F456992

General Info

Members Datasets Scaffolds Average Seq Length
509 216 509 165

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10010650|Ga0207691_100106502
Length 186
Sequence LYSVQGFWGLPVGTSINLAICLTSLLALKGKSYLCRMDLLQNWEKKSQDHQKEYKRYLQRAGKNHVLRNQHVFHEEAFEKVNKNYSPRFKTPDIKRISKLLKMKEGDFIQTYLRLDEEGDYVARSKPCPFLGDDNACSIYDQRPSDCSRFPYTDEDVLYKRQALTLKNSSFCPIVYYVIEKLMTVK

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
202 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
212 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
213 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 0
Rhizosphere 97.84
Stem 0
Stem Tuber 0
Unclassified 1.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10087488 3300003320 Bacteria 3499
2 rootL2_10064875 3300003322 Bacteria 7982
3 Ga0070658_10043686 3300005327 Bacteria 3620
4 Ga0070658_10061316 3300005327 Bacteria 3064
5 Ga0070658_10068609 3300005327 Bacteria 2899
6 Ga0070658_10436159 3300005327 Bacteria 1128
7 Ga0070658_10830043 3300005327 Bacteria 803
8 Ga0070658_11254747 3300005327 Bacteria 644
9 Ga0070676_10619534 3300005328 Unclassified 782
10 Ga0070676_11175403 3300005328 Bacteria 582
11 Ga0070683_100052913 3300005329 Bacteria 3762
12 Ga0070683_100177446 3300005329 Bacteria 2022
13 Ga0070683_100223616 3300005329 Bacteria 1789
14 Ga0070683_100571453 3300005329 Archaea 1081
15 Ga0070690_100040602 3300005330 Bacteria 2943
16 Ga0070690_100335719 3300005330 Bacteria 1093
17 Ga0070670_100466189 3300005331 Unclassified 1121
18 Ga0070670_100779551 3300005331 Bacteria 863
19 Ga0070677_10062039 3300005333 Bacteria 1545
20 Ga0068869_100034416 3300005334 Unclassified 3583
21 Ga0068869_100546648 3300005334 Bacteria 972
22 Ga0070666_10015364 3300005335 Bacteria 4882
23 Ga0070680_100006070 3300005336 Bacteria 9148
24 Ga0070680_100481268 3300005336 Bacteria 1061
25 Ga0070682_100001134 3300005337 Bacteria 15189
26 Ga0070682_100012005 3300005337 Bacteria 4956
27 Ga0070682_100013837 3300005337 Bacteria 4652
28 Ga0070682_100063243 3300005337 Bacteria 2346
29 Ga0068868_100016170 3300005338 Bacteria 5535
30 Ga0068868_100066319 3300005338 Bacteria 2869
31 Ga0068868_100147445 3300005338 Bacteria 1936
32 Ga0070660_100005499 3300005339 Bacteria 8776
33 Ga0070660_100014059 3300005339 Bacteria 5761
34 Ga0070660_100023642 3300005339 Bacteria 4554
35 Ga0070660_100040633 3300005339 Bacteria 3541
36 Ga0070660_100539006 3300005339 Bacteria 973
37 Ga0070689_100855817 3300005340 Bacteria 802
38 Ga0070691_10002118 3300005341 Bacteria 8779
39 Ga0070661_100004914 3300005344 Bacteria 9202
40 Ga0070661_100352303 3300005344 Archaea 1155
41 Ga0070669_100390722 3300005353 Bacteria 1136
42 Ga0070675_100014996 3300005354 Bacteria 6121
43 Ga0070675_100127665 3300005354 Bacteria 2165
44 Ga0070671_100013240 3300005355 Bacteria 6646
45 Ga0070671_100113381 3300005355 Bacteria 2278
46 Ga0070673_100035269 3300005364 Bacteria 3792
47 Ga0070673_100121772 3300005364 Bacteria 2177
48 Ga0070688_100244028 3300005365 Bacteria 1276
49 Ga0070688_100579435 3300005365 Bacteria 856
50 Ga0070659_100005352 3300005366 Bacteria 9211
51 Ga0070667_100001521 3300005367 Bacteria 20766
52 Ga0070667_100008567 3300005367 Bacteria 8475
53 Ga0070667_100712816 3300005367 Unclassified 929
54 Ga0070700_100706483 3300005441 Bacteria 802
55 Ga0070694_100545011 3300005444 Unclassified 928
56 Ga0070663_100151454 3300005455 Unclassified 1779
57 Ga0070678_100019337 3300005456 Bacteria 4437
58 Ga0070678_100603339 3300005456 Bacteria 980
59 Ga0070678_100676638 3300005456 Bacteria 928
60 Ga0070662_100006981 3300005457 Bacteria 7307
61 Ga0070662_100756511 3300005457 Bacteria 824
62 Ga0070681_10070892 3300005458 Bacteria 3449
63 Ga0070681_10216029 3300005458 Bacteria 1833
64 Ga0070681_10513165 3300005458 Bacteria 1112
65 Ga0068867_100204309 3300005459 Bacteria 1583
66 Ga0070685_10062766 3300005466 Unclassified 2179
67 Ga0070679_100000158 3300005530 Bacteria 54895
68 Ga0070679_100000684 3300005530 Bacteria 29020
69 Ga0070679_100049146 3300005530 Bacteria 4201
70 Ga0070679_100159630 3300005530 Bacteria 2229
71 Ga0070679_100161022 3300005530 Bacteria 2219
72 Ga0070679_101137678 3300005530 Bacteria 725
73 Ga0070684_100009329 3300005535 Bacteria 7723
74 Ga0070684_100336725 3300005535 Bacteria 1387
75 Ga0070684_100343145 3300005535 Bacteria 1373
76 Ga0070684_100438856 3300005535 Unclassified 1206
77 Ga0068853_100000197 3300005539 Bacteria 42626
78 Ga0068853_100033260 3300005539 Bacteria 4373
79 Ga0068853_100230718 3300005539 Bacteria 1693
80 Ga0068853_100482221 3300005539 Bacteria 1169
81 Ga0070672_100028585 3300005543 Bacteria 4172
82 Ga0070672_100085657 3300005543 Bacteria 2533
83 Ga0070672_100453183 3300005543 Bacteria 1105
84 Ga0070672_100522258 3300005543 Bacteria 1029
85 Ga0070686_100155697 3300005544 Bacteria 1604
86 Ga0070693_100060508 3300005547 Unclassified 2198
87 Ga0070693_100205561 3300005547 Unclassified 1282
88 Ga0070665_101179616 3300005548 Bacteria 777
89 Ga0068855_100002992 3300005563 Bacteria 20656
90 Ga0068855_100005888 3300005563 Bacteria 14948
91 Ga0068855_100017175 3300005563 Bacteria 8707
92 Ga0068855_100102486 3300005563 Bacteria 3294
93 Ga0068855_100109802 3300005563 Bacteria 3166
94 Ga0068855_100145564 3300005563 Bacteria 2698
95 Ga0068855_100182049 3300005563 Unclassified 2375
96 Ga0068855_100194900 3300005563 Bacteria 2283
97 Ga0068855_100329030 3300005563 Bacteria 1687
98 Ga0068855_100441910 3300005563 Bacteria 1420
99 Ga0070664_100000950 3300005564 Bacteria 22641
100 Ga0068857_100057032 3300005577 Bacteria 3466
101 Ga0068857_101619928 3300005577 Bacteria 632
102 Ga0068854_100073685 3300005578 Bacteria 2503
103 Ga0068854_100336052 3300005578 Unclassified 1232
104 Ga0068854_100781931 3300005578 Unclassified 830
105 Ga0068856_100048103 3300005614 Bacteria 4202
106 Ga0068856_100083452 3300005614 Bacteria 3173
107 Ga0068856_100375173 3300005614 Bacteria 1441
108 Ga0068856_100632479 3300005614 Bacteria 1091
109 Ga0068852_100001739 3300005616 Bacteria 14830
110 Ga0068852_100024208 3300005616 Bacteria 4904
111 Ga0068852_100127596 3300005616 Bacteria 2338
112 Ga0068852_100299872 3300005616 Bacteria 1555
113 Ga0068852_101055341 3300005616 Bacteria 832
114 Ga0068852_102253150 3300005616 Unclassified 566
115 Ga0068859_100000106 3300005617 Bacteria 78128
116 Ga0068859_100011757 3300005617 Bacteria 8793
117 Ga0068859_100064691 3300005617 Bacteria 3690
118 Ga0068859_100142962 3300005617 Bacteria 2466
119 Ga0068864_100009738 3300005618 Bacteria 7925
120 Ga0068864_100066191 3300005618 Bacteria 3136
121 Ga0068864_100114482 3300005618 Bacteria 2405
122 Ga0068864_100269881 3300005618 Bacteria 1585
123 Ga0068861_100592422 3300005719 Bacteria 1016
124 Ga0068851_10028829 3300005834 Bacteria 2744
125 Ga0068851_10080692 3300005834 Bacteria 1698
126 Ga0068863_100000567 3300005841 Bacteria 37587
127 Ga0068863_100017497 3300005841 Bacteria 6871
128 Ga0068863_100902052 3300005841 Unclassified 884
129 Ga0068858_100320417 3300005842 Bacteria 1481
130 Ga0068858_101195948 3300005842 Bacteria 747
131 Ga0068860_100003819 3300005843 Bacteria 15494
132 Ga0068860_100005157 3300005843 Bacteria 13283
133 Ga0068860_100019538 3300005843 Bacteria 6568
134 Ga0068860_100030900 3300005843 Bacteria 5150
135 Ga0068860_100041189 3300005843 Unclassified 4412
136 Ga0068860_100547409 3300005843 Bacteria 1159
137 Ga0068862_100185151 3300005844 Bacteria 1871
138 Ga0068862_100394342 3300005844 Bacteria 1294
139 Ga0068862_100960039 3300005844 Bacteria 843
140 Ga0081539_10001226 3300005985 Bacteria 45853
141 Ga0075366_10159807 3300006195 Unclassified 1365
142 Ga0097621_100006863 3300006237 Bacteria 8099
143 Ga0097621_100063023 3300006237 Unclassified 3045
144 Ga0097621_100289477 3300006237 Bacteria 1444
145 Ga0097621_100314087 3300006237 Unclassified 1387
146 Ga0097621_100351570 3300006237 Bacteria 1311
147 Ga0068871_100003787 3300006358 Bacteria 10416
148 Ga0068871_100010171 3300006358 Bacteria 6852
149 Ga0068871_100019773 3300006358 Bacteria 5146
150 Ga0068871_100207190 3300006358 Bacteria 1695
151 Ga0068871_100264827 3300006358 Unclassified 1500
152 Ga0068871_100487338 3300006358 Bacteria 1110
153 Ga0075428_100193784 3300006844 Unclassified 2198
154 Ga0075430_100355123 3300006846 Unclassified 1210
155 Ga0075431_100020645 3300006847 Bacteria 6731
156 Ga0068865_100490979 3300006881 Bacteria 1022
157 Ga0097620_100000106 3300006931 Bacteria 78128
158 Ga0097620_100011757 3300006931 Bacteria 8793
159 Ga0097620_100064693 3300006931 Bacteria 3690
160 Ga0097620_100142962 3300006931 Bacteria 2466
161 Ga0105240_10002290 3300009093 Bacteria 31019
162 Ga0105240_10008150 3300009093 Bacteria 15026
163 Ga0105240_10024327 3300009093 Bacteria 7987
164 Ga0105240_10104502 3300009093 Unclassified 3440
165 Ga0105240_11125669 3300009093 Bacteria 834
166 Ga0105245_10172951 3300009098 Bacteria 2058
167 Ga0105245_10253669 3300009098 Bacteria 1710
168 Ga0105247_10019635 3300009101 Unclassified 4057
169 Ga0114129_10084409 3300009147 Bacteria 4410
170 Ga0105243_11055129 3300009148 Bacteria 818
171 Ga0105241_10001224 3300009174 Bacteria 19641
172 Ga0105241_10002476 3300009174 Bacteria 13891
173 Ga0105241_10131388 3300009174 Unclassified 2028
174 Ga0105241_10218074 3300009174 Bacteria 1602
175 Ga0105242_10542644 3300009176 Unclassified 1113
176 Ga0105242_10630168 3300009176 Bacteria 1040
177 Ga0105237_10003683 3300009545 Bacteria 18058
178 Ga0105237_10008043 3300009545 Bacteria 11467
179 Ga0105237_10009512 3300009545 Bacteria 10407
180 Ga0105237_10012937 3300009545 Bacteria 8765
181 Ga0105237_10121782 3300009545 Bacteria 2603
182 Ga0105237_12324160 3300009545 Unclassified 546
183 Ga0105238_10074065 3300009551 Bacteria 3398
184 Ga0105238_10128549 3300009551 Bacteria 2512
185 Ga0105249_10002874 3300009553 Bacteria 14864
186 Ga0105249_10997829 3300009553 Bacteria 906
187 Ga0105249_11417340 3300009553 Bacteria 767
188 Ga0099796_10113634 3300010159 Unclassified 1033
189 Ga0105239_10000760 3300010375 Bacteria 45542
190 Ga0105239_10002155 3300010375 Bacteria 25331
191 Ga0105239_10025615 3300010375 Bacteria 6495
192 Ga0105239_10060501 3300010375 Unclassified 4157
193 Ga0105239_10077689 3300010375 Bacteria 3653
194 Ga0105239_10194993 3300010375 Bacteria 2268
195 Ga0105239_10301860 3300010375 Bacteria 1803
196 Ga0105239_10545314 3300010375 Bacteria 1320
197 Ga0105246_10019431 3300011119 Unclassified 4341
198 Ga0105246_10085903 3300011119 Bacteria 2254
199 Ga0105246_10186652 3300011119 Bacteria 1601
200 Ga0157373_10005254 3300013100 Bacteria 9723
201 Ga0157373_10006304 3300013100 Bacteria 8862
202 Ga0157373_10033843 3300013100 Bacteria 3672
203 Ga0157373_10055735 3300013100 Unclassified 2808
204 Ga0157373_10435931 3300013100 Bacteria 942
205 Ga0157371_10000231 3300013102 Bacteria 79811
206 Ga0157371_10001159 3300013102 Bacteria 28365
207 Ga0157371_10003438 3300013102 Bacteria 14365
208 Ga0157371_10007512 3300013102 Bacteria 8820
209 Ga0157371_10024064 3300013102 Bacteria 4449
210 Ga0157371_10030010 3300013102 Bacteria 3924
211 Ga0157371_10036236 3300013102 Bacteria 3533
212 Ga0157371_10371717 3300013102 Bacteria 1043
213 Ga0157371_10643113 3300013102 Bacteria 791
214 Ga0157371_10838192 3300013102 Unclassified 695
215 Ga0157371_11395017 3300013102 Bacteria 544
216 Ga0157370_10004240 3300013104 Bacteria 16570
217 Ga0157370_10004630 3300013104 Bacteria 15729
218 Ga0157370_10019132 3300013104 Bacteria 6884
219 Ga0157370_10036554 3300013104 Bacteria 4764
220 Ga0157370_10104499 3300013104 Bacteria 2651
221 Ga0157370_10169571 3300013104 Archaea 2029
222 Ga0157370_10192331 3300013104 Bacteria 1894
223 Ga0157370_10328199 3300013104 Bacteria 1411
224 Ga0157370_10422643 3300013104 Bacteria 1226
225 Ga0157370_10521704 3300013104 Bacteria 1090
226 Ga0157370_11078328 3300013104 Bacteria 726
227 Ga0157369_10008917 3300013105 Bacteria 11491
228 Ga0157369_10015498 3300013105 Bacteria 8589
229 Ga0157369_10043924 3300013105 Bacteria 4868
230 Ga0157369_10050745 3300013105 Bacteria 4491
231 Ga0157369_10053730 3300013105 Bacteria 4352
232 Ga0157369_10167210 3300013105 Bacteria 2319
233 Ga0157369_10228452 3300013105 Bacteria 1946
234 Ga0157369_10549196 3300013105 Bacteria 1194
235 Ga0157369_10610701 3300013105 Bacteria 1125
236 Ga0157374_10000002 3300013296 Bacteria 1054226
237 Ga0157374_10032223 3300013296 Bacteria 4770
238 Ga0157374_10360233 3300013296 Bacteria 1446
239 Ga0157374_10668410 3300013296 Unclassified 1051
240 Ga0157374_11503109 3300013296 Unclassified 697
241 Ga0157378_10008134 3300013297 Bacteria 9153
242 Ga0157378_10296177 3300013297 Unclassified 1564
243 Ga0157378_10667953 3300013297 Unclassified 1056
244 Ga0157378_10816196 3300013297 Unclassified 959
245 Ga0157378_10827880 3300013297 Bacteria 953
246 Ga0163162_10000972 3300013306 Bacteria 26646
247 Ga0163162_10059671 3300013306 Bacteria 3847
248 Ga0163162_10079020 3300013306 Bacteria 3356
249 Ga0163162_10181279 3300013306 Bacteria 2232
250 Ga0163162_10241057 3300013306 Bacteria 1939
251 Ga0163162_10664778 3300013306 Bacteria 1165
252 Ga0157372_10009422 3300013307 Bacteria 10390
253 Ga0157372_10011158 3300013307 Bacteria 9557
254 Ga0157372_10050163 3300013307 Unclassified 4643
255 Ga0157372_10069336 3300013307 Unclassified 3966
256 Ga0157372_10092527 3300013307 Bacteria 3440
257 Ga0157372_10122871 3300013307 Bacteria 2984
258 Ga0157372_10146224 3300013307 Bacteria 2726
259 Ga0157372_10170081 3300013307 Bacteria 2521
260 Ga0157372_10527422 3300013307 Bacteria 1376
261 Ga0157372_11502729 3300013307 Bacteria 776
262 Ga0157372_11976833 3300013307 Bacteria 670
263 Ga0157375_10046462 3300013308 Bacteria 4233
264 Ga0157375_10117318 3300013308 Bacteria 2767
265 Ga0157375_11550859 3300013308 Unclassified 782
266 Ga0163163_10334406 3300014325 Unclassified 1569
267 Ga0163163_10765924 3300014325 Bacteria 1029
268 Ga0163163_10884256 3300014325 Bacteria 957
269 Ga0157380_10187138 3300014326 Bacteria 1825
270 Ga0157377_10061600 3300014745 Bacteria 2145
271 Ga0157377_10629706 3300014745 Unclassified 769
272 Ga0157379_10547664 3300014968 Unclassified 1076
273 Ga0157379_10667911 3300014968 Bacteria 974
274 Ga0157379_11042177 3300014968 Bacteria 781
275 Ga0157376_10001744 3300014969 Bacteria 14472
276 Ga0157376_10041214 3300014969 Bacteria 3779
277 Ga0157376_10186090 3300014969 Bacteria 1901
278 Ga0157376_10228294 3300014969 Bacteria 1728
279 Ga0163161_10319545 3300017792 Unclassified 1227
280 Ga0163161_10950830 3300017792 Unclassified 731
281 Ga0207656_10064115 3300025321 Bacteria 1619
282 Ga0207682_10081943 3300025893 Bacteria 1385
283 Ga0207642_10188569 3300025899 Bacteria 1129
284 Ga0207710_10010011 3300025900 Unclassified 3988
285 Ga0207680_10021255 3300025903 Unclassified 3509
286 Ga0207647_10014949 3300025904 Bacteria 5334
287 Ga0207647_10208757 3300025904 Bacteria 1128
288 Ga0207643_10139946 3300025908 Bacteria 1445
289 Ga0207705_10015146 3300025909 Bacteria 5542
290 Ga0207705_10017824 3300025909 Bacteria 5078
291 Ga0207705_10039758 3300025909 Bacteria 3371
292 Ga0207705_10160955 3300025909 Bacteria 1686
293 Ga0207705_10280507 3300025909 Bacteria 1275
294 Ga0207705_10425614 3300025909 Unclassified 1028
295 Ga0207705_10702403 3300025909 Unclassified 786
296 Ga0207654_10002232 3300025911 Bacteria 9946
297 Ga0207654_10010152 3300025911 Bacteria 4791
298 Ga0207654_10293169 3300025911 Unclassified 1104
299 Ga0207707_10001194 3300025912 Bacteria 24438
300 Ga0207707_10332535 3300025912 Archaea 1311
301 Ga0207707_10544669 3300025912 Bacteria 986
302 Ga0207707_10632508 3300025912 Bacteria 903
303 Ga0207695_10000016 3300025913 Bacteria 771991
304 Ga0207695_10000296 3300025913 Bacteria 123322
305 Ga0207695_10014807 3300025913 Bacteria 9213
306 Ga0207695_10027822 3300025913 Bacteria 6287
307 Ga0207695_10036297 3300025913 Bacteria 5330
308 Ga0207695_10050912 3300025913 Unclassified 4353
309 Ga0207671_10001029 3300025914 Bacteria 33967
310 Ga0207671_10011496 3300025914 Bacteria 7195
311 Ga0207671_10016235 3300025914 Bacteria 5795
312 Ga0207671_10077204 3300025914 Bacteria 2493
313 Ga0207671_10089454 3300025914 Unclassified 2317
314 Ga0207660_10001003 3300025917 Bacteria 18710
315 Ga0207660_10012933 3300025917 Bacteria 5466
316 Ga0207660_10332170 3300025917 Unclassified 1215
317 Ga0207660_10461622 3300025917 Unclassified 1028
318 Ga0207657_10004992 3300025919 Bacteria 13947
319 Ga0207657_10006170 3300025919 Bacteria 12459
320 Ga0207657_10026230 3300025919 Bacteria 5358
321 Ga0207657_10134790 3300025919 Bacteria 2021
322 Ga0207649_10023819 3300025920 Bacteria 3550
323 Ga0207652_10000013 3300025921 Bacteria 222247
324 Ga0207652_10002368 3300025921 Bacteria 15936
325 Ga0207652_10005901 3300025921 Bacteria 9905
326 Ga0207652_10036890 3300025921 Bacteria 4134
327 Ga0207652_10042375 3300025921 Bacteria 3874
328 Ga0207652_10155714 3300025921 Bacteria 2047
329 Ga0207652_10211212 3300025921 Bacteria 1747
330 Ga0207652_10554025 3300025921 Bacteria 1033
331 Ga0207652_10736152 3300025921 Bacteria 878
332 Ga0207681_10322417 3300025923 Bacteria 1229
333 Ga0207694_10093751 3300025924 Bacteria 2372
334 Ga0207694_10135391 3300025924 Bacteria 1978
335 Ga0207650_10079862 3300025925 Bacteria 2478
336 Ga0207650_10666110 3300025925 Bacteria 878
337 Ga0207659_10194337 3300025926 Bacteria 1616
338 Ga0207659_11116375 3300025926 Bacteria 678
339 Ga0207687_10392114 3300025927 Unclassified 1140
340 Ga0207644_10218405 3300025931 Bacteria 1510
341 Ga0207644_10330205 3300025931 Bacteria 1235
342 Ga0207690_10042718 3300025932 Bacteria 2979
343 Ga0207706_10005696 3300025933 Bacteria 11606
344 Ga0207686_10070326 3300025934 Unclassified 2248
345 Ga0207670_10169744 3300025936 Bacteria 1635
346 Ga0207669_10835805 3300025937 Unclassified 766
347 Ga0207691_10010650 3300025940 Bacteria 8824
348 Ga0207691_10104179 3300025940 Bacteria 2529
349 Ga0207691_10129293 3300025940 Bacteria 2232
350 Ga0207689_10000853 3300025942 Bacteria 29374
351 Ga0207689_11053744 3300025942 Unclassified 686
352 Ga0207661_10322149 3300025944 Bacteria 1390
353 Ga0207661_10434737 3300025944 Bacteria 1193
354 Ga0207661_10509389 3300025944 Archaea 1100
355 Ga0207679_10171795 3300025945 Bacteria 1785
356 Ga0207679_10797070 3300025945 Bacteria 861
357 Ga0207667_10000583 3300025949 Bacteria 47418
358 Ga0207667_10001138 3300025949 Bacteria 33456
359 Ga0207667_10083362 3300025949 Bacteria 3310
360 Ga0207667_10110926 3300025949 Bacteria 2829
361 Ga0207667_10148492 3300025949 Unclassified 2413
362 Ga0207667_10153264 3300025949 Bacteria 2371
363 Ga0207667_10176610 3300025949 Bacteria 2194
364 Ga0207667_10233454 3300025949 Bacteria 1883
365 Ga0207651_10035846 3300025960 Bacteria 3232
366 Ga0207651_10479788 3300025960 Bacteria 1071
367 Ga0207712_10002069 3300025961 Bacteria 13179
368 Ga0207668_10085857 3300025972 Bacteria 2298
369 Ga0207668_10313711 3300025972 Bacteria 1299
370 Ga0207640_10166727 3300025981 Bacteria 1636
371 Ga0207640_10427772 3300025981 Unclassified 1085
372 Ga0207658_10009067 3300025986 Bacteria 6747
373 Ga0207658_10010441 3300025986 Bacteria 6307
374 Ga0207658_10348834 3300025986 Bacteria 1288
375 Ga0207677_10003369 3300026023 Bacteria 8455
376 Ga0207677_10031649 3300026023 Bacteria 3390
377 Ga0207677_10307959 3300026023 Bacteria 1311
378 Ga0207703_10003904 3300026035 Bacteria 12380
379 Ga0207703_10907799 3300026035 Bacteria 843
380 Ga0207639_10023498 3300026041 Bacteria 4453
381 Ga0207639_10076414 3300026041 Bacteria 2637
382 Ga0207639_10148486 3300026041 Bacteria 1961
383 Ga0207639_10332934 3300026041 Bacteria 1351
384 Ga0207639_11385088 3300026041 Bacteria 660
385 Ga0207678_10230143 3300026067 Bacteria 1587
386 Ga0207702_10029450 3300026078 Bacteria 4568
387 Ga0207702_10086907 3300026078 Bacteria 2728
388 Ga0207702_10087567 3300026078 Bacteria 2719
389 Ga0207702_10165092 3300026078 Bacteria 2025
390 Ga0207641_10000082 3300026088 Bacteria 138385
391 Ga0207641_10784131 3300026088 Unclassified 942
392 Ga0207648_10470528 3300026089 Bacteria 1147
393 Ga0207676_10005134 3300026095 Bacteria 9267
394 Ga0207676_10286694 3300026095 Bacteria 1497
395 Ga0207676_11499950 3300026095 Bacteria 671
396 Ga0207674_10034788 3300026116 Bacteria 5263
397 Ga0207675_100411993 3300026118 Bacteria 1333
398 Ga0207675_100949999 3300026118 Bacteria 877
399 Ga0207675_101113695 3300026118 Unclassified 809
400 Ga0207683_10093471 3300026121 Bacteria 2680
401 Ga0207683_10713034 3300026121 Unclassified 930
402 Ga0207698_10004508 3300026142 Bacteria 8495
403 Ga0207698_10074014 3300026142 Bacteria 2715
404 Ga0207698_10251970 3300026142 Bacteria 1616
405 Ga0209974_10059969 3300027876 Unclassified 1287
406 Ga0268265_10023924 3300028380 Bacteria 4314
407 Ga0268264_10006272 3300028381 Bacteria 10027
408 Ga0268264_10006312 3300028381 Bacteria 9993
409 Ga0268264_10006818 3300028381 Bacteria 9594
410 Ga0268264_10012637 3300028381 Bacteria 6954
411 Ga0268264_10030257 3300028381 Unclassified 4438
412 Ga0307517_10021498 3300028786 Bacteria 8145
413 Ga0265338_10941828 3300028800 Bacteria 586
414 Ga0265316_10482424 3300031344 Bacteria 887
415 Ga0307509_10121639 3300031507 Bacteria 2586
416 Ga0265313_10118642 3300031595 Unclassified 1156
417 Ga0307516_10001379 3300031730 Bacteria 33641
418 Ga0307414_10861600 3300032004 Bacteria 829
419 Ga0307510_10003610 3300033180 Bacteria 18060
420 Ga0373926_0096882 3300035083 Bacteria 1101
421 Ga0373936_0101579 3300035113 Bacteria 1214
422 Ga0373957_0384137 3300035120 Bacteria 603
423 Ga0373924_0058123 3300035410 Unclassified 1614
424 Ga0373935_0182666 3300035692 Unclassified 1441
425 Ga0373933_0133334 3300035724 Unclassified 1563
426 Ga0373937_0153103 3300036401 Bacteria 2160
427 Ga0395899_0000528 3300037312 Bacteria 41982
428 Ga0395899_0005868 3300037312 Bacteria 9529
429 Ga0395899_0061355 3300037312 Bacteria 2769
430 Ga0395899_0189490 3300037312 Bacteria 1439
431 Ga0395900_0002692 3300037418 Bacteria 19416
432 Ga0395900_0010753 3300037418 Bacteria 9361
433 Ga0395900_0039526 3300037418 Bacteria 4860
434 Ga0395900_0390237 3300037418 Bacteria 1358
435 Ga0395900_0776360 3300037418 Bacteria 887
436 Ga0395898_0000595 3300037466 Bacteria 67162
437 Ga0395898_0053435 3300037466 Bacteria 3945
438 Ga0395898_0075689 3300037466 Bacteria 3251
439 Ga0395898_1353893 3300037466 Bacteria 640
440 Ga0395905_0007136 3300037471 Bacteria 11170
441 Ga0395905_0528286 3300037471 Bacteria 1080
442 Ga0395901_0005353 3300038443 Bacteria 12971
443 Ga0395901_0047717 3300038443 Bacteria 4446
444 Ga0395901_0174479 3300038443 Bacteria 2255
445 Ga0395901_0789469 3300038443 Bacteria 939
446 Ga0395901_1051080 3300038443 Bacteria 787
447 Ga0466961_0016976 3300044693 Bacteria 4675
448 Ga0466964_0329776 3300044706 Bacteria 778
449 Ga0466971_0016800 3300044719 Unclassified 3233
450 Ga0466959_0004171 3300045049 Bacteria 9628
451 Ga0466959_0727761 3300045049 Bacteria 664
452 Ga0466958_0260844 3300045836 Bacteria 1109
453 Ga0466967_0080611 3300045976 Bacteria 2938
454 Ga0495638_0071960 3300046460 Bacteria 2114
455 Ga0495653_0100476 3300046463 Unclassified 2097
456 Ga0495650_0119793 3300046471 Unclassified 970
457 Ga0495580_0394411 3300046472 Bacteria 934
458 Ga0495580_0682212 3300046472 Bacteria 674
459 Ga0495606_0008778 3300046507 Bacteria 8679
460 Ga0495608_0083467 3300046511 Bacteria 2074
461 Ga0495618_0046549 3300046514 Unclassified 2738
462 Ga0495628_0181606 3300046516 Bacteria 1591
463 Ga0495630_0034594 3300046517 Unclassified 3773
464 Ga0495587_0024806 3300046536 Bacteria 3671
465 Ga0495667_0190088 3300046559 Unclassified 1316
466 Ga0495611_0000983 3300046648 Bacteria 15159
467 Ga0495625_0600043 3300046660 Bacteria 661
468 Ga0495658_0248580 3300046683 Bacteria 1118
469 Ga0495649_0369252 3300046694 Unclassified 723
470 Ga0495600_0104490 3300046809 Bacteria 1846
471 Ga0495674_0286954 3300047319 Bacteria 1347
472 Ga0495676_0330225 3300047321 Unclassified 1023
473 Ga0495684_0024797 3300047471 Bacteria 4612
474 Ga0495686_0000016 3300047472 Bacteria 443701
475 Ga0501033_0010981 3300049570 Bacteria 6940
476 Ga0501033_0031125 3300049570 Bacteria 4012
477 Ga0501034_0027873 3300049571 Bacteria 5744
478 Ga0501034_0037584 3300049571 Bacteria 4903
479 Ga0501034_0178622 3300049571 Bacteria 2088
480 Ga0501038_0205683 3300049574 Unclassified 1578
481 Ga0501039_0254150 3300049575 Bacteria 1382
482 Ga0501046_0304168 3300049580 Unclassified 1164
483 Ga0501047_0112205 3300049581 Bacteria 2609
484 Ga0501067_0006335 3300049583 Bacteria 6561
485 Ga0501068_0513740 3300049584 Unclassified 778
486 Ga0501070_0124607 3300049586 Bacteria 2129
487 Ga0501070_0131161 3300049586 Bacteria 2070
488 Ga0501072_0627396 3300049588 Bacteria 847
489 Ga0501073_0121334 3300049589 Bacteria 1811
490 Ga0501074_0653992 3300049590 Unclassified 742
491 Ga0501219_000085 3300049703 Bacteria 15993
492 Ga0501225_0048200 3300049705 Bacteria 1183
493 Ga0501079_0093112 3300049741 Bacteria 2335
494 Ga0501083_0037903 3300049744 Bacteria 3279
495 Ga0501241_016123 3300049758 Bacteria 1362
496 Ga0501035_1104770 3300049822 Unclassified 619
497 Ga0501044_0074228 3300049823 Unclassified 3456
498 Ga0501044_0111919 3300049823 Bacteria 2737
499 Ga0501044_0119837 3300049823 Bacteria 2633
500 Ga0501284_00074 3300050005 Bacteria 28202
501 nmdc:mga05p37_143831_c1 3300050507 Unclassified 2921
502 nmdc:mga06r32_7936_c1 3300050510 Bacteria 9541
503 Ga0500646_0018484 3300053090 Bacteria 1836
504 Ga0500646_0137592 3300053090 Unclassified 799
505 Ga0500588_0014745 3300053146 Bacteria 1988
506 Ga0500637_0479009 3300053178 Unclassified 623
507 Ga0501084_0203069 3300054114 Bacteria 1672
508 Ga0501082_1087301 3300060353 Bacteria 699
509 Ga0466962_0003550 3300061719 Bacteria 7429

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005539 Ga0068853_100482221 Ga0068853_1004822212 137
2 3300005563 Ga0068855_100329030 Ga0068855_1003290302 137
3 3300005334 Ga0068869_100546648 Ga0068869_1005466482 143
4 3300013297 Ga0157378_10816196 Ga0157378_108161961 143
5 3300025942 Ga0207689_11053744 Ga0207689_110537441 143
6 3300026023 Ga0207677_10307959 Ga0207677_103079592 143
7 3300026041 Ga0207639_10148486 Ga0207639_101484862 148
8 3300025937 Ga0207669_10835805 Ga0207669_108358051 150
9 3300005456 Ga0070678_100676638 Ga0070678_1006766382 152
10 3300006358 Ga0068871_100487338 Ga0068871_1004873382 152
11 3300025908 Ga0207643_10139946 Ga0207643_101399462 152
12 3300025940 Ga0207691_10010650 Ga0207691_100106502 152
13 3300026121 Ga0207683_10713034 Ga0207683_107130341 152
14 3300005333 Ga0070677_10062039 Ga0070677_100620392 153
15 3300005364 Ga0070673_100035269 Ga0070673_1000352692 153
16 3300005543 Ga0070672_100028585 Ga0070672_1000285853 153
17 3300013308 Ga0157375_10046462 Ga0157375_100464623 153
18 3300014326 Ga0157380_10187138 Ga0157380_101871381 153
19 3300017792 Ga0163161_10319545 Ga0163161_103195452 153
20 3300025893 Ga0207682_10081943 Ga0207682_100819431 153
21 3300025960 Ga0207651_10035846 Ga0207651_100358462 153
22 3300026089 Ga0207648_10470528 Ga0207648_104705282 154
23 3300003322 rootL2_10064875 rootL2_100648752 155
24 3300006237 Ga0097621_100351570 Ga0097621_1003515702 155
25 3300005327 Ga0070658_10436159 Ga0070658_104361592 157
26 3300005337 Ga0070682_100063243 Ga0070682_1000632432 157
27 3300005339 Ga0070660_100023642 Ga0070660_1000236424 157
28 3300005458 Ga0070681_10513165 Ga0070681_105131651 157
29 3300005530 Ga0070679_100049146 Ga0070679_1000491465 157
30 3300005535 Ga0070684_100343145 Ga0070684_1003431452 157
31 3300005563 Ga0068855_100441910 Ga0068855_1004419102 157
32 3300005614 Ga0068856_100375173 Ga0068856_1003751731 157
33 3300005616 Ga0068852_100024208 Ga0068852_1000242082 157
34 3300005616 Ga0068852_100299872 Ga0068852_1002998722 157
35 3300009093 Ga0105240_10104502 Ga0105240_101045025 157
36 3300009174 Ga0105241_10218074 Ga0105241_102180741 157
37 3300009545 Ga0105237_10121782 Ga0105237_101217822 157
38 3300013100 Ga0157373_10006304 Ga0157373_100063045 157
39 3300013102 Ga0157371_10000231 Ga0157371_1000023152 157
40 3300013102 Ga0157371_10371717 Ga0157371_103717171 157
41 3300013105 Ga0157369_10008917 Ga0157369_100089177 157
42 3300013105 Ga0157369_10610701 Ga0157369_106107012 157
43 3300025911 Ga0207654_10293169 Ga0207654_102931691 157
44 3300025912 Ga0207707_10632508 Ga0207707_106325081 157
45 3300025914 Ga0207671_10077204 Ga0207671_100772041 157
46 3300025921 Ga0207652_10211212 Ga0207652_102112122 157
47 3300025949 Ga0207667_10083362 Ga0207667_100833622 157
48 3300026041 Ga0207639_10332934 Ga0207639_103329342 157
49 3300026078 Ga0207702_10029450 Ga0207702_100294502 157
50 3300026142 Ga0207698_10251970 Ga0207698_102519701 157
51 3300053090 Ga0500646_0018484 Ga0500646_0018484_979_1476 157
52 3300005331 Ga0070670_100779551 Ga0070670_1007795512 158
53 3300005353 Ga0070669_100390722 Ga0070669_1003907221 158
54 3300005354 Ga0070675_100127665 Ga0070675_1001276652 158
55 3300005367 Ga0070667_100712816 Ga0070667_1007128161 158
56 3300005456 Ga0070678_100603339 Ga0070678_1006033392 158
57 3300005459 Ga0068867_100204309 Ga0068867_1002043091 158
58 3300005563 Ga0068855_100194900 Ga0068855_1001949002 158
59 3300005617 Ga0068859_100011757 Ga0068859_1000117572 158
60 3300005618 Ga0068864_100066191 Ga0068864_1000661913 158
61 3300005618 Ga0068864_100114482 Ga0068864_1001144822 158
62 3300005843 Ga0068860_100003819 Ga0068860_1000038198 158
63 3300005844 Ga0068862_100185151 Ga0068862_1001851512 158
64 3300006237 Ga0097621_100289477 Ga0097621_1002894772 158
65 3300006931 Ga0097620_100011757 Ga0097620_1000117572 158
66 3300009553 Ga0105249_11417340 Ga0105249_114173401 158
67 3300013102 Ga0157371_10003438 Ga0157371_1000343814 158
68 3300013102 Ga0157371_10036236 Ga0157371_100362363 158
69 3300013104 Ga0157370_10004240 Ga0157370_100042406 158
70 3300013306 Ga0163162_10241057 Ga0163162_102410571 158
71 3300013306 Ga0163162_10664778 Ga0163162_106647782 158
72 3300013307 Ga0157372_10011158 Ga0157372_100111586 158
73 3300013307 Ga0157372_11502729 Ga0157372_115027291 158
74 3300014325 Ga0163163_10765924 Ga0163163_107659242 158
75 3300014745 Ga0157377_10629706 Ga0157377_106297061 158
76 3300025923 Ga0207681_10322417 Ga0207681_103224172 158
77 3300025925 Ga0207650_10666110 Ga0207650_106661101 158
78 3300025926 Ga0207659_10194337 Ga0207659_101943372 158
79 3300025945 Ga0207679_10797070 Ga0207679_107970702 158
80 3300025949 Ga0207667_10153264 Ga0207667_101532643 158
81 3300025972 Ga0207668_10085857 Ga0207668_100858572 158
82 3300025986 Ga0207658_10348834 Ga0207658_103488341 158
83 3300026041 Ga0207639_11385088 Ga0207639_113850881 158
84 3300026095 Ga0207676_10286694 Ga0207676_102866942 158
85 3300026095 Ga0207676_11499950 Ga0207676_114999501 158
86 3300028380 Ga0268265_10023924 Ga0268265_100239241 158
87 3300028381 Ga0268264_10006272 Ga0268264_100062723 158
88 3300049570 Ga0501033_0010981 Ga0501033_0010981_1984_2460 158
89 3300049571 Ga0501034_0027873 Ga0501034_0027873_592_1068 158
90 3300049574 Ga0501038_0205683 Ga0501038_0205683_168_644 158
91 3300049586 Ga0501070_0131161 Ga0501070_0131161_857_1333 158
92 3300049823 Ga0501044_0111919 Ga0501044_0111919_1237_1713 158
93 3300005327 Ga0070658_11254747 Ga0070658_112547471 159
94 3300005329 Ga0070683_100177446 Ga0070683_1001774462 159
95 3300005530 Ga0070679_100159630 Ga0070679_1001596301 159
96 3300005563 Ga0068855_100109802 Ga0068855_1001098021 159
97 3300005843 Ga0068860_100547409 Ga0068860_1005474091 159
98 3300006195 Ga0075366_10159807 Ga0075366_101598073 159
99 3300013102 Ga0157371_10643113 Ga0157371_106431131 159
100 3300013104 Ga0157370_11078328 Ga0157370_110783281 159
101 3300013306 Ga0163162_10181279 Ga0163162_101812793 159
102 3300025914 Ga0207671_10089454 Ga0207671_100894542 159
103 3300025919 Ga0207657_10026230 Ga0207657_100262304 159
104 3300025921 Ga0207652_10155714 Ga0207652_101557141 159
105 3300025944 Ga0207661_10322149 Ga0207661_103221492 159
106 3300025949 Ga0207667_10233454 Ga0207667_102334542 159
107 3300037312 Ga0395899_0000528 Ga0395899_0000528_29148_29627 159
108 3300037418 Ga0395900_0002692 Ga0395900_0002692_63_542 159
109 3300037466 Ga0395898_0000595 Ga0395898_0000595_27161_27640 159
110 3300038443 Ga0395901_0005353 Ga0395901_0005353_2232_2711 159
111 3300046660 Ga0495625_0600043 Ga0495625_0600043_49_531 159
112 3300049570 Ga0501033_0031125 Ga0501033_0031125_2086_2565 159
113 3300049571 Ga0501034_0037584 Ga0501034_0037584_2081_2560 159
114 3300049575 Ga0501039_0254150 Ga0501039_0254150_409_888 159
115 3300005539 Ga0068853_100000197 Ga0068853_10000019727 160
116 3300005563 Ga0068855_100182049 Ga0068855_1001820492 160
117 3300005614 Ga0068856_100083452 Ga0068856_1000834524 160
118 3300005843 Ga0068860_100005157 Ga0068860_1000051571 160
119 3300006844 Ga0075428_100193784 Ga0075428_1001937843 160
120 3300006846 Ga0075430_100355123 Ga0075430_1003551231 160
121 3300006847 Ga0075431_100020645 Ga0075431_1000206453 160
122 3300009093 Ga0105240_10024327 Ga0105240_100243272 160
123 3300009147 Ga0114129_10084409 Ga0114129_100844094 160
124 3300009174 Ga0105241_10131388 Ga0105241_101313882 160
125 3300009545 Ga0105237_10008043 Ga0105237_100080437 160
126 3300009545 Ga0105237_10009512 Ga0105237_100095124 160
127 3300009545 Ga0105237_10012937 Ga0105237_100129374 160
128 3300009551 Ga0105238_10074065 Ga0105238_100740653 160
129 3300009551 Ga0105238_10128549 Ga0105238_101285492 160
130 3300010375 Ga0105239_10000760 Ga0105239_1000076011 160
131 3300010375 Ga0105239_10002155 Ga0105239_100021557 160
132 3300010375 Ga0105239_10025615 Ga0105239_100256152 160
133 3300010375 Ga0105239_10077689 Ga0105239_100776893 160
134 3300010375 Ga0105239_10301860 Ga0105239_103018602 160
135 3300010375 Ga0105239_10545314 Ga0105239_105453143 160
136 3300013296 Ga0157374_10000002 Ga0157374_10000002244 160
137 3300013296 Ga0157374_10668410 Ga0157374_106684101 160
138 3300013306 Ga0163162_10000972 Ga0163162_1000097217 160
139 3300013307 Ga0157372_10050163 Ga0157372_100501632 160
140 3300014969 Ga0157376_10001744 Ga0157376_100017443 160
141 3300025913 Ga0207695_10000016 Ga0207695_1000001679 160
142 3300025913 Ga0207695_10000296 Ga0207695_1000029672 160
143 3300025913 Ga0207695_10036297 Ga0207695_100362973 160
144 3300025913 Ga0207695_10050912 Ga0207695_100509126 160
145 3300025914 Ga0207671_10011496 Ga0207671_100114964 160
146 3300025914 Ga0207671_10016235 Ga0207671_100162353 160
147 3300025924 Ga0207694_10093751 Ga0207694_100937512 160
148 3300025924 Ga0207694_10135391 Ga0207694_101353912 160
149 3300025949 Ga0207667_10148492 Ga0207667_101484923 160
150 3300026041 Ga0207639_10076414 Ga0207639_100764142 160
151 3300026078 Ga0207702_10087567 Ga0207702_100875671 160
152 3300027876 Ga0209974_10059969 Ga0209974_100599692 160
153 3300028381 Ga0268264_10006312 Ga0268264_1000631210 160
154 3300031507 Ga0307509_10121639 Ga0307509_101216392 160
155 3300031595 Ga0265313_10118642 Ga0265313_101186422 160
156 3300044693 Ga0466961_0016976 Ga0466961_0016976_3123_3617 160
157 3300044706 Ga0466964_0329776 Ga0466964_0329776_53_547 160
158 3300044719 Ga0466971_0016800 Ga0466971_0016800_2063_2557 160
159 3300045049 Ga0466959_0004171 Ga0466959_0004171_2438_2932 160
160 3300045049 Ga0466959_0727761 Ga0466959_0727761_91_585 160
161 3300045836 Ga0466958_0260844 Ga0466958_0260844_98_592 160
162 3300046460 Ga0495638_0071960 Ga0495638_0071960_1088_1582 160
163 3300046472 Ga0495580_0394411 Ga0495580_0394411_109_591 160
164 3300046648 Ga0495611_0000983 Ga0495611_0000983_10582_11076 160
165 3300046694 Ga0495649_0369252 Ga0495649_0369252_208_702 160
166 3300047472 Ga0495686_0000016 Ga0495686_0000016_130684_131178 160
167 3300050507 nmdc:mga05p37_143831_c1 nmdc:mga05p37_143831_c1_1068_1580 160
168 3300050510 nmdc:mga06r32_7936_c1 nmdc:mga06r32_7936_c1_1186_1698 160
169 3300053146 Ga0500588_0014745 Ga0500588_0014745_714_1208 160
170 3300053178 Ga0500637_0479009 Ga0500637_0479009_10_504 160
171 3300061719 Ga0466962_0003550 Ga0466962_0003550_3531_4025 160
172 3300005327 Ga0070658_10830043 Ga0070658_108300431 161
173 3300005328 Ga0070676_10619534 Ga0070676_106195342 161
174 3300005329 Ga0070683_100223616 Ga0070683_1002236162 161
175 3300005331 Ga0070670_100466189 Ga0070670_1004661892 161
176 3300005336 Ga0070680_100006070 Ga0070680_1000060706 161
177 3300005337 Ga0070682_100001134 Ga0070682_10000113418 161
178 3300005338 Ga0068868_100016170 Ga0068868_1000161705 161
179 3300005339 Ga0070660_100040633 Ga0070660_1000406332 161
180 3300005341 Ga0070691_10002118 Ga0070691_100021183 161
181 3300005365 Ga0070688_100244028 Ga0070688_1002440282 161
182 3300005367 Ga0070667_100008567 Ga0070667_1000085672 161
183 3300005455 Ga0070663_100151454 Ga0070663_1001514542 161
184 3300005458 Ga0070681_10070892 Ga0070681_100708924 161
185 3300005466 Ga0070685_10062766 Ga0070685_100627662 161
186 3300005530 Ga0070679_100000158 Ga0070679_1000001585 161
187 3300005530 Ga0070679_100161022 Ga0070679_1001610221 161
188 3300005530 Ga0070679_101137678 Ga0070679_1011376781 161
189 3300005535 Ga0070684_100336725 Ga0070684_1003367252 161
190 3300005539 Ga0068853_100033260 Ga0068853_1000332603 161
191 3300005543 Ga0070672_100522258 Ga0070672_1005222582 161
192 3300005547 Ga0070693_100060508 Ga0070693_1000605083 161
193 3300005563 Ga0068855_100002992 Ga0068855_10000299212 161
194 3300005563 Ga0068855_100005888 Ga0068855_10000588814 161
195 3300005563 Ga0068855_100017175 Ga0068855_1000171752 161
196 3300005563 Ga0068855_100145564 Ga0068855_1001455643 161
197 3300005577 Ga0068857_101619928 Ga0068857_1016199281 161
198 3300005578 Ga0068854_100073685 Ga0068854_1000736853 161
199 3300005578 Ga0068854_100336052 Ga0068854_1003360524 161
200 3300005614 Ga0068856_100632479 Ga0068856_1006324791 161
201 3300005616 Ga0068852_101055341 Ga0068852_1010553411 161
202 3300005617 Ga0068859_100064691 Ga0068859_1000646912 161
203 3300005617 Ga0068859_100142962 Ga0068859_1001429622 161
204 3300005618 Ga0068864_100269881 Ga0068864_1002698813 161
205 3300005719 Ga0068861_100592422 Ga0068861_1005924222 161
206 3300005834 Ga0068851_10080692 Ga0068851_100806923 161
207 3300005841 Ga0068863_100017497 Ga0068863_1000174974 161
208 3300005843 Ga0068860_100019538 Ga0068860_1000195384 161
209 3300005843 Ga0068860_100030900 Ga0068860_1000309006 161
210 3300005844 Ga0068862_100960039 Ga0068862_1009600392 161
211 3300006237 Ga0097621_100063023 Ga0097621_1000630232 161
212 3300006237 Ga0097621_100314087 Ga0097621_1003140872 161
213 3300006358 Ga0068871_100003787 Ga0068871_1000037871 161
214 3300006358 Ga0068871_100207190 Ga0068871_1002071902 161
215 3300006358 Ga0068871_100264827 Ga0068871_1002648273 161
216 3300006881 Ga0068865_100490979 Ga0068865_1004909791 161
217 3300006931 Ga0097620_100064693 Ga0097620_1000646932 161
218 3300006931 Ga0097620_100142962 Ga0097620_1001429622 161
219 3300009093 Ga0105240_10002290 Ga0105240_1000229019 161
220 3300009093 Ga0105240_10008150 Ga0105240_100081502 161
221 3300009093 Ga0105240_11125669 Ga0105240_111256692 161
222 3300009098 Ga0105245_10172951 Ga0105245_101729514 161
223 3300009174 Ga0105241_10001224 Ga0105241_100012245 161
224 3300009176 Ga0105242_10542644 Ga0105242_105426441 161
225 3300009553 Ga0105249_10997829 Ga0105249_109978292 161
226 3300010159 Ga0099796_10113634 Ga0099796_101136341 161
227 3300011119 Ga0105246_10186652 Ga0105246_101866522 161
228 3300013100 Ga0157373_10033843 Ga0157373_100338432 161
229 3300013100 Ga0157373_10435931 Ga0157373_104359312 161
230 3300013102 Ga0157371_10001159 Ga0157371_1000115917 161
231 3300013102 Ga0157371_10007512 Ga0157371_100075122 161
232 3300013102 Ga0157371_10838192 Ga0157371_108381921 161
233 3300013104 Ga0157370_10004630 Ga0157370_100046306 161
234 3300013104 Ga0157370_10019132 Ga0157370_100191322 161
235 3300013104 Ga0157370_10036554 Ga0157370_100365546 161
236 3300013104 Ga0157370_10192331 Ga0157370_101923313 161
237 3300013104 Ga0157370_10328199 Ga0157370_103281992 161
238 3300013104 Ga0157370_10422643 Ga0157370_104226432 161
239 3300013104 Ga0157370_10521704 Ga0157370_105217042 161
240 3300013105 Ga0157369_10053730 Ga0157369_100537306 161
241 3300013105 Ga0157369_10167210 Ga0157369_101672102 161
242 3300013105 Ga0157369_10228452 Ga0157369_102284523 161
243 3300013105 Ga0157369_10549196 Ga0157369_105491962 161
244 3300013296 Ga0157374_11503109 Ga0157374_115031092 161
245 3300013297 Ga0157378_10296177 Ga0157378_102961773 161
246 3300013297 Ga0157378_10827880 Ga0157378_108278802 161
247 3300013306 Ga0163162_10079020 Ga0163162_100790202 161
248 3300013307 Ga0157372_10009422 Ga0157372_1000942210 161
249 3300013307 Ga0157372_10122871 Ga0157372_101228714 161
250 3300013307 Ga0157372_10146224 Ga0157372_101462243 161
251 3300013307 Ga0157372_10170081 Ga0157372_101700812 161
252 3300013308 Ga0157375_11550859 Ga0157375_115508591 161
253 3300014325 Ga0163163_10334406 Ga0163163_103344062 161
254 3300014325 Ga0163163_10884256 Ga0163163_108842562 161
255 3300014968 Ga0157379_10547664 Ga0157379_105476641 161
256 3300014968 Ga0157379_10667911 Ga0157379_106679112 161
257 3300014969 Ga0157376_10041214 Ga0157376_100412144 161
258 3300014969 Ga0157376_10228294 Ga0157376_102282942 161
259 3300025899 Ga0207642_10188569 Ga0207642_101885692 161
260 3300025909 Ga0207705_10017824 Ga0207705_100178244 161
261 3300025909 Ga0207705_10039758 Ga0207705_100397581 161
262 3300025909 Ga0207705_10280507 Ga0207705_102805072 161
263 3300025909 Ga0207705_10425614 Ga0207705_104256142 161
264 3300025911 Ga0207654_10010152 Ga0207654_100101528 161
265 3300025912 Ga0207707_10001194 Ga0207707_1000119422 161
266 3300025912 Ga0207707_10544669 Ga0207707_105446692 161
267 3300025913 Ga0207695_10014807 Ga0207695_1001480712 161
268 3300025913 Ga0207695_10027822 Ga0207695_100278224 161
269 3300025917 Ga0207660_10001003 Ga0207660_1000100314 161
270 3300025917 Ga0207660_10012933 Ga0207660_100129335 161
271 3300025919 Ga0207657_10134790 Ga0207657_101347902 161
272 3300025921 Ga0207652_10000013 Ga0207652_1000001310 161
273 3300025921 Ga0207652_10002368 Ga0207652_1000236815 161
274 3300025921 Ga0207652_10036890 Ga0207652_100368902 161
275 3300025921 Ga0207652_10736152 Ga0207652_107361522 161
276 3300025925 Ga0207650_10079862 Ga0207650_100798622 161
277 3300025926 Ga0207659_11116375 Ga0207659_111163751 161
278 3300025931 Ga0207644_10330205 Ga0207644_103302052 161
279 3300025940 Ga0207691_10129293 Ga0207691_101292932 161
280 3300025949 Ga0207667_10001138 Ga0207667_1000113810 161
281 3300025949 Ga0207667_10110926 Ga0207667_101109262 161
282 3300025981 Ga0207640_10427772 Ga0207640_104277722 161
283 3300025986 Ga0207658_10009067 Ga0207658_100090677 161
284 3300026023 Ga0207677_10003369 Ga0207677_100033692 161
285 3300026067 Ga0207678_10230143 Ga0207678_102301432 161
286 3300026078 Ga0207702_10086907 Ga0207702_100869073 161
287 3300026118 Ga0207675_100411993 Ga0207675_1004119932 161
288 3300026118 Ga0207675_100949999 Ga0207675_1009499991 161
289 3300028381 Ga0268264_10006818 Ga0268264_100068186 161
290 3300028381 Ga0268264_10012637 Ga0268264_100126374 161
291 3300028786 Ga0307517_10021498 Ga0307517_100214987 161
292 3300028800 Ga0265338_10941828 Ga0265338_109418282 161
293 3300031344 Ga0265316_10482424 Ga0265316_104824241 161
294 3300031730 Ga0307516_10001379 Ga0307516_1000137917 161
295 3300032004 Ga0307414_10861600 Ga0307414_108616002 161
296 3300033180 Ga0307510_10003610 Ga0307510_100036104 161
297 3300035113 Ga0373936_0101579 Ga0373936_0101579_526_1011 161
298 3300037312 Ga0395899_0005868 Ga0395899_0005868_5077_5562 161
299 3300037312 Ga0395899_0061355 Ga0395899_0061355_1947_2432 161
300 3300037312 Ga0395899_0189490 Ga0395899_0189490_717_1202 161
301 3300037418 Ga0395900_0010753 Ga0395900_0010753_3909_4394 161
302 3300037418 Ga0395900_0039526 Ga0395900_0039526_2914_3399 161
303 3300037418 Ga0395900_0390237 Ga0395900_0390237_384_869 161
304 3300037418 Ga0395900_0776360 Ga0395900_0776360_136_621 161
305 3300037466 Ga0395898_0053435 Ga0395898_0053435_1271_1756 161
306 3300037466 Ga0395898_0075689 Ga0395898_0075689_826_1311 161
307 3300037466 Ga0395898_1353893 Ga0395898_1353893_97_582 161
308 3300037471 Ga0395905_0007136 Ga0395905_0007136_9729_10214 161
309 3300037471 Ga0395905_0528286 Ga0395905_0528286_291_776 161
310 3300038443 Ga0395901_0047717 Ga0395901_0047717_2367_2852 161
311 3300038443 Ga0395901_0174479 Ga0395901_0174479_329_814 161
312 3300038443 Ga0395901_0789469 Ga0395901_0789469_253_738 161
313 3300038443 Ga0395901_1051080 Ga0395901_1051080_44_529 161
314 3300046471 Ga0495650_0119793 Ga0495650_0119793_172_657 161
315 3300046507 Ga0495606_0008778 Ga0495606_0008778_4245_4742 161
316 3300049571 Ga0501034_0178622 Ga0501034_0178622_761_1255 161
317 3300049580 Ga0501046_0304168 Ga0501046_0304168_440_934 161
318 3300049581 Ga0501047_0112205 Ga0501047_0112205_408_902 161
319 3300049583 Ga0501067_0006335 Ga0501067_0006335_411_905 161
320 3300049584 Ga0501068_0513740 Ga0501068_0513740_227_721 161
321 3300049586 Ga0501070_0124607 Ga0501070_0124607_808_1302 161
322 3300049588 Ga0501072_0627396 Ga0501072_0627396_215_709 161
323 3300049589 Ga0501073_0121334 Ga0501073_0121334_1218_1712 161
324 3300049590 Ga0501074_0653992 Ga0501074_0653992_19_513 161
325 3300049703 Ga0501219_000085 Ga0501219_000085_2413_2931 161
326 3300049705 Ga0501225_0048200 Ga0501225_0048200_323_841 161
327 3300049741 Ga0501079_0093112 Ga0501079_0093112_1764_2258 161
328 3300049744 Ga0501083_0037903 Ga0501083_0037903_2004_2498 161
329 3300049758 Ga0501241_016123 Ga0501241_016123_152_670 161
330 3300049822 Ga0501035_1104770 Ga0501035_1104770_17_502 161
331 3300049823 Ga0501044_0119837 Ga0501044_0119837_1883_2377 161
332 3300050005 Ga0501284_00074 Ga0501284_00074_7543_8061 161
333 3300053090 Ga0500646_0137592 Ga0500646_0137592_206_691 161
334 3300054114 Ga0501084_0203069 Ga0501084_0203069_130_624 161
335 3300060353 Ga0501082_1087301 Ga0501082_1087301_64_558 161
336 3300005339 Ga0070660_100539006 Ga0070660_1005390062 162
337 3300005548 Ga0070665_101179616 Ga0070665_1011796161 162
338 3300025972 Ga0207668_10313711 Ga0207668_103137111 162
339 3300049823 Ga0501044_0074228 Ga0501044_0074228_95_583 162
340 3300005330 Ga0070690_100335719 Ga0070690_1003357191 163
341 3300005334 Ga0068869_100034416 Ga0068869_1000344163 163
342 3300005335 Ga0070666_10015364 Ga0070666_100153643 163
343 3300005338 Ga0068868_100147445 Ga0068868_1001474453 163
344 3300005340 Ga0070689_100855817 Ga0070689_1008558171 163
345 3300005355 Ga0070671_100013240 Ga0070671_1000132405 163
346 3300005365 Ga0070688_100579435 Ga0070688_1005794352 163
347 3300005367 Ga0070667_100001521 Ga0070667_1000015218 163
348 3300005543 Ga0070672_100085657 Ga0070672_1000856573 163
349 3300005616 Ga0068852_100127596 Ga0068852_1001275964 163
350 3300005617 Ga0068859_100000106 Ga0068859_10000010618 163
351 3300005618 Ga0068864_100009738 Ga0068864_1000097386 163
352 3300005834 Ga0068851_10028829 Ga0068851_100288293 163
353 3300005841 Ga0068863_100000567 Ga0068863_10000056712 163
354 3300005842 Ga0068858_100320417 Ga0068858_1003204172 163
355 3300005843 Ga0068860_100041189 Ga0068860_1000411893 163
356 3300005844 Ga0068862_100394342 Ga0068862_1003943422 163
357 3300006358 Ga0068871_100019773 Ga0068871_1000197736 163
358 3300006931 Ga0097620_100000106 Ga0097620_10000010618 163
359 3300009098 Ga0105245_10253669 Ga0105245_102536692 163
360 3300009101 Ga0105247_10019635 Ga0105247_100196352 163
361 3300009148 Ga0105243_11055129 Ga0105243_110551291 163
362 3300009174 Ga0105241_10002476 Ga0105241_100024764 163
363 3300009176 Ga0105242_10630168 Ga0105242_106301682 163
364 3300009545 Ga0105237_10003683 Ga0105237_1000368317 163
365 3300009553 Ga0105249_10002874 Ga0105249_1000287416 163
366 3300010375 Ga0105239_10060501 Ga0105239_100605013 163
367 3300011119 Ga0105246_10019431 Ga0105246_100194312 163
368 3300011119 Ga0105246_10085903 Ga0105246_100859033 163
369 3300013296 Ga0157374_10360233 Ga0157374_103602332 163
370 3300013297 Ga0157378_10667953 Ga0157378_106679532 163
371 3300013308 Ga0157375_10117318 Ga0157375_101173182 163
372 3300014968 Ga0157379_11042177 Ga0157379_110421772 163
373 3300025321 Ga0207656_10064115 Ga0207656_100641152 163
374 3300025900 Ga0207710_10010011 Ga0207710_100100114 163
375 3300025903 Ga0207680_10021255 Ga0207680_100212553 163
376 3300025911 Ga0207654_10002232 Ga0207654_100022327 163
377 3300025914 Ga0207671_10001029 Ga0207671_100010295 163
378 3300025927 Ga0207687_10392114 Ga0207687_103921141 163
379 3300025934 Ga0207686_10070326 Ga0207686_100703262 163
380 3300025936 Ga0207670_10169744 Ga0207670_101697441 163
381 3300025940 Ga0207691_10104179 Ga0207691_101041792 163
382 3300025942 Ga0207689_10000853 Ga0207689_1000085317 163
383 3300025961 Ga0207712_10002069 Ga0207712_1000206913 163
384 3300025986 Ga0207658_10010441 Ga0207658_100104413 163
385 3300026023 Ga0207677_10031649 Ga0207677_100316492 163
386 3300026035 Ga0207703_10003904 Ga0207703_1000390412 163
387 3300026088 Ga0207641_10000082 Ga0207641_1000008270 163
388 3300026095 Ga0207676_10005134 Ga0207676_100051348 163
389 3300026118 Ga0207675_101113695 Ga0207675_1011136951 163
390 3300026142 Ga0207698_10074014 Ga0207698_100740143 163
391 3300028381 Ga0268264_10030257 Ga0268264_100302573 163
392 3300005327 Ga0070658_10043686 Ga0070658_100436862 164
393 3300005329 Ga0070683_100571453 Ga0070683_1005714532 164
394 3300005337 Ga0070682_100012005 Ga0070682_1000120052 164
395 3300005339 Ga0070660_100014059 Ga0070660_1000140592 164
396 3300005344 Ga0070661_100352303 Ga0070661_1003523031 164
397 3300005457 Ga0070662_100756511 Ga0070662_1007565111 164
398 3300005530 Ga0070679_100000684 Ga0070679_1000006848 164
399 3300005616 Ga0068852_100001739 Ga0068852_1000017395 164
400 3300005616 Ga0068852_102253150 Ga0068852_1022531501 164
401 3300005985 Ga0081539_10001226 Ga0081539_1000122623 164
402 3300009545 Ga0105237_12324160 Ga0105237_123241601 164
403 3300010375 Ga0105239_10194993 Ga0105239_101949932 164
404 3300013104 Ga0157370_10169571 Ga0157370_101695712 164
405 3300013105 Ga0157369_10050745 Ga0157369_100507453 164
406 3300013307 Ga0157372_10092527 Ga0157372_100925272 164
407 3300025909 Ga0207705_10015146 Ga0207705_100151465 164
408 3300025912 Ga0207707_10332535 Ga0207707_103325352 164
409 3300025919 Ga0207657_10006170 Ga0207657_100061706 164
410 3300025921 Ga0207652_10005901 Ga0207652_100059014 164
411 3300025944 Ga0207661_10509389 Ga0207661_105093892 164
412 3300026142 Ga0207698_10004508 Ga0207698_100045082 164
413 3300035083 Ga0373926_0096882 Ga0373926_0096882_233_742 164
414 3300035120 Ga0373957_0384137 Ga0373957_0384137_31_540 164
415 3300035410 Ga0373924_0058123 Ga0373924_0058123_702_1211 164
416 3300035692 Ga0373935_0182666 Ga0373935_0182666_365_874 164
417 3300035724 Ga0373933_0133334 Ga0373933_0133334_689_1198 164
418 3300036401 Ga0373937_0153103 Ga0373937_0153103_1092_1601 164
419 3300045976 Ga0466967_0080611 Ga0466967_0080611_2354_2848 164
420 3300046463 Ga0495653_0100476 Ga0495653_0100476_544_1053 164
421 3300046472 Ga0495580_0682212 Ga0495580_0682212_140_649 164
422 3300046511 Ga0495608_0083467 Ga0495608_0083467_395_904 164
423 3300046514 Ga0495618_0046549 Ga0495618_0046549_925_1434 164
424 3300046516 Ga0495628_0181606 Ga0495628_0181606_985_1494 164
425 3300046517 Ga0495630_0034594 Ga0495630_0034594_562_1071 164
426 3300046536 Ga0495587_0024806 Ga0495587_0024806_2865_3410 164
427 3300046559 Ga0495667_0190088 Ga0495667_0190088_539_1048 164
428 3300046683 Ga0495658_0248580 Ga0495658_0248580_36_545 164
429 3300046809 Ga0495600_0104490 Ga0495600_0104490_373_882 164
430 3300047319 Ga0495674_0286954 Ga0495674_0286954_248_757 164
431 3300047321 Ga0495676_0330225 Ga0495676_0330225_406_915 164
432 3300047471 Ga0495684_0024797 Ga0495684_0024797_1084_1593 164
433 3300025904 Ga0207647_10014949 Ga0207647_100149494 165
434 3300025949 Ga0207667_10000583 Ga0207667_100005832 165
435 3300005327 Ga0070658_10068609 Ga0070658_100686091 166
436 3300005458 Ga0070681_10216029 Ga0070681_102160291 166
437 3300005535 Ga0070684_100438856 Ga0070684_1004388561 166
438 3300005577 Ga0068857_100057032 Ga0068857_1000570323 166
439 3300013100 Ga0157373_10055735 Ga0157373_100557352 166
440 3300013102 Ga0157371_10030010 Ga0157371_100300102 166
441 3300013102 Ga0157371_11395017 Ga0157371_113950171 166
442 3300013105 Ga0157369_10015498 Ga0157369_100154982 166
443 3300013307 Ga0157372_10527422 Ga0157372_105274222 166
444 3300013307 Ga0157372_11976833 Ga0157372_119768331 166
445 3300025904 Ga0207647_10208757 Ga0207647_102087572 166
446 3300025909 Ga0207705_10160955 Ga0207705_101609551 166
447 3300025917 Ga0207660_10332170 Ga0207660_103321702 166
448 3300025921 Ga0207652_10042375 Ga0207652_100423752 166
449 3300026116 Ga0207674_10034788 Ga0207674_100347885 166
450 3300005327 Ga0070658_10061316 Ga0070658_100613162 167
451 3300005328 Ga0070676_11175403 Ga0070676_111754031 167
452 3300005329 Ga0070683_100052913 Ga0070683_1000529132 167
453 3300005330 Ga0070690_100040602 Ga0070690_1000406022 167
454 3300005336 Ga0070680_100481268 Ga0070680_1004812683 167
455 3300005337 Ga0070682_100013837 Ga0070682_1000138373 167
456 3300005338 Ga0068868_100066319 Ga0068868_1000663192 167
457 3300005339 Ga0070660_100005499 Ga0070660_1000054994 167
458 3300005344 Ga0070661_100004914 Ga0070661_1000049142 167
459 3300005354 Ga0070675_100014996 Ga0070675_1000149961 167
460 3300005355 Ga0070671_100113381 Ga0070671_1001133812 167
461 3300005364 Ga0070673_100121772 Ga0070673_1001217721 167
462 3300005366 Ga0070659_100005352 Ga0070659_1000053525 167
463 3300005444 Ga0070694_100545011 Ga0070694_1005450111 167
464 3300005456 Ga0070678_100019337 Ga0070678_1000193372 167
465 3300005457 Ga0070662_100006981 Ga0070662_1000069817 167
466 3300005535 Ga0070684_100009329 Ga0070684_1000093296 167
467 3300005539 Ga0068853_100230718 Ga0068853_1002307182 167
468 3300005543 Ga0070672_100453183 Ga0070672_1004531832 167
469 3300005544 Ga0070686_100155697 Ga0070686_1001556971 167
470 3300005547 Ga0070693_100205561 Ga0070693_1002055612 167
471 3300005563 Ga0068855_100102486 Ga0068855_1001024863 167
472 3300005564 Ga0070664_100000950 Ga0070664_10000095013 167
473 3300005578 Ga0068854_100781931 Ga0068854_1007819312 167
474 3300005614 Ga0068856_100048103 Ga0068856_1000481032 167
475 3300005841 Ga0068863_100902052 Ga0068863_1009020522 167
476 3300005842 Ga0068858_101195948 Ga0068858_1011959481 167
477 3300006237 Ga0097621_100006863 Ga0097621_1000068632 167
478 3300006358 Ga0068871_100010171 Ga0068871_1000101714 167
479 3300013100 Ga0157373_10005254 Ga0157373_100052542 167
480 3300013102 Ga0157371_10024064 Ga0157371_100240644 167
481 3300013104 Ga0157370_10104499 Ga0157370_101044992 167
482 3300013105 Ga0157369_10043924 Ga0157369_100439242 167
483 3300013296 Ga0157374_10032223 Ga0157374_100322234 167
484 3300013297 Ga0157378_10008134 Ga0157378_100081346 167
485 3300013306 Ga0163162_10059671 Ga0163162_100596714 167
486 3300013307 Ga0157372_10069336 Ga0157372_100693362 167
487 3300014745 Ga0157377_10061600 Ga0157377_100616003 167
488 3300014969 Ga0157376_10186090 Ga0157376_101860902 167
489 3300017792 Ga0163161_10950830 Ga0163161_109508301 167
490 3300025909 Ga0207705_10702403 Ga0207705_107024031 167
491 3300025917 Ga0207660_10461622 Ga0207660_104616221 167
492 3300025919 Ga0207657_10004992 Ga0207657_100049924 167
493 3300025920 Ga0207649_10023819 Ga0207649_100238191 167
494 3300025921 Ga0207652_10554025 Ga0207652_105540251 167
495 3300025931 Ga0207644_10218405 Ga0207644_102184051 167
496 3300025932 Ga0207690_10042718 Ga0207690_100427182 167
497 3300025933 Ga0207706_10005696 Ga0207706_100056965 167
498 3300025944 Ga0207661_10434737 Ga0207661_104347371 167
499 3300025945 Ga0207679_10171795 Ga0207679_101717952 167
500 3300025949 Ga0207667_10176610 Ga0207667_101766102 167
501 3300025960 Ga0207651_10479788 Ga0207651_104797882 167
502 3300025981 Ga0207640_10166727 Ga0207640_101667272 167
503 3300026035 Ga0207703_10907799 Ga0207703_109077991 167
504 3300026041 Ga0207639_10023498 Ga0207639_100234984 167
505 3300026078 Ga0207702_10165092 Ga0207702_101650922 167
506 3300026088 Ga0207641_10784131 Ga0207641_107841311 167
507 3300026121 Ga0207683_10093471 Ga0207683_100934713 167
508 3300005441 Ga0070700_100706483 Ga0070700_1007064831 169
509 3300003320 rootH2_10087488 rootH2_100874884 170

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03692

CxxCxxCC

Putative zinc- or iron-chelating domain

79

173

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7al5-assembly1.cif.gz_D crystal structure of the selenomethionine substituted hypothetical protein pa1622 from pseudomonas aeruginosa pao1 0.39 34 101
6e8d-assembly1.cif.gz_A crystal structure of the bacillus subtilis sliding clamp-mutl complex. 0.3825 59 119
1s4b-assembly1.cif.gz_P crystal structure of human thimet oligopeptidase. 0.3375 29 148
8ity-assembly1.cif.gz_M human rna polymerase iii pre-initiation complex closed dna 1 0.3222 61 144
2o36-assembly1.cif.gz_A crystal structure of engineered thimet oligopeptidase with neurolysin specificity in neurotensin cleavage site 0.3204 34 148
ID Description Score Start End Superfamily
af_Q8IZ41_3_75_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.4174 34 94 1.10.238.10
af_Q8I568_671_747_3.30.70.870 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Elongation Factor G (Translational Gtpase), domain 3 0.3851 60 99 3.30.70.870
4ak1A04 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.3779 83 102 2.60.40.10
af_P36048_600_676_3.30.70.870 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Elongation Factor G (Translational Gtpase), domain 3 0.3559 60 119 3.30.70.870
af_Q55G92_457_533_3.30.70.870 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Elongation Factor G (Translational Gtpase), domain 3 0.3334 60 99 3.30.70.870
ID Description Score Start End GO Terms
AF-A0A521N604-F1-model_v4 YkgJ family cysteine cluster protein 0.8924 61 117
AF-A0A258MU31-F1-model_v4 Zinc/iron-chelating domain-containing protein 0.8907 6 156
AF-A0A1M4Y8B0-F1-model_v4 Zinc-or iron-chelating domain-containing protein 0.8828 15 156
AF-A0A4S8HPT7-F1-model_v4 YkgJ family cysteine cluster protein 0.8821 5 156
AF-A0A1G3J9A4-F1-model_v4 Fe-S-oxidoreductase 0.8818 8 157

Feature Viewer

pLDDT pTM Quality
78.01 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map