F456979

General Info

Members Datasets Scaffolds Average Seq Length
509 280 1018 264

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10399944|Ga0105239_103999442
Length 316
Sequence LEIYGYLMGRGPDVANRPRHSVESHEHLMAAITQDSGYNILRGFPMGGVTVLKNGLALIATMTGLLMSPAAASDTVLLHAAGSLRGALAEVSQAFEKSVPFKVQAKFGASGLLKDEIAGGARAEVFASANMEHPRALAAAKKSGPVVLFARNKLCALVRPGLAVTSDTLLERMLDPQVKLGTSTPKADPSGDYAFEAFRKAETVRTDARAVLEKKALQLTGSAAPPAGRNPYGWHIAEGRADMFLAYCTAARDARQENAELQSIALPDALAVSADYGLTVMADASPGAYQFALFILSSEGQRILAAYGFSAPGLSP

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
166 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
178 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
207 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
208 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
262 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
263 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
264 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
265 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
266 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
267 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
268 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
271 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
275 2643221736 Bosea sp. Root483D1 Isolate Unclassified
276 2791355199
277 2844104063 Bosea sp. Tri-39 Isolate Nodule
278 2851246043 Bosea sp. Tri-54 Isolate Nodule
279 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
280 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0
Isolates 0.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.16
Nodule 0.59
Rhizoplane 7.07
Rhizosphere 74.66
Stem 0
Stem Tuber 0
Unclassified 1.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10399944 3300010375 Bacteria 1554
2 JGI25153J46596_10001537 3300003215 Bacteria 13698
3 JGI25153J46596_10002228 3300003215 Bacteria 11312
4 JGI25405J52794_10022734 3300003911 Bacteria 1273
5 Ga0065165_1000209 3300005262 Bacteria 101834
6 Ga0070690_100007625 3300005330 Bacteria 6200
7 Ga0070670_100018595 3300005331 Bacteria 5955
8 Ga0070670_100177274 3300005331 Bacteria 1850
9 Ga0068869_100017122 3300005334 Bacteria 4905
10 Ga0068869_100124187 3300005334 Bacteria 1978
11 Ga0068869_100467702 3300005334 Bacteria 1048
12 Ga0068868_100004148 3300005338 Bacteria 10129
13 Ga0068868_100007157 3300005338 Bacteria 7929
14 Ga0068868_100317057 3300005338 Bacteria 1327
15 Ga0070660_100165221 3300005339 Bacteria 1785
16 Ga0070689_100004242 3300005340 Bacteria 9662
17 Ga0070689_100133931 3300005340 Bacteria 1989
18 Ga0070687_100015928 3300005343 Bacteria 3412
19 Ga0070661_100058763 3300005344 Bacteria 2818
20 Ga0070661_100101157 3300005344 Bacteria 2144
21 Ga0070661_100234589 3300005344 Bacteria 1411
22 Ga0070668_100106151 3300005347 Bacteria 2231
23 Ga0070668_100126362 3300005347 Bacteria 2048
24 Ga0070668_100141257 3300005347 Bacteria 1940
25 Ga0070668_100269558 3300005347 Bacteria 1419
26 Ga0070668_100382067 3300005347 Bacteria 1199
27 Ga0070668_100677173 3300005347 Bacteria 908
28 Ga0070671_100010850 3300005355 Bacteria 7310
29 Ga0070674_100020694 3300005356 Bacteria 4210
30 Ga0070674_100069795 3300005356 Bacteria 2480
31 Ga0070673_100065984 3300005364 Bacteria 2889
32 Ga0070688_100040872 3300005365 Bacteria 2844
33 Ga0070659_100055929 3300005366 Bacteria 3110
34 Ga0070659_100105715 3300005366 Bacteria 2268
35 Ga0070701_10064850 3300005438 Bacteria 1936
36 Ga0070711_100072040 3300005439 Bacteria 2437
37 Ga0070705_100136433 3300005440 Bacteria 1608
38 Ga0070700_100007929 3300005441 Bacteria 5763
39 Ga0070708_100312381 3300005445 Bacteria 1480
40 Ga0070663_100008714 3300005455 Bacteria 6252
41 Ga0070663_100021199 3300005455 Bacteria 4318
42 Ga0070663_100028448 3300005455 Bacteria 3805
43 Ga0070663_100046446 3300005455 Bacteria 3073
44 Ga0070663_100220862 3300005455 Bacteria 1488
45 Ga0070678_100020180 3300005456 Bacteria 4367
46 Ga0070678_100026624 3300005456 Bacteria 3913
47 Ga0070678_100099780 3300005456 Bacteria 2247
48 Ga0070678_100196516 3300005456 Bacteria 1662
49 Ga0070678_100338636 3300005456 Bacteria 1290
50 Ga0070662_100056902 3300005457 Bacteria 2840
51 Ga0068867_100043037 3300005459 Bacteria 3305
52 Ga0070706_100267542 3300005467 Bacteria 1595
53 Ga0070707_100352913 3300005468 Bacteria 1428
54 Ga0070698_100259965 3300005471 Bacteria 1668
55 Ga0070699_100199391 3300005518 Bacteria 1779
56 Ga0070697_100431786 3300005536 Bacteria 1146
57 Ga0070695_100004441 3300005545 Bacteria 8238
58 Ga0070665_100008737 3300005548 Bacteria 10254
59 Ga0070665_100014156 3300005548 Bacteria 8015
60 Ga0070665_100115492 3300005548 Bacteria 2687
61 Ga0070665_100136512 3300005548 Bacteria 2456
62 Ga0070665_100145365 3300005548 Bacteria 2374
63 Ga0070665_100153019 3300005548 Bacteria 2309
64 Ga0070665_100159099 3300005548 Bacteria 2260
65 Ga0070665_100397201 3300005548 Bacteria 1386
66 Ga0068855_100021611 3300005563 Bacteria 7718
67 Ga0070664_100109399 3300005564 Bacteria 2411
68 Ga0070664_100382612 3300005564 Bacteria 1285
69 Ga0068854_100024808 3300005578 Bacteria 4109
70 Ga0068856_100021308 3300005614 Bacteria 6298
71 Ga0070702_100005496 3300005615 Bacteria 5912
72 Ga0068852_100027942 3300005616 Bacteria 4607
73 Ga0068852_100040460 3300005616 Bacteria 3933
74 Ga0068859_100025816 3300005617 Bacteria 5894
75 Ga0068864_100025263 3300005618 Bacteria 5001
76 Ga0068866_10003450 3300005718 Bacteria 6470
77 Ga0068866_10069233 3300005718 Bacteria 1858
78 Ga0068861_100049025 3300005719 Bacteria 3196
79 Ga0068861_100050086 3300005719 Bacteria 3165
80 Ga0068861_100303245 3300005719 Bacteria 1384
81 Ga0068861_100347761 3300005719 Bacteria 1299
82 Ga0068861_100529706 3300005719 Bacteria 1070
83 Ga0068870_10118705 3300005840 Bacteria 1520
84 Ga0068863_100052782 3300005841 Bacteria 3852
85 Ga0068863_100140104 3300005841 Bacteria 2311
86 Ga0068858_100022715 3300005842 Bacteria 5849
87 Ga0068858_100025404 3300005842 Bacteria 5512
88 Ga0068858_100232239 3300005842 Bacteria 1749
89 Ga0068858_100459426 3300005842 Bacteria 1228
90 Ga0068860_100005739 3300005843 Bacteria 12518
91 Ga0068860_100142958 3300005843 Bacteria 2300
92 Ga0068862_100032654 3300005844 Bacteria 4398
93 Ga0068862_100077866 3300005844 Bacteria 2872
94 Ga0068862_100097820 3300005844 Bacteria 2563
95 Ga0068862_100735568 3300005844 Bacteria 958
96 Ga0081455_10006927 3300005937 Bacteria 12057
97 Ga0081455_10047171 3300005937 Bacteria 3733
98 Ga0081455_10074531 3300005937 Bacteria 2803
99 Ga0081455_10095006 3300005937 Bacteria 2407
100 Ga0081455_10196777 3300005937 Bacteria 1513
101 Ga0081540_1000948 3300005983 Bacteria 26149
102 Ga0081540_1004138 3300005983 Bacteria 11189
103 Ga0081540_1007687 3300005983 Bacteria 7643
104 Ga0081540_1011103 3300005983 Bacteria 6046
105 Ga0081539_10041088 3300005985 Bacteria 2707
106 Ga0081539_10058556 3300005985 Bacteria 2125
107 Ga0070717_10369754 3300006028 Bacteria 1284
108 Ga0070717_10452175 3300006028 Bacteria 1158
109 Ga0075365_10026500 3300006038 Bacteria 3680
110 Ga0075365_10065951 3300006038 Bacteria 2428
111 Ga0075365_10081986 3300006038 Bacteria 2186
112 Ga0075365_10084686 3300006038 Bacteria 2152
113 Ga0075365_10114669 3300006038 Bacteria 1854
114 Ga0075365_10235262 3300006038 Bacteria 1286
115 Ga0075365_10246610 3300006038 Bacteria 1254
116 Ga0075368_10008933 3300006042 Bacteria 3592
117 Ga0075363_100222372 3300006048 Bacteria 1082
118 Ga0075363_100252451 3300006048 Bacteria 1016
119 Ga0075364_10014811 3300006051 Bacteria 4824
120 Ga0075364_10148171 3300006051 Bacteria 1581
121 Ga0075364_10230809 3300006051 Bacteria 1257
122 Ga0070712_100571824 3300006175 Bacteria 954
123 Ga0075362_10022640 3300006177 Bacteria 2650
124 Ga0075362_10024000 3300006177 Bacteria 2584
125 Ga0075367_10024602 3300006178 Bacteria 3397
126 Ga0075367_10054210 3300006178 Bacteria 2377
127 Ga0075367_10060320 3300006178 Bacteria 2261
128 Ga0075367_10120596 3300006178 Bacteria 1616
129 Ga0075369_10015863 3300006186 Bacteria 3031
130 Ga0075366_10025213 3300006195 Bacteria 3472
131 Ga0075366_10056242 3300006195 Bacteria 2337
132 Ga0075366_10111785 3300006195 Bacteria 1643
133 Ga0097621_100279291 3300006237 Unclassified 1470
134 Ga0075370_10016088 3300006353 Bacteria 4020
135 Ga0075370_10020374 3300006353 Bacteria 3624
136 Ga0075370_10025265 3300006353 Bacteria 3284
137 Ga0075370_10064891 3300006353 Bacteria 2083
138 Ga0075428_100029097 3300006844 Bacteria 6113
139 Ga0075428_100043811 3300006844 Bacteria 4919
140 Ga0075428_100212742 3300006844 Bacteria 2089
141 Ga0075428_100374393 3300006844 Bacteria 1527
142 Ga0075430_100000029 3300006846 Bacteria 73352
143 Ga0075430_100182608 3300006846 Bacteria 1745
144 Ga0075431_100076574 3300006847 Bacteria 3452
145 Ga0075431_100663398 3300006847 Bacteria 1023
146 Ga0075434_100028848 3300006871 Bacteria 5458
147 Ga0075434_100067089 3300006871 Bacteria 3575
148 Ga0068865_100092194 3300006881 Bacteria 2200
149 Ga0068865_100161804 3300006881 Bacteria 1708
150 Ga0068865_100336959 3300006881 Bacteria 1218
151 Ga0097620_100025816 3300006931 Bacteria 5894
152 Ga0099795_10002392 3300007788 Bacteria 4404
153 Ga0105240_10026366 3300009093 Bacteria 7624
154 Ga0111539_10014716 3300009094 Bacteria 9760
155 Ga0111539_10059271 3300009094 Bacteria 4540
156 Ga0111539_10062705 3300009094 Bacteria 4400
157 Ga0105247_10002289 3300009101 Bacteria 13101
158 Ga0105247_10217944 3300009101 Bacteria 1290
159 Ga0114129_10061881 3300009147 Bacteria 5231
160 Ga0114129_10497506 3300009147 Bacteria 1593
161 Ga0105243_10119090 3300009148 Bacteria 2223
162 Ga0105243_10123249 3300009148 Bacteria 2189
163 Ga0105242_10035577 3300009176 Bacteria 3993
164 Ga0105242_10340958 3300009176 Bacteria 1381
165 Ga0105248_10008256 3300009177 Bacteria 11439
166 Ga0105248_10047206 3300009177 Bacteria 4829
167 Ga0105237_10028364 3300009545 Bacteria 5703
168 Ga0105238_10059815 3300009551 Bacteria 3816
169 Ga0105238_10389873 3300009551 Bacteria 1385
170 Ga0105249_10023502 3300009553 Bacteria 5531
171 Ga0105239_10038265 3300010375 Bacteria 5257
172 Ga0105239_10092060 3300010375 Bacteria 3346
173 Ga0105239_10281671 3300010375 Bacteria 1872
174 Ga0105239_10342245 3300010375 Bacteria 1688
175 Ga0105246_10008246 3300011119 Bacteria 6400
176 Ga0105246_10079883 3300011119 Bacteria 2327
177 Ga0157374_10009863 3300013296 Bacteria 8198
178 Ga0157374_10022161 3300013296 Bacteria 5664
179 Ga0157378_10103968 3300013297 Bacteria 2596
180 Ga0157378_10310803 3300013297 Bacteria 1528
181 Ga0163162_10025642 3300013306 Bacteria 5828
182 Ga0163162_10898853 3300013306 Bacteria 999
183 Ga0163162_10989302 3300013306 Bacteria 951
184 Ga0157375_10170651 3300013308 Bacteria 2323
185 Ga0157375_10191329 3300013308 Bacteria 2201
186 Ga0163163_10010304 3300014325 Bacteria 8401
187 Ga0157380_10050916 3300014326 Bacteria 3272
188 Ga0157380_10091362 3300014326 Bacteria 2513
189 Ga0157380_10169690 3300014326 Bacteria 1905
190 Ga0157380_10584265 3300014326 Bacteria 1102
191 Ga0157377_10039947 3300014745 Bacteria 2597
192 Ga0157377_10250873 3300014745 Bacteria 1147
193 Ga0157377_10401372 3300014745 Bacteria 934
194 Ga0157379_10021965 3300014968 Bacteria 5655
195 Ga0157379_10382098 3300014968 Bacteria 1292
196 Ga0157376_10020304 3300014969 Bacteria 5137
197 Ga0157376_10056408 3300014969 Bacteria 3281
198 Ga0157376_10417780 3300014969 Bacteria 1301
199 Ga0163161_10012863 3300017792 Bacteria 5815
200 Ga0163161_10072574 3300017792 Bacteria 2520
201 Ga0209130_1000080 3300025284 Bacteria 166684
202 Ga0209025_1008635 3300025294 Bacteria 7285
203 Ga0209025_1026310 3300025294 Bacteria 2926
204 Ga0209758_1000079 3300025297 Bacteria 262874
205 Ga0209758_1020356 3300025297 Bacteria 3143
206 Ga0207426_1005450 3300025302 Bacteria 5804
207 Ga0207642_10036726 3300025899 Bacteria 2105
208 Ga0207688_10004896 3300025901 Bacteria 7288
209 Ga0207688_10083379 3300025901 Bacteria 1828
210 Ga0207647_10060065 3300025904 Bacteria 2325
211 Ga0207647_10220571 3300025904 Bacteria 1093
212 Ga0207643_10005792 3300025908 Bacteria 6604
213 Ga0207643_10043264 3300025908 Bacteria 2541
214 Ga0207654_10008079 3300025911 Bacteria 5304
215 Ga0207671_10008698 3300025914 Bacteria 8568
216 Ga0207663_10048761 3300025916 Bacteria 2623
217 Ga0207662_10025959 3300025918 Bacteria 3377
218 Ga0207662_10257500 3300025918 Bacteria 1147
219 Ga0207657_10023462 3300025919 Bacteria 5743
220 Ga0207649_10026772 3300025920 Bacteria 3377
221 Ga0207646_10260387 3300025922 Bacteria 1567
222 Ga0207650_10071709 3300025925 Bacteria 2606
223 Ga0207687_10048589 3300025927 Bacteria 2947
224 Ga0207700_10108215 3300025928 Bacteria 2232
225 Ga0207644_10183998 3300025931 Bacteria 1639
226 Ga0207690_10032618 3300025932 Bacteria 3343
227 Ga0207690_10123393 3300025932 Bacteria 1885
228 Ga0207706_10005745 3300025933 Bacteria 11553
229 Ga0207706_10126249 3300025933 Bacteria 2250
230 Ga0207706_10313158 3300025933 Bacteria 1366
231 Ga0207686_10054687 3300025934 Bacteria 2501
232 Ga0207709_10028958 3300025935 Bacteria 3206
233 Ga0207669_10366355 3300025937 Bacteria 1118
234 Ga0207704_10009866 3300025938 Bacteria 4628
235 Ga0207691_10021052 3300025940 Bacteria 6162
236 Ga0207691_10162152 3300025940 Bacteria 1961
237 Ga0207711_10037937 3300025941 Bacteria 4096
238 Ga0207689_10015653 3300025942 Bacteria 6423
239 Ga0207689_10019078 3300025942 Bacteria 5783
240 Ga0207689_10037773 3300025942 Bacteria 4003
241 Ga0207661_10061197 3300025944 Bacteria 3041
242 Ga0207679_10087539 3300025945 Bacteria 2399
243 Ga0207679_10167256 3300025945 Bacteria 1807
244 Ga0207667_10546669 3300025949 Bacteria 1172
245 Ga0207712_10348306 3300025961 Bacteria 1231
246 Ga0207668_10010335 3300025972 Bacteria 5639
247 Ga0207668_10016019 3300025972 Bacteria 4669
248 Ga0207668_10160443 3300025972 Bacteria 1751
249 Ga0207668_10179949 3300025972 Bacteria 1666
250 Ga0207668_10199840 3300025972 Bacteria 1591
251 Ga0207668_10312437 3300025972 Bacteria 1301
252 Ga0207668_10352492 3300025972 Bacteria 1231
253 Ga0207658_10010664 3300025986 Bacteria 6247
254 Ga0207658_10112593 3300025986 Bacteria 2154
255 Ga0207677_10003374 3300026023 Bacteria 8451
256 Ga0207677_10045320 3300026023 Bacteria 2936
257 Ga0207677_10266322 3300026023 Bacteria 1399
258 Ga0207703_10008823 3300026035 Bacteria 7949
259 Ga0207703_10140722 3300026035 Bacteria 2094
260 Ga0207703_10309350 3300026035 Bacteria 1444
261 Ga0207639_10287102 3300026041 Bacteria 1449
262 Ga0207678_10014733 3300026067 Bacteria 6880
263 Ga0207678_10019040 3300026067 Bacteria 6029
264 Ga0207678_10060018 3300026067 Bacteria 3272
265 Ga0207678_10244329 3300026067 Bacteria 1537
266 Ga0207708_10007808 3300026075 Bacteria 7922
267 Ga0207708_10120515 3300026075 Bacteria 2044
268 Ga0207702_10143155 3300026078 Bacteria 2166
269 Ga0207641_10174070 3300026088 Bacteria 1967
270 Ga0207648_10004699 3300026089 Bacteria 13964
271 Ga0207674_10409210 3300026116 Unclassified 1311
272 Ga0207675_100013083 3300026118 Bacteria 7745
273 Ga0207675_100024197 3300026118 Bacteria 5647
274 Ga0207675_100035075 3300026118 Bacteria 4679
275 Ga0207675_100106233 3300026118 Bacteria 2647
276 Ga0207675_100283329 3300026118 Bacteria 1611
277 Ga0207683_10013941 3300026121 Bacteria 6853
278 Ga0207683_10023737 3300026121 Bacteria 5276
279 Ga0207683_10029530 3300026121 Bacteria 4747
280 Ga0207683_10044623 3300026121 Bacteria 3875
281 Ga0207683_10347747 3300026121 Bacteria 1360
282 Ga0207683_10692559 3300026121 Bacteria 945
283 Ga0268266_10000638 3300028379 Bacteria 47680
284 Ga0268266_10000807 3300028379 Bacteria 41568
285 Ga0268266_10006312 3300028379 Bacteria 10862
286 Ga0268266_10044321 3300028379 Bacteria 3803
287 Ga0268266_10132501 3300028379 Bacteria 2230
288 Ga0268266_10165483 3300028379 Bacteria 2003
289 Ga0268265_10011307 3300028380 Bacteria 6035
290 Ga0268265_10189065 3300028380 Bacteria 1776
291 Ga0268265_10677758 3300028380 Bacteria 994
292 Ga0268264_10346792 3300028381 Bacteria 1412
293 Ga0307517_10001037 3300028786 Bacteria 47162
294 Ga0307517_10109412 3300028786 Bacteria 2114
295 Ga0307517_10169309 3300028786 Bacteria 1441
296 Ga0307515_10038410 3300028794 Bacteria 7659
297 Ga0265340_10016232 3300031247 Bacteria 3859
298 Ga0265339_10023413 3300031249 Bacteria 3570
299 Ga0307513_10124215 3300031456 Bacteria 2541
300 Ga0307509_10295267 3300031507 Bacteria 1372
301 Ga0265314_10063589 3300031711 Bacteria 2503
302 Ga0265342_10001629 3300031712 Bacteria 20703
303 Ga0307516_10157908 3300031730 Bacteria 2021
304 Ga0307405_10342202 3300031731 Bacteria 1150
305 Ga0307407_10198344 3300031903 Bacteria 1343
306 Ga0307510_10003040 3300033180 Bacteria 19361
307 Ga0373938_0037568 3300034957 Bacteria 1064
308 Ga0373934_0056811 3300035086 Bacteria 1557
309 Ga0373936_0088388 3300035113 Bacteria 1297
310 Ga0373945_0008684 3300035116 Bacteria 3314
311 Ga0373943_0035970 3300035170 Bacteria 2370
312 Ga0373946_0004911 3300035171 Bacteria 4816
313 Ga0373931_0057678 3300035691 Bacteria 2083
314 Ga0373931_0227475 3300035691 Unclassified 1126
315 Ga0373931_0260712 3300035691 Unclassified 1057
316 Ga0373935_0038259 3300035692 Bacteria 3003
317 Ga0373927_0005061 3300035695 Bacteria 9123
318 Ga0373927_0256876 3300035695 Bacteria 1149
319 Ga0373947_0100615 3300035725 Bacteria 1816
320 Ga0373947_0164273 3300035725 Bacteria 1437
321 Ga0373947_0203886 3300035725 Bacteria 1295
322 Ga0373937_0002219 3300036401 Bacteria 16228
323 Ga0373925_0003941 3300037068 Bacteria 11329
324 Ga0373925_0591514 3300037068 Bacteria 914
325 Ga0439465_0035381 3300041413 Bacteria 1601
326 Ga0495617_022865 3300046452 Bacteria 2113
327 Ga0495603_0046248 3300046455 Bacteria 2594
328 Ga0495638_0200750 3300046460 Bacteria 1126
329 Ga0495650_0067358 3300046471 Bacteria 1415
330 Ga0495639_0134068 3300046475 Bacteria 1187
331 Ga0495584_0205593 3300046491 Bacteria 1001
332 Ga0495585_0026904 3300046492 Bacteria 3284
333 Ga0495585_0206991 3300046492 Bacteria 996
334 Ga0495594_0090314 3300046499 Bacteria 1716
335 Ga0495594_0205500 3300046499 Bacteria 1122
336 Ga0495607_0147942 3300046501 Bacteria 1205
337 Ga0495606_0103807 3300046507 Bacteria 1726
338 Ga0495610_0042191 3300046512 Bacteria 2284
339 Ga0495610_0105106 3300046512 Bacteria 1259
340 Ga0495620_0052646 3300046515 Bacteria 1728
341 Ga0495620_0081369 3300046515 Bacteria 1310
342 Ga0495631_0146650 3300046518 Unclassified 1013
343 Ga0495632_0041392 3300046519 Bacteria 2315
344 Ga0495632_0100691 3300046519 Bacteria 1362
345 Ga0495632_0149968 3300046519 Bacteria 1078
346 Ga0495643_0174604 3300046522 Bacteria 1048
347 Ga0495644_0101382 3300046523 Bacteria 1089
348 Ga0495644_0110048 3300046523 Bacteria 1045
349 Ga0495652_0432414 3300046529 Bacteria 925
350 Ga0495665_0121780 3300046531 Bacteria 1366
351 Ga0495640_0071703 3300046533 Bacteria 2324
352 Ga0495622_0022552 3300046557 Bacteria 2934
353 Ga0495622_0052900 3300046557 Bacteria 1884
354 Ga0495622_0066148 3300046557 Bacteria 1671
355 Ga0495633_0025824 3300046558 Bacteria 2889
356 Ga0495656_0081888 3300046615 Bacteria 1458
357 Ga0495656_0116752 3300046615 Bacteria 1255
358 Ga0495656_0195857 3300046615 Bacteria 1000
359 Ga0495668_0124622 3300046616 Bacteria 1410
360 Ga0495634_0087759 3300046642 Bacteria 2024
361 Ga0495611_0060195 3300046648 Bacteria 1725
362 Ga0495625_0086319 3300046660 Bacteria 2177
363 Ga0495625_0110095 3300046660 Bacteria 1883
364 Ga0495625_0267199 3300046660 Bacteria 1105
365 Ga0495635_0047860 3300046663 Bacteria 2948
366 Ga0495661_0191448 3300046665 Bacteria 1077
367 Ga0495647_0030887 3300046681 Bacteria 1990
368 Ga0495647_0051382 3300046681 Bacteria 1602
369 Ga0495658_0010016 3300046683 Bacteria 4732
370 Ga0495669_0037534 3300046684 Bacteria 2144
371 Ga0495669_0038387 3300046684 Bacteria 2121
372 Ga0495613_0057067 3300046689 Bacteria 2867
373 Ga0495624_0062825 3300046690 Bacteria 2322
374 Ga0495670_0286369 3300046691 Bacteria 882
375 Ga0495649_0058245 3300046694 Bacteria 2082
376 Ga0495581_0276227 3300047315 Bacteria 982
377 Ga0495636_0113306 3300047318 Bacteria 1195
378 Ga0495672_0177903 3300047320 Bacteria 1080
379 Ga0495676_0141267 3300047321 Bacteria 1725
380 Ga0495676_0145962 3300047321 Bacteria 1690
381 Ga0495683_0047129 3300047323 Bacteria 2163
382 Ga0495677_0049616 3300047445 Bacteria 1543
383 Ga0495685_071794 3300047447 Bacteria 1159
384 Ga0495673_0092044 3300047469 Bacteria 1238
385 Ga0495686_0141405 3300047472 Bacteria 1420
386 Ga0495686_0153010 3300047472 Bacteria 1353
387 Ga0495614_0068765 3300048089 Bacteria 1525
388 Ga0495614_0152078 3300048089 Bacteria 1033
389 Ga0496101_0039626 3300048904 Bacteria 3352
390 Ga0496101_0047905 3300048904 Bacteria 3070
391 Ga0496101_0073124 3300048904 Bacteria 2518
392 Ga0496102_0009948 3300048905 Bacteria 8179
393 Ga0496102_0081213 3300048905 Bacteria 2988
394 Ga0496102_0082283 3300048905 Bacteria 2969
395 Ga0496102_0127761 3300048905 Bacteria 2377
396 Ga0496103_0004098 3300048906 Bacteria 8857
397 Ga0496104_0050718 3300048907 Bacteria 3915
398 Ga0496104_0428213 3300048907 Bacteria 1235
399 Ga0496105_0001515 3300048908 Bacteria 16423
400 Ga0496105_0004141 3300048908 Bacteria 10879
401 Ga0496106_0006373 3300048909 Bacteria 8735
402 Ga0496106_0066405 3300048909 Bacteria 2747
403 Ga0496107_0033724 3300048910 Bacteria 3664
404 Ga0496107_0034010 3300048910 Bacteria 3649
405 Ga0496108_0001028 3300048911 Bacteria 21742
406 Ga0496108_0009471 3300048911 Bacteria 7886
407 Ga0496108_0038439 3300048911 Bacteria 3987
408 Ga0496109_0002430 3300048912 Bacteria 15588
409 Ga0496109_0093530 3300048912 Bacteria 2782
410 Ga0496109_0107195 3300048912 Bacteria 2595
411 Ga0496110_0001894 3300048913 Bacteria 15456
412 Ga0496110_0040479 3300048913 Bacteria 4061
413 Ga0496111_0000436 3300048914 Bacteria 21122
414 Ga0496111_0002610 3300048914 Bacteria 10913
415 Ga0496111_0115083 3300048914 Bacteria 1983
416 Ga0496111_0555536 3300048914 Bacteria 843
417 Ga0496112_0004518 3300048915 Bacteria 11815
418 Ga0496113_0001905 3300048916 Bacteria 11913
419 Ga0496113_0026153 3300048916 Bacteria 4169
420 Ga0496114_0024989 3300048917 Bacteria 4878
421 Ga0496114_0369769 3300048917 Bacteria 1269
422 Ga0496115_0021662 3300048918 Bacteria 4967
423 Ga0496115_0073654 3300048918 Bacteria 2772
424 Ga0496115_0157970 3300048918 Bacteria 1873
425 Ga0496117_0218132 3300048920 Bacteria 1064
426 Ga0496119_0179135 3300048922 Bacteria 1113
427 Ga0496121_0000091 3300048924 Bacteria 216685
428 Ga0496121_0163415 3300048924 Bacteria 1625
429 Ga0496121_0179499 3300048924 Bacteria 1529
430 Ga0496124_0014474 3300048927 Bacteria 7627
431 Ga0496124_0051872 3300048927 Bacteria 3488
432 Ga0496125_0065286 3300048928 Bacteria 2885
433 Ga0496126_0014034 3300048929 Bacteria 8117
434 Ga0496126_0049099 3300048929 Bacteria 3854
435 Ga0496126_0138091 3300048929 Bacteria 2100
436 Ga0496126_0177049 3300048929 Bacteria 1814
437 Ga0501033_0109734 3300049570 Bacteria 2009
438 Ga0501034_0024555 3300049571 Bacteria 6131
439 Ga0501034_0124109 3300049571 Bacteria 2568
440 Ga0501036_0339869 3300049572 Bacteria 1254
441 Ga0501039_0472257 3300049575 Bacteria 985
442 Ga0501047_0016268 3300049581 Bacteria 7094
443 Ga0501047_0036168 3300049581 Bacteria 4771
444 Ga0501073_0035365 3300049589 Bacteria 3552
445 Ga0501073_0124928 3300049589 Bacteria 1783
446 Ga0501075_0251790 3300049591 Unclassified 1346
447 Ga0501076_0047592 3300049592 Bacteria 3391
448 Ga0501076_0111148 3300049592 Bacteria 2215
449 Ga0501076_0592388 3300049592 Bacteria 915
450 Ga0501081_0050060 3300049743 Bacteria 2878
451 Ga0501083_0024497 3300049744 Bacteria 4181
452 Ga0501035_0356771 3300049822 Bacteria 1222
453 nmdc:mga03683_38137_c1 3300050489 Bacteria 1961
454 nmdc:mga03n38_148136_c1 3300050490 Bacteria 1179
455 nmdc:mga03n38_158299_c1 3300050490 Bacteria 1145
456 nmdc:mga03n38_220438_c1 3300050490 Bacteria 990
457 nmdc:mga03n38_2665_c1 3300050490 Bacteria 5572
458 nmdc:mga00v17_11637_c1 3300050491 Bacteria 4837
459 nmdc:mga00v17_57211_c1 3300050491 Bacteria 2385
460 nmdc:mga0yw44_13581_c1 3300050492 Bacteria 4293
461 nmdc:mga0yw44_42397_c1 3300050492 Bacteria 2714
462 nmdc:mga0yw44_9147_c1 3300050492 Bacteria 4985
463 nmdc:mga0k408_232635_c1 3300050493 Bacteria 1100
464 nmdc:mga0k408_393947_c1 3300050493 Bacteria 824
465 nmdc:mga06z11_243427_c1 3300050494 Bacteria 1057
466 nmdc:mga06z11_76491_c1 3300050494 Bacteria 1785
467 nmdc:mga07m45_5521_c1 3300050496 Bacteria 6303
468 nmdc:mga07m45_78381_c1 3300050496 Bacteria 1885
469 nmdc:mga07m45_89122_c1 3300050496 Bacteria 1766
470 nmdc:mga05p37_127696_c1 3300050507 Bacteria 3121
471 nmdc:mga05p37_50505_c1 3300050507 Bacteria 5115
472 nmdc:mga0qj67_51461_c1 3300050509 Bacteria 3257
473 nmdc:mga06r32_315983_c1 3300050510 Bacteria 1547
474 nmdc:mga08y16_172280_c1 3300050511 Bacteria 2248
475 nmdc:mga08y16_48196_c1 3300050511 Bacteria 4458
476 nmdc:mga08y16_66137_c1 3300050511 Bacteria 3773
477 nmdc:mga0n895_13911_c1 3300050512 Bacteria 7285
478 nmdc:mga0n895_282413_c1 3300050512 Bacteria 1683
479 nmdc:mga0n895_38960_c1 3300050512 Bacteria 4608
480 nmdc:mga0rr50_20477_c1 3300050513 Bacteria 4494
481 nmdc:mga08x19_232388_c1 3300050514 Bacteria 1269
482 nmdc:mga0sz30_44535_c1 3300050516 Bacteria 1870
483 Ga0495601_0043844 3300053077 Bacteria 2810
484 Ga0495601_0049720 3300053077 Bacteria 2644
485 Ga0495655_0025842 3300053083 Bacteria 1378
486 Ga0495619_0065152 3300053085 Bacteria 2430
487 Ga0500555_074934 3300053103 Bacteria 888
488 Ga0500562_055599 3300053108 Bacteria 1061
489 Ga0500594_0110783 3300053118 Bacteria 854
490 Ga0500595_008592 3300053119 Bacteria 4167
491 Ga0500642_0032408 3300053130 Bacteria 2193
492 Ga0500642_0223484 3300053130 Bacteria 872
493 Ga0500568_0054879 3300053139 Bacteria 1557
494 Ga0500588_0046292 3300053146 Bacteria 1337
495 Ga0500590_102551 3300053148 Bacteria 1372
496 Ga0500616_0053235 3300053153 Bacteria 2124
497 Ga0500627_0147730 3300053158 Bacteria 1062
498 Ga0500645_007308 3300053730 Bacteria 3861
499 Ga0500645_017374 3300053730 Bacteria 2257
500 Ga0501084_0233830 3300054114 Bacteria 1551
501 Ga0501082_0023425 3300060353 Bacteria 5327
502 Ga0530510_0237246 3300061734 Bacteria 1357
503 Ga0530510_0262968 3300061734 Bacteria 1287
504 2644746011 2643221736 Bacteria 6608466
505 2793079001
506 2844105715 2844104063 Bacteria 6440972
507 2851246071 2851246043 Bacteria 6439203
508 2874608935 2874604998 Bacteria 7834745
509 8006987247 8006984368 Bacteria 9651211
510 Ga0105239_10399944
511 JGI25153J46596_10001537
512 JGI25153J46596_10002228
513 JGI25405J52794_10022734
514 Ga0065165_1000209
515 Ga0070690_100007625
516 Ga0070670_100018595
517 Ga0070670_100177274
518 Ga0068869_100017122
519 Ga0068869_100124187
520 Ga0068869_100467702
521 Ga0068868_100004148
522 Ga0068868_100007157
523 Ga0068868_100317057
524 Ga0070660_100165221
525 Ga0070689_100004242
526 Ga0070689_100133931
527 Ga0070687_100015928
528 Ga0070661_100058763
529 Ga0070661_100101157
530 Ga0070661_100234589
531 Ga0070668_100106151
532 Ga0070668_100126362
533 Ga0070668_100141257
534 Ga0070668_100269558
535 Ga0070668_100382067
536 Ga0070668_100677173
537 Ga0070671_100010850
538 Ga0070674_100020694
539 Ga0070674_100069795
540 Ga0070673_100065984
541 Ga0070688_100040872
542 Ga0070659_100055929
543 Ga0070659_100105715
544 Ga0070701_10064850
545 Ga0070711_100072040
546 Ga0070705_100136433
547 Ga0070700_100007929
548 Ga0070708_100312381
549 Ga0070663_100008714
550 Ga0070663_100021199
551 Ga0070663_100028448
552 Ga0070663_100046446
553 Ga0070663_100220862
554 Ga0070678_100020180
555 Ga0070678_100026624
556 Ga0070678_100099780
557 Ga0070678_100196516
558 Ga0070678_100338636
559 Ga0070662_100056902
560 Ga0068867_100043037
561 Ga0070706_100267542
562 Ga0070707_100352913
563 Ga0070698_100259965
564 Ga0070699_100199391
565 Ga0070697_100431786
566 Ga0070695_100004441
567 Ga0070665_100008737
568 Ga0070665_100014156
569 Ga0070665_100115492
570 Ga0070665_100136512
571 Ga0070665_100145365
572 Ga0070665_100153019
573 Ga0070665_100159099
574 Ga0070665_100397201
575 Ga0068855_100021611
576 Ga0070664_100109399
577 Ga0070664_100382612
578 Ga0068854_100024808
579 Ga0068856_100021308
580 Ga0070702_100005496
581 Ga0068852_100027942
582 Ga0068852_100040460
583 Ga0068859_100025816
584 Ga0068864_100025263
585 Ga0068866_10003450
586 Ga0068866_10069233
587 Ga0068861_100049025
588 Ga0068861_100050086
589 Ga0068861_100303245
590 Ga0068861_100347761
591 Ga0068861_100529706
592 Ga0068870_10118705
593 Ga0068863_100052782
594 Ga0068863_100140104
595 Ga0068858_100022715
596 Ga0068858_100025404
597 Ga0068858_100232239
598 Ga0068858_100459426
599 Ga0068860_100005739
600 Ga0068860_100142958
601 Ga0068862_100032654
602 Ga0068862_100077866
603 Ga0068862_100097820
604 Ga0068862_100735568
605 Ga0081455_10006927
606 Ga0081455_10047171
607 Ga0081455_10074531
608 Ga0081455_10095006
609 Ga0081455_10196777
610 Ga0081540_1000948
611 Ga0081540_1004138
612 Ga0081540_1007687
613 Ga0081540_1011103
614 Ga0081539_10041088
615 Ga0081539_10058556
616 Ga0070717_10369754
617 Ga0070717_10452175
618 Ga0075365_10026500
619 Ga0075365_10065951
620 Ga0075365_10081986
621 Ga0075365_10084686
622 Ga0075365_10114669
623 Ga0075365_10235262
624 Ga0075365_10246610
625 Ga0075368_10008933
626 Ga0075363_100222372
627 Ga0075363_100252451
628 Ga0075364_10014811
629 Ga0075364_10148171
630 Ga0075364_10230809
631 Ga0070712_100571824
632 Ga0075362_10022640
633 Ga0075362_10024000
634 Ga0075367_10024602
635 Ga0075367_10054210
636 Ga0075367_10060320
637 Ga0075367_10120596
638 Ga0075369_10015863
639 Ga0075366_10025213
640 Ga0075366_10056242
641 Ga0075366_10111785
642 Ga0097621_100279291
643 Ga0075370_10016088
644 Ga0075370_10020374
645 Ga0075370_10025265
646 Ga0075370_10064891
647 Ga0075428_100029097
648 Ga0075428_100043811
649 Ga0075428_100212742
650 Ga0075428_100374393
651 Ga0075430_100000029
652 Ga0075430_100182608
653 Ga0075431_100076574
654 Ga0075431_100663398
655 Ga0075434_100028848
656 Ga0075434_100067089
657 Ga0068865_100092194
658 Ga0068865_100161804
659 Ga0068865_100336959
660 Ga0097620_100025816
661 Ga0099795_10002392
662 Ga0105240_10026366
663 Ga0111539_10014716
664 Ga0111539_10059271
665 Ga0111539_10062705
666 Ga0105247_10002289
667 Ga0105247_10217944
668 Ga0114129_10061881
669 Ga0114129_10497506
670 Ga0105243_10119090
671 Ga0105243_10123249
672 Ga0105242_10035577
673 Ga0105242_10340958
674 Ga0105248_10008256
675 Ga0105248_10047206
676 Ga0105237_10028364
677 Ga0105238_10059815
678 Ga0105238_10389873
679 Ga0105249_10023502
680 Ga0105239_10038265
681 Ga0105239_10092060
682 Ga0105239_10281671
683 Ga0105239_10342245
684 Ga0105246_10008246
685 Ga0105246_10079883
686 Ga0157374_10009863
687 Ga0157374_10022161
688 Ga0157378_10103968
689 Ga0157378_10310803
690 Ga0163162_10025642
691 Ga0163162_10898853
692 Ga0163162_10989302
693 Ga0157375_10170651
694 Ga0157375_10191329
695 Ga0163163_10010304
696 Ga0157380_10050916
697 Ga0157380_10091362
698 Ga0157380_10169690
699 Ga0157380_10584265
700 Ga0157377_10039947
701 Ga0157377_10250873
702 Ga0157377_10401372
703 Ga0157379_10021965
704 Ga0157379_10382098
705 Ga0157376_10020304
706 Ga0157376_10056408
707 Ga0157376_10417780
708 Ga0163161_10012863
709 Ga0163161_10072574
710 Ga0209130_1000080
711 Ga0209025_1008635
712 Ga0209025_1026310
713 Ga0209758_1000079
714 Ga0209758_1020356
715 Ga0207426_1005450
716 Ga0207642_10036726
717 Ga0207688_10004896
718 Ga0207688_10083379
719 Ga0207647_10060065
720 Ga0207647_10220571
721 Ga0207643_10005792
722 Ga0207643_10043264
723 Ga0207654_10008079
724 Ga0207671_10008698
725 Ga0207663_10048761
726 Ga0207662_10025959
727 Ga0207662_10257500
728 Ga0207657_10023462
729 Ga0207649_10026772
730 Ga0207646_10260387
731 Ga0207650_10071709
732 Ga0207687_10048589
733 Ga0207700_10108215
734 Ga0207644_10183998
735 Ga0207690_10032618
736 Ga0207690_10123393
737 Ga0207706_10005745
738 Ga0207706_10126249
739 Ga0207706_10313158
740 Ga0207686_10054687
741 Ga0207709_10028958
742 Ga0207669_10366355
743 Ga0207704_10009866
744 Ga0207691_10021052
745 Ga0207691_10162152
746 Ga0207711_10037937
747 Ga0207689_10015653
748 Ga0207689_10019078
749 Ga0207689_10037773
750 Ga0207661_10061197
751 Ga0207679_10087539
752 Ga0207679_10167256
753 Ga0207667_10546669
754 Ga0207712_10348306
755 Ga0207668_10010335
756 Ga0207668_10016019
757 Ga0207668_10160443
758 Ga0207668_10179949
759 Ga0207668_10199840
760 Ga0207668_10312437
761 Ga0207668_10352492
762 Ga0207658_10010664
763 Ga0207658_10112593
764 Ga0207677_10003374
765 Ga0207677_10045320
766 Ga0207677_10266322
767 Ga0207703_10008823
768 Ga0207703_10140722
769 Ga0207703_10309350
770 Ga0207639_10287102
771 Ga0207678_10014733
772 Ga0207678_10019040
773 Ga0207678_10060018
774 Ga0207678_10244329
775 Ga0207708_10007808
776 Ga0207708_10120515
777 Ga0207702_10143155
778 Ga0207641_10174070
779 Ga0207648_10004699
780 Ga0207674_10409210
781 Ga0207675_100013083
782 Ga0207675_100024197
783 Ga0207675_100035075
784 Ga0207675_100106233
785 Ga0207675_100283329
786 Ga0207683_10013941
787 Ga0207683_10023737
788 Ga0207683_10029530
789 Ga0207683_10044623
790 Ga0207683_10347747
791 Ga0207683_10692559
792 Ga0268266_10000638
793 Ga0268266_10000807
794 Ga0268266_10006312
795 Ga0268266_10044321
796 Ga0268266_10132501
797 Ga0268266_10165483
798 Ga0268265_10011307
799 Ga0268265_10189065
800 Ga0268265_10677758
801 Ga0268264_10346792
802 Ga0307517_10001037
803 Ga0307517_10109412
804 Ga0307517_10169309
805 Ga0307515_10038410
806 Ga0265340_10016232
807 Ga0265339_10023413
808 Ga0307513_10124215
809 Ga0307509_10295267
810 Ga0265314_10063589
811 Ga0265342_10001629
812 Ga0307516_10157908
813 Ga0307405_10342202
814 Ga0307407_10198344
815 Ga0307510_10003040
816 Ga0373938_0037568
817 Ga0373934_0056811
818 Ga0373936_0088388
819 Ga0373945_0008684
820 Ga0373943_0035970
821 Ga0373946_0004911
822 Ga0373931_0057678
823 Ga0373931_0227475
824 Ga0373931_0260712
825 Ga0373935_0038259
826 Ga0373927_0005061
827 Ga0373927_0256876
828 Ga0373947_0100615
829 Ga0373947_0164273
830 Ga0373947_0203886
831 Ga0373937_0002219
832 Ga0373925_0003941
833 Ga0373925_0591514
834 Ga0439465_0035381
835 Ga0495617_022865
836 Ga0495603_0046248
837 Ga0495638_0200750
838 Ga0495650_0067358
839 Ga0495639_0134068
840 Ga0495584_0205593
841 Ga0495585_0026904
842 Ga0495585_0206991
843 Ga0495594_0090314
844 Ga0495594_0205500
845 Ga0495607_0147942
846 Ga0495606_0103807
847 Ga0495610_0042191
848 Ga0495610_0105106
849 Ga0495620_0052646
850 Ga0495620_0081369
851 Ga0495631_0146650
852 Ga0495632_0041392
853 Ga0495632_0100691
854 Ga0495632_0149968
855 Ga0495643_0174604
856 Ga0495644_0101382
857 Ga0495644_0110048
858 Ga0495652_0432414
859 Ga0495665_0121780
860 Ga0495640_0071703
861 Ga0495622_0022552
862 Ga0495622_0052900
863 Ga0495622_0066148
864 Ga0495633_0025824
865 Ga0495656_0081888
866 Ga0495656_0116752
867 Ga0495656_0195857
868 Ga0495668_0124622
869 Ga0495634_0087759
870 Ga0495611_0060195
871 Ga0495625_0086319
872 Ga0495625_0110095
873 Ga0495625_0267199
874 Ga0495635_0047860
875 Ga0495661_0191448
876 Ga0495647_0030887
877 Ga0495647_0051382
878 Ga0495658_0010016
879 Ga0495669_0037534
880 Ga0495669_0038387
881 Ga0495613_0057067
882 Ga0495624_0062825
883 Ga0495670_0286369
884 Ga0495649_0058245
885 Ga0495581_0276227
886 Ga0495636_0113306
887 Ga0495672_0177903
888 Ga0495676_0141267
889 Ga0495676_0145962
890 Ga0495683_0047129
891 Ga0495677_0049616
892 Ga0495685_071794
893 Ga0495673_0092044
894 Ga0495686_0141405
895 Ga0495686_0153010
896 Ga0495614_0068765
897 Ga0495614_0152078
898 Ga0496101_0039626
899 Ga0496101_0047905
900 Ga0496101_0073124
901 Ga0496102_0009948
902 Ga0496102_0081213
903 Ga0496102_0082283
904 Ga0496102_0127761
905 Ga0496103_0004098
906 Ga0496104_0050718
907 Ga0496104_0428213
908 Ga0496105_0001515
909 Ga0496105_0004141
910 Ga0496106_0006373
911 Ga0496106_0066405
912 Ga0496107_0033724
913 Ga0496107_0034010
914 Ga0496108_0001028
915 Ga0496108_0009471
916 Ga0496108_0038439
917 Ga0496109_0002430
918 Ga0496109_0093530
919 Ga0496109_0107195
920 Ga0496110_0001894
921 Ga0496110_0040479
922 Ga0496111_0000436
923 Ga0496111_0002610
924 Ga0496111_0115083
925 Ga0496111_0555536
926 Ga0496112_0004518
927 Ga0496113_0001905
928 Ga0496113_0026153
929 Ga0496114_0024989
930 Ga0496114_0369769
931 Ga0496115_0021662
932 Ga0496115_0073654
933 Ga0496115_0157970
934 Ga0496117_0218132
935 Ga0496119_0179135
936 Ga0496121_0000091
937 Ga0496121_0163415
938 Ga0496121_0179499
939 Ga0496124_0014474
940 Ga0496124_0051872
941 Ga0496125_0065286
942 Ga0496126_0014034
943 Ga0496126_0049099
944 Ga0496126_0138091
945 Ga0496126_0177049
946 Ga0501033_0109734
947 Ga0501034_0024555
948 Ga0501034_0124109
949 Ga0501036_0339869
950 Ga0501039_0472257
951 Ga0501047_0016268
952 Ga0501047_0036168
953 Ga0501073_0035365
954 Ga0501073_0124928
955 Ga0501075_0251790
956 Ga0501076_0047592
957 Ga0501076_0111148
958 Ga0501076_0592388
959 Ga0501081_0050060
960 Ga0501083_0024497
961 Ga0501035_0356771
962 nmdc:mga03683_38137_c1
963 nmdc:mga03n38_148136_c1
964 nmdc:mga03n38_158299_c1
965 nmdc:mga03n38_220438_c1
966 nmdc:mga03n38_2665_c1
967 nmdc:mga00v17_11637_c1
968 nmdc:mga00v17_57211_c1
969 nmdc:mga0yw44_13581_c1
970 nmdc:mga0yw44_42397_c1
971 nmdc:mga0yw44_9147_c1
972 nmdc:mga0k408_232635_c1
973 nmdc:mga0k408_393947_c1
974 nmdc:mga06z11_243427_c1
975 nmdc:mga06z11_76491_c1
976 nmdc:mga07m45_5521_c1
977 nmdc:mga07m45_78381_c1
978 nmdc:mga07m45_89122_c1
979 nmdc:mga05p37_127696_c1
980 nmdc:mga05p37_50505_c1
981 nmdc:mga0qj67_51461_c1
982 nmdc:mga06r32_315983_c1
983 nmdc:mga08y16_172280_c1
984 nmdc:mga08y16_48196_c1
985 nmdc:mga08y16_66137_c1
986 nmdc:mga0n895_13911_c1
987 nmdc:mga0n895_282413_c1
988 nmdc:mga0n895_38960_c1
989 nmdc:mga0rr50_20477_c1
990 nmdc:mga08x19_232388_c1
991 nmdc:mga0sz30_44535_c1
992 Ga0495601_0043844
993 Ga0495601_0049720
994 Ga0495655_0025842
995 Ga0495619_0065152
996 Ga0500555_074934
997 Ga0500562_055599
998 Ga0500594_0110783
999 Ga0500595_008592
1000 Ga0500642_0032408
1001 Ga0500642_0223484
1002 Ga0500568_0054879
1003 Ga0500588_0046292
1004 Ga0500590_102551
1005 Ga0500616_0053235
1006 Ga0500627_0147730
1007 Ga0500645_007308
1008 Ga0500645_017374
1009 Ga0501084_0233830
1010 Ga0501082_0023425
1011 Ga0530510_0237246
1012 Ga0530510_0262968
1013 2644746011
1014 2793079001
1015 2844105715
1016 2851246071
1017 2874608935
1018 8006987247

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

76

310

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kd5-assembly1.cif.gz_C substrate binding domain of putative molybdenum abc transporter from clostridium difficile 0.8579 24 262
4kd5-assembly1.cif.gz_C substrate binding domain of putative molybdenum abc transporter from clostridium difficile 0.8404 24 262
8k8k-assembly1.cif.gz_A structure of klebsiella pneumonia moda 0.8235 25 262
8k8k-assembly1.cif.gz_A structure of klebsiella pneumonia moda 0.8136 25 262
3k6v-assembly1.cif.gz_A m. acetivorans molybdate-binding protein (moda) in citrate-bound open form 0.8041 23 262
ID Description Score Start End Superfamily
2h5yB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9555 23 98 3.40.190.10
4rxlA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9313 25 98 3.40.190.10
af_P37329_30_103_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9289 27 89 3.40.190.10
af_P9WGU3_42_110_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9122 27 89 3.40.190.10
af_Q2FVX4_42_108_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9078 25 88 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2G6Y580-F1-model_v4 Molybdenum ABC transporter molybdate-binding protein 0.9856 23 263 GO:0015689
GO:0030973
AF-A0A5E7ZYP0-F1-model_v4 deleted 0.966 24 267
AF-A0A2G6Y580-F1-model_v4 Molybdenum ABC transporter molybdate-binding protein 0.9619 23 263 GO:0015689
GO:0030973
AF-A0A5E7ZYP0-F1-model_v4 deleted 0.9432 24 267
AF-A0A1M5YV20-F1-model_v4 Molybdenum ABC transporter, molybdate-binding protein 0.9171 24 263 GO:0015689
GO:0030973

Map