F456969

General Info

Members Datasets Scaffolds Average Seq Length
509 202 1018 471

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10082237|Ga0111539_100822373
Length 536
Sequence MDRRNIPQPFAVNSLVLQVQAAGLLLTTGAEQSEALAAHGGGAHGRAGVGPRAQQIMQTQPMKTIAVLIGCTLVASLTLIARSDPPTADWPMWGGTADRNMLSSMKGLPTAWDVKTKKNIKWVAELGSQAYGNPVVANGLVFVGTNNESNKDPEVKGDKGILMAFRESDGQFMWQAVHDKLAAGRANDWPFQGICSSPLVENGIVYYVSNRGELMAVDADGFRDKTNDGRVKDEKATKDTDADILWRLDMMDQLGVMQHNMANSSPVMFEDLIYISTSNGQDESHVNVPSPRAPAIIAVNKVTGEMVWEDNSVGEKILHGQWSSPAVGRIGDTVQVVIGQGDGWVRGFEAKSGKKLWEFDLNPKDSVWPKTRNEVISTPVIYENVVYIANGQDPEHGEGVGHLYAIDATKRGDITXXXQIWHYGDIRRSISTGAIYNGILFYSDFSGFLHAVDIKTGKPFWKHDMFAAIWGSPIVIDGKVYLGDEDGDVAVMAADKTMKMIAENNMGSSVYSTAVPANGAIFLVNRNQLFAIAEGK

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
146 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
147 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
161 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
162 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
196 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.18
Nodule 0
Rhizoplane 1.57
Rhizosphere 96.86
Stem 0
Stem Tuber 0
Unclassified 16.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10082237 3300009094 Bacteria 3787
2 JGI24746J21847_1000964 3300001977 Bacteria 4510
3 JGI24751J29686_10007096 3300002459 Bacteria 2290
4 JGI25406J46586_10000674 3300003203 Bacteria 15880
5 JGI25406J46586_10015181 3300003203 Unclassified 3253
6 Ga0058860_11896194 3300004801 Bacteria 1934
7 Ga0065712_10000594 3300005290 Bacteria 9725
8 Ga0065712_10013380 3300005290 Bacteria 3091
9 Ga0065712_10118112 3300005290 Unclassified 1711
10 Ga0065712_10121199 3300005290 Bacteria 1668
11 Ga0065715_10002067 3300005293 Bacteria 6150
12 Ga0065715_10009082 3300005293 Bacteria 2630
13 Ga0065715_10090496 3300005293 Bacteria 6908
14 Ga0065715_10096968 3300005293 Bacteria 3786
15 Ga0065707_10006208 3300005295 Bacteria 3037
16 Ga0065707_10098391 3300005295 Bacteria 3089
17 Ga0070676_10023500 3300005328 Bacteria 3465
18 Ga0070683_100000168 3300005329 Bacteria 42900
19 Ga0070690_100003917 3300005330 Bacteria 8209
20 Ga0070690_100023437 3300005330 Bacteria 3785
21 Ga0070690_100089802 3300005330 Unclassified 2022
22 Ga0070690_100109031 3300005330 Bacteria 1845
23 Ga0070670_100015223 3300005331 Bacteria 6601
24 Ga0070670_100216943 3300005331 Unclassified 1664
25 Ga0070677_10001599 3300005333 Bacteria 7170
26 Ga0070677_10011404 3300005333 Unclassified 3065
27 Ga0068869_100006550 3300005334 Bacteria 7384
28 Ga0068869_100015633 3300005334 Bacteria 5097
29 Ga0068869_100136610 3300005334 Unclassified 1889
30 Ga0070666_10009740 3300005335 Bacteria 6003
31 Ga0070680_100036203 3300005336 Bacteria 3987
32 Ga0068868_100038788 3300005338 Bacteria 3698
33 Ga0068868_100056882 3300005338 Bacteria 3089
34 Ga0070689_100027604 3300005340 Bacteria 4280
35 Ga0070687_100001746 3300005343 Bacteria 7829
36 Ga0070661_100011906 3300005344 Bacteria 6073
37 Ga0070661_100039887 3300005344 Bacteria 3423
38 Ga0070668_100012453 3300005347 Bacteria 6335
39 Ga0070668_100024802 3300005347 Unclassified 4545
40 Ga0070669_100003794 3300005353 Bacteria 10916
41 Ga0070669_100004193 3300005353 Bacteria 10433
42 Ga0070669_100163073 3300005353 Unclassified 1733
43 Ga0070675_100005573 3300005354 Bacteria 9638
44 Ga0070675_100012676 3300005354 Bacteria 6612
45 Ga0070675_100015201 3300005354 Bacteria 6079
46 Ga0070675_100022443 3300005354 Bacteria 5044
47 Ga0070675_100046214 3300005354 Unclassified 3565
48 Ga0070675_100122247 3300005354 Bacteria 2212
49 Ga0070671_100007773 3300005355 Bacteria 8564
50 Ga0070671_100098022 3300005355 Bacteria 2459
51 Ga0070674_100030629 3300005356 Unclassified 3558
52 Ga0070673_100001480 3300005364 Bacteria 13756
53 Ga0070673_100009290 3300005364 Bacteria 6596
54 Ga0070673_100022098 3300005364 Unclassified 4626
55 Ga0070688_100002133 3300005365 Bacteria 9972
56 Ga0070688_100011641 3300005365 Bacteria 4895
57 Ga0070688_100026548 3300005365 Bacteria 3442
58 Ga0070688_100094920 3300005365 Bacteria 1956
59 Ga0070688_100124158 3300005365 Bacteria 1733
60 Ga0070659_100007034 3300005366 Bacteria 8148
61 Ga0070659_100022334 3300005366 Bacteria 4829
62 Ga0070667_100009104 3300005367 Bacteria 8216
63 Ga0070667_100048697 3300005367 Bacteria 3567
64 Ga0070700_100000106 3300005441 Bacteria 53028
65 Ga0070700_100010484 3300005441 Bacteria 5120
66 Ga0070694_100002772 3300005444 Bacteria 10397
67 Ga0070694_100052632 3300005444 Unclassified 2753
68 Ga0070678_100031114 3300005456 Unclassified 3677
69 Ga0070678_100034308 3300005456 Unclassified 3532
70 Ga0070678_100043713 3300005456 Bacteria 3194
71 Ga0070678_100050744 3300005456 Unclassified 3003
72 Ga0070662_100015490 3300005457 Bacteria 5109
73 Ga0070681_10001349 3300005458 Bacteria 21451
74 Ga0070681_10086870 3300005458 Bacteria 3081
75 Ga0070685_10009005 3300005466 Bacteria 5148
76 Ga0070707_100000506 3300005468 Bacteria 38731
77 Ga0070698_100001679 3300005471 Bacteria 24687
78 Ga0070698_100032281 3300005471 Bacteria 5425
79 Ga0070699_100000616 3300005518 Bacteria 33616
80 Ga0070699_100006383 3300005518 Bacteria 10277
81 Ga0070699_100121250 3300005518 Bacteria 2299
82 Ga0070699_100160272 3300005518 Unclassified 1991
83 Ga0070684_100000873 3300005535 Bacteria 21270
84 Ga0070697_100000185 3300005536 Bacteria 51425
85 Ga0070672_100008761 3300005543 Bacteria 6943
86 Ga0070672_100033937 3300005543 Unclassified 3868
87 Ga0070672_100085211 3300005543 Bacteria 2539
88 Ga0070672_100215027 3300005543 Bacteria 1611
89 Ga0070686_100039124 3300005544 Unclassified 2953
90 Ga0070695_100018362 3300005545 Bacteria 4248
91 Ga0070695_100083481 3300005545 Unclassified 2117
92 Ga0070693_100020947 3300005547 Unclassified 3456
93 Ga0070704_100039468 3300005549 Bacteria 3242
94 Ga0070704_100065364 3300005549 Bacteria 2618
95 Ga0070664_100000519 3300005564 Bacteria 29237
96 Ga0070664_100001224 3300005564 Bacteria 20509
97 Ga0070664_100001446 3300005564 Bacteria 18950
98 Ga0070664_100071268 3300005564 Bacteria 2978
99 Ga0068857_100007795 3300005577 Bacteria 9229
100 Ga0068857_100012374 3300005577 Bacteria 7427
101 Ga0068854_100048098 3300005578 Unclassified 3041
102 Ga0070702_100034279 3300005615 Unclassified 2797
103 Ga0068852_100011114 3300005616 Bacteria 6761
104 Ga0068859_100003263 3300005617 Bacteria 16514
105 Ga0068859_100003677 3300005617 Bacteria 15622
106 Ga0068859_100005029 3300005617 Bacteria 13417
107 Ga0068859_100016611 3300005617 Bacteria 7389
108 Ga0068859_100075013 3300005617 Bacteria 3422
109 Ga0068864_100012203 3300005618 Bacteria 7101
110 Ga0068864_100013633 3300005618 Bacteria 6739
111 Ga0068864_100028577 3300005618 Bacteria 4716
112 Ga0068864_100075328 3300005618 Unclassified 2946
113 Ga0068861_100021495 3300005719 Bacteria 4637
114 Ga0068870_10000247 3300005840 Bacteria 20110
115 Ga0068863_100001047 3300005841 Bacteria 27679
116 Ga0068863_100005672 3300005841 Bacteria 12262
117 Ga0068863_100053732 3300005841 Bacteria 3819
118 Ga0068858_100010936 3300005842 Bacteria 8577
119 Ga0068858_100011678 3300005842 Bacteria 8282
120 Ga0068858_100061783 3300005842 Bacteria 3464
121 Ga0068860_100003082 3300005843 Bacteria 17240
122 Ga0068860_100019300 3300005843 Bacteria 6616
123 Ga0068860_100035543 3300005843 Bacteria 4779
124 Ga0068860_100072275 3300005843 Unclassified 3278
125 Ga0068862_100001160 3300005844 Bacteria 24859
126 Ga0068862_100041896 3300005844 Bacteria 3898
127 Ga0081539_10000043 3300005985 Bacteria 288108
128 Ga0081539_10002299 3300005985 Bacteria 27621
129 Ga0081539_10003220 3300005985 Bacteria 20601
130 Ga0075368_10039418 3300006042 Bacteria 1852
131 Ga0075366_10033237 3300006195 Bacteria 3038
132 Ga0097621_100009091 3300006237 Bacteria 7201
133 Ga0075428_100000361 3300006844 Bacteria 45078
134 Ga0075428_100000386 3300006844 Bacteria 43670
135 Ga0075428_100004937 3300006844 Bacteria 14811
136 Ga0075428_100007471 3300006844 Bacteria 12108
137 Ga0075428_100018312 3300006844 Bacteria 7743
138 Ga0075428_100137980 3300006844 Bacteria 2651
139 Ga0075428_100170701 3300006844 Bacteria 2358
140 Ga0075428_100255245 3300006844 Bacteria 1889
141 Ga0075430_100005306 3300006846 Bacteria 10876
142 Ga0075430_100009125 3300006846 Bacteria 8376
143 Ga0075430_100012811 3300006846 Bacteria 7145
144 Ga0075430_100041575 3300006846 Bacteria 3889
145 Ga0075431_100010650 3300006847 Bacteria 9243
146 Ga0075431_100045539 3300006847 Unclassified 4522
147 Ga0075431_100055945 3300006847 Bacteria 4070
148 Ga0075431_100073178 3300006847 Bacteria 3536
149 Ga0075431_100089757 3300006847 Bacteria 3172
150 Ga0075431_100139673 3300006847 Bacteria 2497
151 Ga0075433_10000042 3300006852 Bacteria 51751
152 Ga0075433_10000046 3300006852 Bacteria 50848
153 Ga0075433_10000874 3300006852 Bacteria 21140
154 Ga0075433_10019139 3300006852 Bacteria 5697
155 Ga0075433_10035784 3300006852 Bacteria 4273
156 Ga0075433_10048036 3300006852 Bacteria 3711
157 Ga0075433_10065268 3300006852 Bacteria 3193
158 Ga0075434_100001063 3300006871 Bacteria 22430
159 Ga0075434_100002987 3300006871 Bacteria 15051
160 Ga0075434_100007204 3300006871 Bacteria 10287
161 Ga0075434_100008301 3300006871 Bacteria 9647
162 Ga0075429_100050774 3300006880 Bacteria 3608
163 Ga0075429_100069628 3300006880 Unclassified 3063
164 Ga0075429_100076035 3300006880 Bacteria 2924
165 Ga0075429_100109243 3300006880 Unclassified 2417
166 Ga0068865_100020347 3300006881 Unclassified 4302
167 Ga0075436_100021695 3300006914 Unclassified 4407
168 Ga0075436_100025904 3300006914 Bacteria 4037
169 Ga0097620_100003263 3300006931 Bacteria 16514
170 Ga0097620_100003677 3300006931 Bacteria 15622
171 Ga0097620_100005029 3300006931 Bacteria 13417
172 Ga0097620_100016610 3300006931 Bacteria 7389
173 Ga0097620_100075003 3300006931 Bacteria 3422
174 Ga0075435_100002965 3300007076 Bacteria 11407
175 Ga0075435_100034718 3300007076 Bacteria 3998
176 Ga0075435_100040534 3300007076 Bacteria 3719
177 Ga0075435_100079850 3300007076 Bacteria 2685
178 Ga0111539_10000005 3300009094 Bacteria 467342
179 Ga0111539_10000381 3300009094 Bacteria 54711
180 Ga0111539_10003931 3300009094 Bacteria 19533
181 Ga0111539_10005088 3300009094 Bacteria 17071
182 Ga0111539_10005617 3300009094 Bacteria 16223
183 Ga0111539_10009173 3300009094 Bacteria 12512
184 Ga0111539_10013198 3300009094 Bacteria 10330
185 Ga0111539_10020177 3300009094 Bacteria 8213
186 Ga0111539_10030916 3300009094 Bacteria 6507
187 Ga0111539_10034967 3300009094 Bacteria 6086
188 Ga0111539_10128390 3300009094 Bacteria 2970
189 Ga0114129_10001500 3300009147 Bacteria 31579
190 Ga0114129_10001940 3300009147 Bacteria 28311
191 Ga0114129_10002123 3300009147 Bacteria 27329
192 Ga0114129_10019271 3300009147 Bacteria 9718
193 Ga0114129_10031833 3300009147 Bacteria 7456
194 Ga0114129_10032245 3300009147 Bacteria 7404
195 Ga0114129_10040154 3300009147 Bacteria 6597
196 Ga0114129_10046200 3300009147 Bacteria 6121
197 Ga0114129_10050393 3300009147 Bacteria 5848
198 Ga0114129_10051053 3300009147 Bacteria 5807
199 Ga0114129_10171850 3300009147 Bacteria 2954
200 Ga0114129_10178764 3300009147 Unclassified 2889
201 Ga0105241_10119210 3300009174 Bacteria 2123
202 Ga0105242_10159281 3300009176 Bacteria 1974
203 Ga0105248_10044993 3300009177 Unclassified 4949
204 Ga0105248_10066938 3300009177 Unclassified 4033
205 Ga0105248_10138460 3300009177 Bacteria 2746
206 Ga0105248_10211476 3300009177 Bacteria 2185
207 Ga0105249_10000201 3300009553 Bacteria 68199
208 Ga0105249_10001833 3300009553 Bacteria 18474
209 Ga0105249_10049050 3300009553 Unclassified 3850
210 Ga0105249_10049592 3300009553 Bacteria 3828
211 Ga0105249_10084303 3300009553 Bacteria 2959
212 Ga0105249_10122231 3300009553 Bacteria 2476
213 Ga0105239_10173881 3300010375 Unclassified 2409
214 Ga0157374_10066651 3300013296 Bacteria 3383
215 Ga0157374_10166391 3300013296 Bacteria 2149
216 Ga0157378_10084600 3300013297 Unclassified 2872
217 Ga0157378_10262750 3300013297 Unclassified 1657
218 Ga0163162_10000128 3300013306 Bacteria 68199
219 Ga0163162_10002417 3300013306 Bacteria 17578
220 Ga0163162_10019930 3300013306 Bacteria 6587
221 Ga0163162_10020070 3300013306 Bacteria 6563
222 Ga0163162_10030954 3300013306 Bacteria 5305
223 Ga0157375_10055083 3300013308 Bacteria 3919
224 Ga0157375_10067809 3300013308 Unclassified 3566
225 Ga0163163_10001093 3300014325 Bacteria 23016
226 Ga0163163_10014578 3300014325 Bacteria 7231
227 Ga0163163_10049087 3300014325 Bacteria 4152
228 Ga0163163_10078211 3300014325 Bacteria 3304
229 Ga0163163_10235449 3300014325 Unclassified 1880
230 Ga0157380_10004758 3300014326 Bacteria 9450
231 Ga0157380_10012644 3300014326 Bacteria 6126
232 Ga0157380_10033088 3300014326 Unclassified 3980
233 Ga0157380_10034414 3300014326 Bacteria 3908
234 Ga0157380_10053761 3300014326 Bacteria 3194
235 Ga0157377_10005488 3300014745 Bacteria 5963
236 Ga0157379_10014728 3300014968 Bacteria 6860
237 Ga0163161_10028208 3300017792 Bacteria 3985
238 Ga0163161_10034502 3300017792 Bacteria 3620
239 Ga0207697_10000703 3300025315 Bacteria 19045
240 Ga0207697_10002066 3300025315 Bacteria 10575
241 Ga0207697_10006066 3300025315 Bacteria 5524
242 Ga0207697_10013271 3300025315 Bacteria 3439
243 Ga0207682_10001329 3300025893 Bacteria 11368
244 Ga0207682_10013256 3300025893 Unclassified 3213
245 Ga0207688_10002969 3300025901 Bacteria 9236
246 Ga0207688_10017111 3300025901 Unclassified 3939
247 Ga0207680_10121717 3300025903 Bacteria 1707
248 Ga0207645_10021081 3300025907 Bacteria 4254
249 Ga0207643_10000174 3300025908 Bacteria 44035
250 Ga0207643_10002461 3300025908 Bacteria 9994
251 Ga0207684_10000170 3300025910 Bacteria 107800
252 Ga0207684_10012356 3300025910 Bacteria 7431
253 Ga0207662_10007155 3300025918 Bacteria 6069
254 Ga0207662_10060595 3300025918 Unclassified 2270
255 Ga0207649_10025704 3300025920 Bacteria 3435
256 Ga0207649_10043718 3300025920 Bacteria 2741
257 Ga0207646_10040040 3300025922 Bacteria 4216
258 Ga0207681_10025757 3300025923 Bacteria 3786
259 Ga0207650_10029969 3300025925 Bacteria 3915
260 Ga0207659_10000954 3300025926 Bacteria 17286
261 Ga0207659_10051218 3300025926 Bacteria 2935
262 Ga0207659_10075862 3300025926 Unclassified 2469
263 Ga0207644_10014763 3300025931 Bacteria 5233
264 Ga0207690_10041464 3300025932 Bacteria 3017
265 Ga0207706_10008995 3300025933 Bacteria 9192
266 Ga0207686_10000034 3300025934 Bacteria 134765
267 Ga0207686_10094841 3300025934 Bacteria 1979
268 Ga0207709_10000029 3300025935 Bacteria 333327
269 Ga0207670_10008962 3300025936 Bacteria 5679
270 Ga0207670_10078597 3300025936 Unclassified 2301
271 Ga0207669_10022476 3300025937 Unclassified 3351
272 Ga0207669_10029949 3300025937 Unclassified 3018
273 Ga0207669_10056419 3300025937 Bacteria 2385
274 Ga0207665_10132814 3300025939 Bacteria 1769
275 Ga0207691_10004634 3300025940 Bacteria 13309
276 Ga0207691_10029919 3300025940 Bacteria 5093
277 Ga0207691_10051228 3300025940 Bacteria 3775
278 Ga0207691_10058183 3300025940 Bacteria 3516
279 Ga0207691_10067264 3300025940 Unclassified 3240
280 Ga0207691_10069808 3300025940 Unclassified 3173
281 Ga0207711_10010986 3300025941 Bacteria 7522
282 Ga0207711_10020159 3300025941 Bacteria 5556
283 Ga0207711_10034444 3300025941 Bacteria 4289
284 Ga0207711_10071243 3300025941 Bacteria 3016
285 Ga0207711_10115427 3300025941 Unclassified 2393
286 Ga0207689_10002012 3300025942 Bacteria 19207
287 Ga0207689_10002932 3300025942 Bacteria 15748
288 Ga0207689_10018884 3300025942 Bacteria 5814
289 Ga0207689_10076835 3300025942 Unclassified 2745
290 Ga0207679_10014981 3300025945 Bacteria 5110
291 Ga0207679_10039406 3300025945 Bacteria 3373
292 Ga0207651_10040594 3300025960 Bacteria 3080
293 Ga0207712_10000330 3300025961 Bacteria 43368
294 Ga0207712_10005801 3300025961 Bacteria 7782
295 Ga0207712_10017306 3300025961 Bacteria 4680
296 Ga0207712_10021617 3300025961 Bacteria 4225
297 Ga0207712_10088612 3300025961 Bacteria 2273
298 Ga0207712_10193433 3300025961 Bacteria 1607
299 Ga0207668_10005768 3300025972 Bacteria 7298
300 Ga0207658_10079856 3300025986 Bacteria 2504
301 Ga0207658_10112490 3300025986 Unclassified 2155
302 Ga0207703_10024025 3300026035 Bacteria 4795
303 Ga0207703_10075449 3300026035 Bacteria 2795
304 Ga0207703_10093681 3300026035 Bacteria 2530
305 Ga0207708_10000043 3300026075 Bacteria 121725
306 Ga0207708_10041004 3300026075 Bacteria 3531
307 Ga0207641_10100303 3300026088 Bacteria 2550
308 Ga0207676_10007660 3300026095 Bacteria 7666
309 Ga0207676_10014873 3300026095 Bacteria 5606
310 Ga0207676_10058808 3300026095 Bacteria 3033
311 Ga0207676_10068039 3300026095 Bacteria 2847
312 Ga0207674_10102715 3300026116 Unclassified 2838
313 Ga0207674_10120835 3300026116 Bacteria 2587
314 Ga0207675_100025991 3300026118 Bacteria 5449
315 Ga0207675_100029552 3300026118 Bacteria 5106
316 Ga0207675_100156798 3300026118 Bacteria 2170
317 Ga0207683_10008552 3300026121 Bacteria 8761
318 Ga0207683_10029027 3300026121 Unclassified 4788
319 Ga0207683_10060443 3300026121 Bacteria 3331
320 Ga0209971_1010714 3300027682 Bacteria 2171
321 Ga0207428_10000039 3300027907 Bacteria 213218
322 Ga0207428_10001087 3300027907 Bacteria 29632
323 Ga0207428_10001827 3300027907 Bacteria 21780
324 Ga0207428_10001923 3300027907 Bacteria 21027
325 Ga0207428_10005452 3300027907 Bacteria 11863
326 Ga0207428_10009778 3300027907 Bacteria 8592
327 Ga0207428_10014032 3300027907 Bacteria 6978
328 Ga0207428_10021264 3300027907 Bacteria 5495
329 Ga0207428_10042333 3300027907 Bacteria 3683
330 Ga0207428_10091475 3300027907 Bacteria 2362
331 Ga0268266_10250269 3300028379 Bacteria 1639
332 Ga0268265_10006291 3300028380 Bacteria 8041
333 Ga0268265_10013314 3300028380 Bacteria 5588
334 Ga0268265_10029789 3300028380 Bacteria 3924
335 Ga0268264_10191174 3300028381 Unclassified 1866
336 Ga0265323_10000918 3300028653 Bacteria 15548
337 Ga0265338_10067692 3300028800 Bacteria 3082
338 Ga0265316_10021615 3300031344 Bacteria 5444
339 Ga0265316_10065873 3300031344 Unclassified 2804
340 Ga0307513_10003183 3300031456 Bacteria 22411
341 Ga0307408_100003951 3300031548 Bacteria 10098
342 Ga0307408_100081003 3300031548 Unclassified 2426
343 Ga0307408_100104814 3300031548 Bacteria 2161
344 Ga0316576_10061927 3300031727 Bacteria 2743
345 Ga0307405_10024862 3300031731 Unclassified 3430
346 Ga0307410_10131438 3300031852 Bacteria 1839
347 Ga0307407_10008683 3300031903 Bacteria 4679
348 Ga0307407_10033907 3300031903 Bacteria 2790
349 Ga0307412_10007883 3300031911 Bacteria 6065
350 Ga0307412_10030741 3300031911 Unclassified 3385
351 Ga0307412_10035842 3300031911 Unclassified 3173
352 Ga0307412_10086581 3300031911 Bacteria 2181
353 Ga0307416_100013054 3300032002 Bacteria 5630
354 Ga0307416_100032906 3300032002 Unclassified 3924
355 Ga0307416_100035796 3300032002 Unclassified 3797
356 Ga0307416_100111113 3300032002 Unclassified 2415
357 Ga0307411_10013167 3300032005 Bacteria 4551
358 Ga0307411_10048366 3300032005 Unclassified 2756
359 Ga0307415_100012401 3300032126 Unclassified 4926
360 Ga0307415_100079493 3300032126 Unclassified 2336
361 Ga0307415_100172143 3300032126 Bacteria 1690
362 Ga0373952_0009454 3300035092 Bacteria 1867
363 Ga0373939_0020963 3300035114 Bacteria 1783
364 Ga0373927_0001438 3300035695 Bacteria 17966
365 Ga0242420_003600 3300038996 Bacteria 2296
366 Ga0439431_0016844 3300041997 Unclassified 1714
367 Ga0439457_017870 3300042014 Bacteria 1574
368 Ga0451576_0088269 3300045051 Bacteria 3225
369 Ga0451576_0296366 3300045051 Bacteria 1691
370 Ga0495603_0049813 3300046455 Bacteria 2493
371 Ga0495638_0002862 3300046460 Bacteria 13817
372 Ga0495621_0016369 3300046539 Bacteria 2379
373 Ga0495658_0043378 3300046683 Unclassified 2516
374 Ga0495674_0069158 3300047319 Bacteria 3054
375 Ga0495672_0084215 3300047320 Bacteria 1764
376 Ga0496104_0001345 3300048907 Bacteria 21274
377 Ga0496105_0054322 3300048908 Bacteria 3307
378 Ga0496108_0002967 3300048911 Bacteria 13630
379 Ga0496108_0161066 3300048911 Bacteria 1939
380 Ga0496109_0000442 3300048912 Bacteria 35846
381 Ga0496109_0002728 3300048912 Bacteria 14804
382 Ga0496109_0075555 3300048912 Bacteria 3098
383 Ga0496112_0006502 3300048915 Bacteria 10274
384 Ga0501296_000436 3300049519 Bacteria 4093
385 Ga0501298_002792 3300049521 Unclassified 2672
386 Ga0501299_004128 3300049522 Unclassified 2151
387 Ga0501036_0094706 3300049572 Bacteria 2524
388 Ga0501038_0002299 3300049574 Bacteria 17768
389 Ga0501038_0110160 3300049574 Bacteria 2282
390 Ga0501039_0049295 3300049575 Unclassified 3255
391 Ga0501039_0173630 3300049575 Bacteria 1695
392 Ga0501040_0043342 3300049576 Bacteria 3067
393 Ga0501041_0019553 3300049577 Bacteria 4045
394 Ga0501041_0039154 3300049577 Unclassified 2877
395 Ga0501042_0026054 3300049578 Bacteria 4110
396 Ga0501042_0048787 3300049578 Bacteria 3019
397 Ga0501042_0169585 3300049578 Bacteria 1575
398 Ga0501046_0046828 3300049580 Unclassified 3431
399 Ga0501048_0091241 3300049582 Bacteria 2149
400 Ga0501071_0003369 3300049587 Bacteria 9984
401 Ga0501071_0004685 3300049587 Bacteria 8692
402 Ga0501071_0168041 3300049587 Bacteria 1642
403 Ga0501072_0039972 3300049588 Bacteria 3683
404 Ga0501072_0053308 3300049588 Unclassified 3185
405 Ga0501072_0058178 3300049588 Bacteria 3047
406 Ga0501072_0064911 3300049588 Bacteria 2879
407 Ga0501072_0222243 3300049588 Bacteria 1505
408 Ga0501075_0009428 3300049591 Bacteria 6827
409 Ga0501075_0118609 3300049591 Bacteria 2012
410 Ga0501075_0119196 3300049591 Bacteria 2007
411 Ga0501076_0013090 3300049592 Bacteria 6211
412 Ga0501076_0037363 3300049592 Bacteria 3808
413 Ga0501076_0073574 3300049592 Bacteria 2736
414 Ga0501076_0151328 3300049592 Bacteria 1888
415 Ga0501077_0050120 3300049593 Bacteria 2654
416 Ga0501235_003742 3300049669 Unclassified 3284
417 Ga0501079_0013308 3300049741 Bacteria 6272
418 Ga0501079_0030550 3300049741 Bacteria 4140
419 Ga0501079_0146179 3300049741 Unclassified 1842
420 Ga0501079_0188407 3300049741 Bacteria 1610
421 Ga0501080_0111292 3300049742 Bacteria 2538
422 Ga0501081_0165622 3300049743 Bacteria 1594
423 Ga0501083_0078757 3300049744 Bacteria 2186
424 Ga0501283_000509 3300049779 Bacteria 5100
425 Ga0501045_0003414 3300049824 Bacteria 10869
426 Ga0501045_0008944 3300049824 Bacteria 6994
427 Ga0501045_0028087 3300049824 Bacteria 4057
428 Ga0501045_0111448 3300049824 Bacteria 2029
429 nmdc:mga0k408_4305_c1 3300050493 Bacteria 7559
430 nmdc:mga04h51_29944_c1 3300050495 Bacteria 1710
431 nmdc:mga05p37_12795_c1 3300050507 Bacteria 10029
432 nmdc:mga05p37_128278_c1 3300050507 Unclassified 3114
433 nmdc:mga05p37_191_c1 3300050507 Bacteria 61045
434 nmdc:mga05p37_23756_c1 3300050507 Bacteria 7444
435 nmdc:mga05p37_279911_c1 3300050507 Bacteria 1990
436 nmdc:mga05p37_335021_c1 3300050507 Bacteria 1786
437 nmdc:mga05p37_35026_c2 3300050507 Bacteria 5739
438 nmdc:mga05p37_36080_c1 3300050507 Bacteria 6066
439 nmdc:mga05p37_38285_c1 3300050507 Bacteria 5882
440 nmdc:mga05p37_382_c1 3300050507 Bacteria 47795
441 nmdc:mga05p37_45389_c1 3300050507 Bacteria 5404
442 nmdc:mga05p37_46443_c1 3300050507 Bacteria 5340
443 nmdc:mga05p37_797_c1 3300050507 Bacteria 35111
444 nmdc:mga09592_110670_c1 3300050508 Bacteria 2356
445 nmdc:mga09592_11375_c1 3300050508 Bacteria 7236
446 nmdc:mga09592_148368_c1 3300050508 Unclassified 2023
447 nmdc:mga09592_174852_c1 3300050508 Bacteria 1857
448 nmdc:mga09592_29093_c1 3300050508 Unclassified 4595
449 nmdc:mga09592_66128_c1 3300050508 Unclassified 3064
450 nmdc:mga09592_78188_c1 3300050508 Bacteria 2815
451 nmdc:mga0qj67_1675_c1 3300050509 Bacteria 15613
452 nmdc:mga0qj67_3284_c1 3300050509 Bacteria 11647
453 nmdc:mga0qj67_89252_c1 3300050509 Bacteria 2476
454 nmdc:mga06r32_102841_c2 3300050510 Bacteria 2514
455 nmdc:mga06r32_14463_c1 3300050510 Bacteria 7163
456 nmdc:mga06r32_16047_c1 3300050510 Bacteria 6819
457 nmdc:mga06r32_23168_c1 3300050510 Bacteria 5744
458 nmdc:mga06r32_38635_c1 3300050510 Bacteria 4524
459 nmdc:mga06r32_60774_c1 3300050510 Unclassified 3637
460 nmdc:mga08y16_12825_c1 3300050511 Bacteria 8812
461 nmdc:mga08y16_133_c1 3300050511 Bacteria 64498
462 nmdc:mga08y16_18103_c1 3300050511 Bacteria 7420
463 nmdc:mga08y16_20006_c1 3300050511 Bacteria 7061
464 nmdc:mga08y16_22010_c1 3300050511 Bacteria 6730
465 nmdc:mga08y16_22085_c1 3300050511 Bacteria 6719
466 nmdc:mga08y16_27446_c1 3300050511 Bacteria 6001
467 nmdc:mga08y16_3028_c1 3300050511 Bacteria 17353
468 nmdc:mga08y16_3039_c1 3300050511 Bacteria 17327
469 nmdc:mga08y16_80063_c1 3300050511 Bacteria 3406
470 nmdc:mga08y16_92862_c1 3300050511 Unclassified 3145
471 nmdc:mga0n895_1194_c1 3300050512 Bacteria 19124
472 nmdc:mga0n895_265535_c1 3300050512 Bacteria 1741
473 nmdc:mga0n895_4542_c1 3300050512 Bacteria 11422
474 nmdc:mga0n895_6644_c1 3300050512 Bacteria 9851
475 nmdc:mga0rr50_136354_c1 3300050513 Bacteria 1970
476 nmdc:mga0rr50_170318_c1 3300050513 Bacteria 1774
477 nmdc:mga0rr50_23853_c1 3300050513 Bacteria 4229
478 nmdc:mga0rr50_63097_c1 3300050513 Bacteria 2797
479 nmdc:mga0rr50_8236_c1 3300050513 Bacteria 5373
480 nmdc:mga0rr50_90211_c1 3300050513 Unclassified 2385
481 nmdc:mga08x19_29702_c1 3300050514 Unclassified 3430
482 nmdc:mga08x19_53724_c1 3300050514 Bacteria 2592
483 nmdc:mga08x19_83116_c1 3300050514 Bacteria 2105
484 nmdc:mga0a205_122043_c2 3300050515 Bacteria 1836
485 nmdc:mga0a205_151311_c1 3300050515 Bacteria 2220
486 nmdc:mga0a205_15178_c1 3300050515 Bacteria 7196
487 nmdc:mga0a205_21076_c1 3300050515 Bacteria 6163
488 nmdc:mga0a205_297403_c1 3300050515 Bacteria 1488
489 nmdc:mga0a205_43339_c1 3300050515 Bacteria 4339
490 nmdc:mga0a205_4340_c1 3300050515 Bacteria 12714
491 nmdc:mga0a205_53712_c1 3300050515 Bacteria 3889
492 nmdc:mga0a205_9158_c1 3300050515 Bacteria 9037
493 nmdc:mga0a205_951_c1 3300050515 Bacteria 23906
494 Ga0495601_0128635 3300053077 Bacteria 1649
495 Ga0500641_0003490 3300053096 Bacteria 5560
496 Ga0500568_0005865 3300053139 Bacteria 6257
497 Ga0501084_0039245 3300054114 Bacteria 3960
498 Ga0590071_000064 3300059421 Bacteria 28214
499 Ga0590071_000165 3300059421 Bacteria 19051
500 Ga0590075_000117 3300059424 Bacteria 20529
501 Ga0590075_000164 3300059424 Bacteria 18191
502 Ga0590077_000117 3300059426 Bacteria 21293
503 Ga0590077_000120 3300059426 Bacteria 21251
504 Ga0501082_0062014 3300060353 Bacteria 3218
505 Ga0501082_0122504 3300060353 Bacteria 2255
506 Ga0501082_0155460 3300060353 Bacteria 1987
507 Ga0530510_0008270 3300061734 Bacteria 7254
508 Ga0530510_0016303 3300061734 Bacteria 5256
509 Ga0530510_0138977 3300061734 Bacteria 1789
510 Ga0111539_10082237
511 JGI24746J21847_1000964
512 JGI24751J29686_10007096
513 JGI25406J46586_10000674
514 JGI25406J46586_10015181
515 Ga0058860_11896194
516 Ga0065712_10000594
517 Ga0065712_10013380
518 Ga0065712_10118112
519 Ga0065712_10121199
520 Ga0065715_10002067
521 Ga0065715_10009082
522 Ga0065715_10090496
523 Ga0065715_10096968
524 Ga0065707_10006208
525 Ga0065707_10098391
526 Ga0070676_10023500
527 Ga0070683_100000168
528 Ga0070690_100003917
529 Ga0070690_100023437
530 Ga0070690_100089802
531 Ga0070690_100109031
532 Ga0070670_100015223
533 Ga0070670_100216943
534 Ga0070677_10001599
535 Ga0070677_10011404
536 Ga0068869_100006550
537 Ga0068869_100015633
538 Ga0068869_100136610
539 Ga0070666_10009740
540 Ga0070680_100036203
541 Ga0068868_100038788
542 Ga0068868_100056882
543 Ga0070689_100027604
544 Ga0070687_100001746
545 Ga0070661_100011906
546 Ga0070661_100039887
547 Ga0070668_100012453
548 Ga0070668_100024802
549 Ga0070669_100003794
550 Ga0070669_100004193
551 Ga0070669_100163073
552 Ga0070675_100005573
553 Ga0070675_100012676
554 Ga0070675_100015201
555 Ga0070675_100022443
556 Ga0070675_100046214
557 Ga0070675_100122247
558 Ga0070671_100007773
559 Ga0070671_100098022
560 Ga0070674_100030629
561 Ga0070673_100001480
562 Ga0070673_100009290
563 Ga0070673_100022098
564 Ga0070688_100002133
565 Ga0070688_100011641
566 Ga0070688_100026548
567 Ga0070688_100094920
568 Ga0070688_100124158
569 Ga0070659_100007034
570 Ga0070659_100022334
571 Ga0070667_100009104
572 Ga0070667_100048697
573 Ga0070700_100000106
574 Ga0070700_100010484
575 Ga0070694_100002772
576 Ga0070694_100052632
577 Ga0070678_100031114
578 Ga0070678_100034308
579 Ga0070678_100043713
580 Ga0070678_100050744
581 Ga0070662_100015490
582 Ga0070681_10001349
583 Ga0070681_10086870
584 Ga0070685_10009005
585 Ga0070707_100000506
586 Ga0070698_100001679
587 Ga0070698_100032281
588 Ga0070699_100000616
589 Ga0070699_100006383
590 Ga0070699_100121250
591 Ga0070699_100160272
592 Ga0070684_100000873
593 Ga0070697_100000185
594 Ga0070672_100008761
595 Ga0070672_100033937
596 Ga0070672_100085211
597 Ga0070672_100215027
598 Ga0070686_100039124
599 Ga0070695_100018362
600 Ga0070695_100083481
601 Ga0070693_100020947
602 Ga0070704_100039468
603 Ga0070704_100065364
604 Ga0070664_100000519
605 Ga0070664_100001224
606 Ga0070664_100001446
607 Ga0070664_100071268
608 Ga0068857_100007795
609 Ga0068857_100012374
610 Ga0068854_100048098
611 Ga0070702_100034279
612 Ga0068852_100011114
613 Ga0068859_100003263
614 Ga0068859_100003677
615 Ga0068859_100005029
616 Ga0068859_100016611
617 Ga0068859_100075013
618 Ga0068864_100012203
619 Ga0068864_100013633
620 Ga0068864_100028577
621 Ga0068864_100075328
622 Ga0068861_100021495
623 Ga0068870_10000247
624 Ga0068863_100001047
625 Ga0068863_100005672
626 Ga0068863_100053732
627 Ga0068858_100010936
628 Ga0068858_100011678
629 Ga0068858_100061783
630 Ga0068860_100003082
631 Ga0068860_100019300
632 Ga0068860_100035543
633 Ga0068860_100072275
634 Ga0068862_100001160
635 Ga0068862_100041896
636 Ga0081539_10000043
637 Ga0081539_10002299
638 Ga0081539_10003220
639 Ga0075368_10039418
640 Ga0075366_10033237
641 Ga0097621_100009091
642 Ga0075428_100000361
643 Ga0075428_100000386
644 Ga0075428_100004937
645 Ga0075428_100007471
646 Ga0075428_100018312
647 Ga0075428_100137980
648 Ga0075428_100170701
649 Ga0075428_100255245
650 Ga0075430_100005306
651 Ga0075430_100009125
652 Ga0075430_100012811
653 Ga0075430_100041575
654 Ga0075431_100010650
655 Ga0075431_100045539
656 Ga0075431_100055945
657 Ga0075431_100073178
658 Ga0075431_100089757
659 Ga0075431_100139673
660 Ga0075433_10000042
661 Ga0075433_10000046
662 Ga0075433_10000874
663 Ga0075433_10019139
664 Ga0075433_10035784
665 Ga0075433_10048036
666 Ga0075433_10065268
667 Ga0075434_100001063
668 Ga0075434_100002987
669 Ga0075434_100007204
670 Ga0075434_100008301
671 Ga0075429_100050774
672 Ga0075429_100069628
673 Ga0075429_100076035
674 Ga0075429_100109243
675 Ga0068865_100020347
676 Ga0075436_100021695
677 Ga0075436_100025904
678 Ga0097620_100003263
679 Ga0097620_100003677
680 Ga0097620_100005029
681 Ga0097620_100016610
682 Ga0097620_100075003
683 Ga0075435_100002965
684 Ga0075435_100034718
685 Ga0075435_100040534
686 Ga0075435_100079850
687 Ga0111539_10000005
688 Ga0111539_10000381
689 Ga0111539_10003931
690 Ga0111539_10005088
691 Ga0111539_10005617
692 Ga0111539_10009173
693 Ga0111539_10013198
694 Ga0111539_10020177
695 Ga0111539_10030916
696 Ga0111539_10034967
697 Ga0111539_10128390
698 Ga0114129_10001500
699 Ga0114129_10001940
700 Ga0114129_10002123
701 Ga0114129_10019271
702 Ga0114129_10031833
703 Ga0114129_10032245
704 Ga0114129_10040154
705 Ga0114129_10046200
706 Ga0114129_10050393
707 Ga0114129_10051053
708 Ga0114129_10171850
709 Ga0114129_10178764
710 Ga0105241_10119210
711 Ga0105242_10159281
712 Ga0105248_10044993
713 Ga0105248_10066938
714 Ga0105248_10138460
715 Ga0105248_10211476
716 Ga0105249_10000201
717 Ga0105249_10001833
718 Ga0105249_10049050
719 Ga0105249_10049592
720 Ga0105249_10084303
721 Ga0105249_10122231
722 Ga0105239_10173881
723 Ga0157374_10066651
724 Ga0157374_10166391
725 Ga0157378_10084600
726 Ga0157378_10262750
727 Ga0163162_10000128
728 Ga0163162_10002417
729 Ga0163162_10019930
730 Ga0163162_10020070
731 Ga0163162_10030954
732 Ga0157375_10055083
733 Ga0157375_10067809
734 Ga0163163_10001093
735 Ga0163163_10014578
736 Ga0163163_10049087
737 Ga0163163_10078211
738 Ga0163163_10235449
739 Ga0157380_10004758
740 Ga0157380_10012644
741 Ga0157380_10033088
742 Ga0157380_10034414
743 Ga0157380_10053761
744 Ga0157377_10005488
745 Ga0157379_10014728
746 Ga0163161_10028208
747 Ga0163161_10034502
748 Ga0207697_10000703
749 Ga0207697_10002066
750 Ga0207697_10006066
751 Ga0207697_10013271
752 Ga0207682_10001329
753 Ga0207682_10013256
754 Ga0207688_10002969
755 Ga0207688_10017111
756 Ga0207680_10121717
757 Ga0207645_10021081
758 Ga0207643_10000174
759 Ga0207643_10002461
760 Ga0207684_10000170
761 Ga0207684_10012356
762 Ga0207662_10007155
763 Ga0207662_10060595
764 Ga0207649_10025704
765 Ga0207649_10043718
766 Ga0207646_10040040
767 Ga0207681_10025757
768 Ga0207650_10029969
769 Ga0207659_10000954
770 Ga0207659_10051218
771 Ga0207659_10075862
772 Ga0207644_10014763
773 Ga0207690_10041464
774 Ga0207706_10008995
775 Ga0207686_10000034
776 Ga0207686_10094841
777 Ga0207709_10000029
778 Ga0207670_10008962
779 Ga0207670_10078597
780 Ga0207669_10022476
781 Ga0207669_10029949
782 Ga0207669_10056419
783 Ga0207665_10132814
784 Ga0207691_10004634
785 Ga0207691_10029919
786 Ga0207691_10051228
787 Ga0207691_10058183
788 Ga0207691_10067264
789 Ga0207691_10069808
790 Ga0207711_10010986
791 Ga0207711_10020159
792 Ga0207711_10034444
793 Ga0207711_10071243
794 Ga0207711_10115427
795 Ga0207689_10002012
796 Ga0207689_10002932
797 Ga0207689_10018884
798 Ga0207689_10076835
799 Ga0207679_10014981
800 Ga0207679_10039406
801 Ga0207651_10040594
802 Ga0207712_10000330
803 Ga0207712_10005801
804 Ga0207712_10017306
805 Ga0207712_10021617
806 Ga0207712_10088612
807 Ga0207712_10193433
808 Ga0207668_10005768
809 Ga0207658_10079856
810 Ga0207658_10112490
811 Ga0207703_10024025
812 Ga0207703_10075449
813 Ga0207703_10093681
814 Ga0207708_10000043
815 Ga0207708_10041004
816 Ga0207641_10100303
817 Ga0207676_10007660
818 Ga0207676_10014873
819 Ga0207676_10058808
820 Ga0207676_10068039
821 Ga0207674_10102715
822 Ga0207674_10120835
823 Ga0207675_100025991
824 Ga0207675_100029552
825 Ga0207675_100156798
826 Ga0207683_10008552
827 Ga0207683_10029027
828 Ga0207683_10060443
829 Ga0209971_1010714
830 Ga0207428_10000039
831 Ga0207428_10001087
832 Ga0207428_10001827
833 Ga0207428_10001923
834 Ga0207428_10005452
835 Ga0207428_10009778
836 Ga0207428_10014032
837 Ga0207428_10021264
838 Ga0207428_10042333
839 Ga0207428_10091475
840 Ga0268266_10250269
841 Ga0268265_10006291
842 Ga0268265_10013314
843 Ga0268265_10029789
844 Ga0268264_10191174
845 Ga0265323_10000918
846 Ga0265338_10067692
847 Ga0265316_10021615
848 Ga0265316_10065873
849 Ga0307513_10003183
850 Ga0307408_100003951
851 Ga0307408_100081003
852 Ga0307408_100104814
853 Ga0316576_10061927
854 Ga0307405_10024862
855 Ga0307410_10131438
856 Ga0307407_10008683
857 Ga0307407_10033907
858 Ga0307412_10007883
859 Ga0307412_10030741
860 Ga0307412_10035842
861 Ga0307412_10086581
862 Ga0307416_100013054
863 Ga0307416_100032906
864 Ga0307416_100035796
865 Ga0307416_100111113
866 Ga0307411_10013167
867 Ga0307411_10048366
868 Ga0307415_100012401
869 Ga0307415_100079493
870 Ga0307415_100172143
871 Ga0373952_0009454
872 Ga0373939_0020963
873 Ga0373927_0001438
874 Ga0242420_003600
875 Ga0439431_0016844
876 Ga0439457_017870
877 Ga0451576_0088269
878 Ga0451576_0296366
879 Ga0495603_0049813
880 Ga0495638_0002862
881 Ga0495621_0016369
882 Ga0495658_0043378
883 Ga0495674_0069158
884 Ga0495672_0084215
885 Ga0496104_0001345
886 Ga0496105_0054322
887 Ga0496108_0002967
888 Ga0496108_0161066
889 Ga0496109_0000442
890 Ga0496109_0002728
891 Ga0496109_0075555
892 Ga0496112_0006502
893 Ga0501296_000436
894 Ga0501298_002792
895 Ga0501299_004128
896 Ga0501036_0094706
897 Ga0501038_0002299
898 Ga0501038_0110160
899 Ga0501039_0049295
900 Ga0501039_0173630
901 Ga0501040_0043342
902 Ga0501041_0019553
903 Ga0501041_0039154
904 Ga0501042_0026054
905 Ga0501042_0048787
906 Ga0501042_0169585
907 Ga0501046_0046828
908 Ga0501048_0091241
909 Ga0501071_0003369
910 Ga0501071_0004685
911 Ga0501071_0168041
912 Ga0501072_0039972
913 Ga0501072_0053308
914 Ga0501072_0058178
915 Ga0501072_0064911
916 Ga0501072_0222243
917 Ga0501075_0009428
918 Ga0501075_0118609
919 Ga0501075_0119196
920 Ga0501076_0013090
921 Ga0501076_0037363
922 Ga0501076_0073574
923 Ga0501076_0151328
924 Ga0501077_0050120
925 Ga0501235_003742
926 Ga0501079_0013308
927 Ga0501079_0030550
928 Ga0501079_0146179
929 Ga0501079_0188407
930 Ga0501080_0111292
931 Ga0501081_0165622
932 Ga0501083_0078757
933 Ga0501283_000509
934 Ga0501045_0003414
935 Ga0501045_0008944
936 Ga0501045_0028087
937 Ga0501045_0111448
938 nmdc:mga0k408_4305_c1
939 nmdc:mga04h51_29944_c1
940 nmdc:mga05p37_12795_c1
941 nmdc:mga05p37_128278_c1
942 nmdc:mga05p37_191_c1
943 nmdc:mga05p37_23756_c1
944 nmdc:mga05p37_279911_c1
945 nmdc:mga05p37_335021_c1
946 nmdc:mga05p37_35026_c2
947 nmdc:mga05p37_36080_c1
948 nmdc:mga05p37_38285_c1
949 nmdc:mga05p37_382_c1
950 nmdc:mga05p37_45389_c1
951 nmdc:mga05p37_46443_c1
952 nmdc:mga05p37_797_c1
953 nmdc:mga09592_110670_c1
954 nmdc:mga09592_11375_c1
955 nmdc:mga09592_148368_c1
956 nmdc:mga09592_174852_c1
957 nmdc:mga09592_29093_c1
958 nmdc:mga09592_66128_c1
959 nmdc:mga09592_78188_c1
960 nmdc:mga0qj67_1675_c1
961 nmdc:mga0qj67_3284_c1
962 nmdc:mga0qj67_89252_c1
963 nmdc:mga06r32_102841_c2
964 nmdc:mga06r32_14463_c1
965 nmdc:mga06r32_16047_c1
966 nmdc:mga06r32_23168_c1
967 nmdc:mga06r32_38635_c1
968 nmdc:mga06r32_60774_c1
969 nmdc:mga08y16_12825_c1
970 nmdc:mga08y16_133_c1
971 nmdc:mga08y16_18103_c1
972 nmdc:mga08y16_20006_c1
973 nmdc:mga08y16_22010_c1
974 nmdc:mga08y16_22085_c1
975 nmdc:mga08y16_27446_c1
976 nmdc:mga08y16_3028_c1
977 nmdc:mga08y16_3039_c1
978 nmdc:mga08y16_80063_c1
979 nmdc:mga08y16_92862_c1
980 nmdc:mga0n895_1194_c1
981 nmdc:mga0n895_265535_c1
982 nmdc:mga0n895_4542_c1
983 nmdc:mga0n895_6644_c1
984 nmdc:mga0rr50_136354_c1
985 nmdc:mga0rr50_170318_c1
986 nmdc:mga0rr50_23853_c1
987 nmdc:mga0rr50_63097_c1
988 nmdc:mga0rr50_8236_c1
989 nmdc:mga0rr50_90211_c1
990 nmdc:mga08x19_29702_c1
991 nmdc:mga08x19_53724_c1
992 nmdc:mga08x19_83116_c1
993 nmdc:mga0a205_122043_c2
994 nmdc:mga0a205_151311_c1
995 nmdc:mga0a205_15178_c1
996 nmdc:mga0a205_21076_c1
997 nmdc:mga0a205_297403_c1
998 nmdc:mga0a205_43339_c1
999 nmdc:mga0a205_4340_c1
1000 nmdc:mga0a205_53712_c1
1001 nmdc:mga0a205_9158_c1
1002 nmdc:mga0a205_951_c1
1003 Ga0495601_0128635
1004 Ga0500641_0003490
1005 Ga0500568_0005865
1006 Ga0501084_0039245
1007 Ga0590071_000064
1008 Ga0590071_000165
1009 Ga0590075_000117
1010 Ga0590075_000164
1011 Ga0590077_000117
1012 Ga0590077_000120
1013 Ga0501082_0062014
1014 Ga0501082_0122504
1015 Ga0501082_0155460
1016 Ga0530510_0008270
1017 Ga0530510_0016303
1018 Ga0530510_0138977

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01011

PQQ

PQQ enzyme repeat

335

371

0.93

PF13570

PQQ_3

PQQ-like domain

119

150

0.93

PF13570

PQQ_3

PQQ-like domain

457

496

0.9

PF13360

PQQ_2

PQQ-like domain

400

499

0.79

PF13360

PQQ_2

PQQ-like domain

236

422

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yms-assembly1.cif.gz_A structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.8773 286 420
2yms-assembly1.cif.gz_B structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.8577 340 420
3hxj-assembly2.cif.gz_C crystal structure of pyrrolo-quinoline quinone (pqq_dh) from methanococcus maripaludis, northeast structural genomics consortium target mrr86 0.8167 84 410
8shq-assembly1.cif.gz_N cct g beta 5 complex closed state 12 0.7865 296 421
2yms-assembly1.cif.gz_A structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.7853 286 420
ID Description Score Start End Superfamily
af_Q60282_716_812_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8808 296 416 2.40.128.630
2ymsA00 Mainly Beta;Beta Barrel;Lipocalin; 0.8773 286 420 2.40.128.630
2ymsB00 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8577 340 420 2.40.10.480
af_Q54LB2_620_694_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8532 342 412 2.40.128.630
af_Q60282_716_812_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8481 296 416 2.40.128.630
ID Description Score Start End GO Terms
AF-A0A7C7HJS2-F1-model_v4 Uncharacterized protein 0.9533 53 468
AF-A0A7W0V2X2-F1-model_v4 PQQ-like beta-propeller repeat protein 0.9517 35 409 GO:0016020
AF-A0A7V8XQH1-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.9497 53 468
AF-A0A7X4FDV2-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.9473 63 469
AF-A0A7V9KQH7-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.9471 36 468

Map