_0153103_1092_1601 | 164 |
| 419 | 3300045976 | Ga0466967_0080611 | Ga0466967_0080611_2354_2848 | 164 |
| 420 | 3300046463 | Ga0495653_0100476 | Ga0495653_0100476_544_1053 | 164 |
| 421 | 3300046472 | Ga0495580_0682212 | Ga0495580_0682212_140_649 | 164 |
| 422 | 3300046511 | Ga0495608_0083467 | Ga0495608_0083467_395_904 | 164 |
| 423 | 3300046514 | Ga0495618_0046549 | Ga0495618_0046549_925_1434 | 164 |
| 424 | 3300046516 | Ga0495628_0181606 | Ga0495628_0181606_985_1494 | 164 |
| 425 | 3300046517 | Ga0495630_0034594 | Ga0495630_0034594_562_1071 | 164 |
| 426 | 3300046536 | Ga0495587_0024806 | Ga0495587_0024806_2865_3410 | 164 |
| 427 | 3300046559 | Ga0495667_0190088 | Ga0495667_0190088_539_1048 | 164 |
| 428 | 3300046683 | Ga0495658_0248580 | Ga0495658_0248580_36_545 | 164 |
| 429 | 3300046809 | Ga0495600_0104490 | Ga0495600_0104490_373_882 | 164 |
| 430 | 3300047319 | Ga0495674_0286954 | Ga0495674_0286954_248_757 | 164 |
| 431 | 3300047321 | Ga0495676_0330225 | Ga0495676_0330225_406_915 | 164 |
| 432 | 3300047471 | Ga0495684_0024797 | Ga0495684_0024797_1084_1593 | 164 |
| 433 | 3300025904 | Ga0207647_10014949 | Ga0207647_100149494 | 165 |
| 434 | 3300025949 | Ga0207667_10000583 | Ga0207667_100005832 | 165 |
| 435 | 3300005327 | Ga0070658_10068609 | Ga0070658_100686091 | 166 |
| 436 | 3300005458 | Ga0070681_10216029 | Ga0070681_102160291 | 166 |
| 437 | 3300005535 | Ga0070684_100438856 | Ga0070684_1004388561 | 166 |
| 438 | 3300005577 | Ga0068857_100057032 | Ga0068857_1000570323 | 166 |
| 439 | 3300013100 | Ga0157373_10055735 | Ga0157373_100557352 | 166 |
| 440 | 3300013102 | Ga0157371_10030010 | Ga0157371_100300102 | 166 |
| 441 | 3300013102 | Ga0157371_11395017 | Ga0157371_113950171 | 166 |
| 442 | 3300013105 | Ga0157369_10015498 | Ga0157369_100154982 | 166 |
| 443 | 3300013307 | Ga0157372_10527422 | Ga0157372_105274222 | 166 |
| 444 | 3300013307 | Ga0157372_11976833 | Ga0157372_119768331 | 166 |
| 445 | 3300025904 | Ga0207647_10208757 | Ga0207647_102087572 | 166 |
| 446 | 3300025909 | Ga0207705_10160955 | Ga0207705_101609551 | 166 |
| 447 | 3300025917 | Ga0207660_10332170 | Ga0207660_103321702 | 166 |
| 448 | 3300025921 | Ga0207652_10042375 | Ga0207652_100423752 | 166 |
| 449 | 3300026116 | Ga0207674_10034788 | Ga0207674_100347885 | 166 |
| 450 | 3300005327 | Ga0070658_10061316 | Ga0070658_100613162 | 167 |
| 451 | 3300005328 | Ga0070676_11175403 | Ga0070676_111754031 | 167 |
| 452 | 3300005329 | Ga0070683_100052913 | Ga0070683_1000529132 | 167 |
| 453 | 3300005330 | Ga0070690_100040602 | Ga0070690_1000406022 | 167 |
| 454 | 3300005336 | Ga0070680_100481268 | Ga0070680_1004812683 | 167 |
| 455 | 3300005337 | Ga0070682_100013837 | Ga0070682_1000138373 | 167 |
| 456 | 3300005338 | Ga0068868_100066319 | Ga0068868_1000663192 | 167 |
| 457 | 3300005339 | Ga0070660_100005499 | Ga0070660_1000054994 | 167 |
| 458 | 3300005344 | Ga0070661_100004914 | Ga0070661_1000049142 | 167 |
| 459 | 3300005354 | Ga0070675_100014996 | Ga0070675_1000149961 | 167 |
| 460 | 3300005355 | Ga0070671_100113381 | Ga0070671_1001133812 | 167 |
| 461 | 3300005364 | Ga0070673_100121772 | Ga0070673_1001217721 | 167 |
| 462 | 3300005366 | Ga0070659_100005352 | Ga0070659_1000053525 | 167 |
| 463 | 3300005444 | Ga0070694_100545011 | Ga0070694_1005450111 | 167 |
| 464 | 3300005456 | Ga0070678_100019337 | Ga0070678_1000193372 | 167 |
| 465 | 3300005457 | Ga0070662_100006981 | Ga0070662_1000069817 | 167 |
| 466 | 3300005535 | Ga0070684_100009329 | Ga0070684_1000093296 | 167 |
| 467 | 3300005539 | Ga0068853_100230718 | Ga0068853_1002307182 | 167 |
| 468 | 3300005543 | Ga0070672_100453183 | Ga0070672_1004531832 | 167 |
| 469 | 3300005544 | Ga0070686_100155697 | Ga0070686_1001556971 | 167 |
| 470 | 3300005547 | Ga0070693_100205561 | Ga0070693_1002055612 | 167 |
| 471 | 3300005563 | Ga0068855_100102486 | Ga0068855_1001024863 | 167 |
| 472 | 3300005564 | Ga0070664_100000950 | Ga0070664_10000095013 | 167 |
| 473 | 3300005578 | Ga0068854_100781931 | Ga0068854_1007819312 | 167 |
| 474 | 3300005614 | Ga0068856_100048103 | Ga0068856_1000481032 | 167 |
| 475 | 3300005841 | Ga0068863_100902052 | Ga0068863_1009020522 | 167 |
| 476 | 3300005842 | Ga0068858_101195948 | Ga0068858_1011959481 | 167 |
| 477 | 3300006237 | Ga0097621_100006863 | Ga0097621_1000068632 | 167 |
| 478 | 3300006358 | Ga0068871_100010171 | Ga0068871_1000101714 | 167 |
| 479 | 3300013100 | Ga0157373_10005254 | Ga0157373_100052542 | 167 |
| 480 | 3300013102 | Ga0157371_10024064 | Ga0157371_100240644 | 167 |
| 481 | 3300013104 | Ga0157370_10104499 | Ga0157370_101044992 | 167 |
| 482 | 3300013105 | Ga0157369_10043924 | Ga0157369_100439242 | 167 |
| 483 | 3300013296 | Ga0157374_10032223 | Ga0157374_100322234 | 167 |
| 484 | 3300013297 | Ga0157378_10008134 | Ga0157378_100081346 | 167 |
| 485 | 3300013306 | Ga0163162_10059671 | Ga0163162_100596714 | 167 |
| 486 | 3300013307 | Ga0157372_10069336 | Ga0157372_100693362 | 167 |
| 487 | 3300014745 | Ga0157377_10061600 | Ga0157377_100616003 | 167 |
| 488 | 3300014969 | Ga0157376_10186090 | Ga0157376_101860902 | 167 |
| 489 | 3300017792 | Ga0163161_10950830 | Ga0163161_109508301 | 167 |
| 490 | 3300025909 | Ga0207705_10702403 | Ga0207705_107024031 | 167 |
| 491 | 3300025917 | Ga0207660_10461622 | Ga0207660_104616221 | 167 |
| 492 | 3300025919 | Ga0207657_10004992 | Ga0207657_100049924 | 167 |
| 493 | 3300025920 | Ga0207649_10023819 | Ga0207649_100238191 | 167 |
| 494 | 3300025921 | Ga0207652_10554025 | Ga0207652_105540251 | 167 |
| 495 | 3300025931 | Ga0207644_10218405 | Ga0207644_102184051 | 167 |
| 496 | 3300025932 | Ga0207690_10042718 | Ga0207690_100427182 | 167 |
| 497 | 3300025933 | Ga0207706_10005696 | Ga0207706_100056965 | 167 |
| 498 | 3300025944 | Ga0207661_10434737 | Ga0207661_104347371 | 167 |
| 499 | 3300025945 | Ga0207679_10171795 | Ga0207679_101717952 | 167 |
| 500 | 3300025949 | Ga0207667_10176610 | Ga0207667_101766102 | 167 |
| 501 | 3300025960 | Ga0207651_10479788 | Ga0207651_104797882 | 167 |
| 502 | 3300025981 | Ga0207640_10166727 | Ga0207640_101667272 | 167 |
| 503 | 3300026035 | Ga0207703_10907799 | Ga0207703_109077991 | 167 |
| 504 | 3300026041 | Ga0207639_10023498 | Ga0207639_100234984 | 167 |
| 505 | 3300026078 | Ga0207702_10165092 | Ga0207702_101650922 | 167 |
| 506 | 3300026088 | Ga0207641_10784131 | Ga0207641_107841311 | 167 |
| 507 | 3300026121 | Ga0207683_10093471 | Ga0207683_100934713 | 167 |
| 508 | 3300005441 | Ga0070700_100706483 | Ga0070700_1007064831 | 169 |
| 509 | 3300003320 | rootH2_10087488 | rootH2_100874884 | 170 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7al5-assembly1.cif.gz_D | crystal structure of the selenomethionine substituted hypothetical protein pa1622 from pseudomonas aeruginosa pao1 | 0.39 | 34 | 101 |
| 6e8d-assembly1.cif.gz_A | crystal structure of the bacillus subtilis sliding clamp-mutl complex. | 0.3825 | 59 | 119 |
| 1s4b-assembly1.cif.gz_P | crystal structure of human thimet oligopeptidase. | 0.3375 | 29 | 148 |
| 8ity-assembly1.cif.gz_M | human rna polymerase iii pre-initiation complex closed dna 1 | 0.3222 | 61 | 144 |
| 2o36-assembly1.cif.gz_A | crystal structure of engineered thimet oligopeptidase with neurolysin specificity in neurotensin cleavage site | 0.3204 | 34 | 148 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8IZ41_3_75_1.10.238.10 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand | 0.4174 | 34 | 94 | 1.10.238.10 |
| af_Q8I568_671_747_3.30.70.870 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Elongation Factor G (Translational Gtpase), domain 3 | 0.3851 | 60 | 99 | 3.30.70.870 |
| 4ak1A04 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.3779 | 83 | 102 | 2.60.40.10 |
| af_P36048_600_676_3.30.70.870 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Elongation Factor G (Translational Gtpase), domain 3 | 0.3559 | 60 | 119 | 3.30.70.870 |
| af_Q55G92_457_533_3.30.70.870 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Elongation Factor G (Translational Gtpase), domain 3 | 0.3334 | 60 | 99 | 3.30.70.870 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A521N604-F1-model_v4 | YkgJ family cysteine cluster protein | 0.8924 | 61 | 117 |
|
| AF-A0A258MU31-F1-model_v4 | Zinc/iron-chelating domain-containing protein | 0.8907 | 6 | 156 |
|
| AF-A0A1M4Y8B0-F1-model_v4 | Zinc-or iron-chelating domain-containing protein | 0.8828 | 15 | 156 |
|
| AF-A0A4S8HPT7-F1-model_v4 | YkgJ family cysteine cluster protein | 0.8821 | 5 | 156 |
|
| AF-A0A1G3J9A4-F1-model_v4 | Fe-S-oxidoreductase | 0.8818 | 8 | 157 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar