F456934

General Info

Members Datasets Scaffolds Average Seq Length
509 186 1018 257

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10057054|Ga0070709_100570542
Length 292
Sequence LEGRRCETEPLSGASRHLLAAEKEKLAQVSMEPCLKQIQPNPASADVETSTLRLPRHVAIVMDGNGRWARQRHRPRSFGHRAGQKSVRAAIEFCLRQGIEALTLFAFSSENWQRPPGEVGALMTLFLKALDREVDELHGHGVCIRFVGELAAFAPALRARMTQAMEQTAGNAKLALNIAVNYGGRWDIANAARLAAQACERGALASDTIDEATLAPYFALADRPPVDLFIRTGGEQRISNFLLWQLAYSEFVFSNVLWPDFDPECLRQAVEEFSRRERRFGKTSAQVAVPGR

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
76 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
185 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
186 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 97.25
Metatranscriptomes 2.16
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 0.79
Rhizosphere 95.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10057054 3300005434 Bacteria 2472
2 JGI24741J21665_1001906 3300001915 Bacteria 5643
3 JGI24741J21665_1001955 3300001915 Bacteria 5557
4 JGI24741J21665_1005057 3300001915 Bacteria 2820
5 JGI24740J21852_10000295 3300001979 Bacteria 21265
6 JGI24740J21852_10000728 3300001979 Bacteria 14334
7 JGI24740J21852_10023630 3300001979 Bacteria 2097
8 JGI24738J21930_10010626 3300002075 Bacteria 2043
9 Ga0070658_10011453 3300005327 Bacteria 7113
10 Ga0070658_10042211 3300005327 Bacteria 3682
11 Ga0070658_10084922 3300005327 Bacteria 2603
12 Ga0070658_10295285 3300005327 Bacteria 1381
13 Ga0070658_10388756 3300005327 Bacteria 1197
14 Ga0070683_100026852 3300005329 Bacteria 5189
15 Ga0070683_100049159 3300005329 Bacteria 3900
16 Ga0070666_10066942 3300005335 Bacteria 2439
17 Ga0070666_10113759 3300005335 Bacteria 1873
18 Ga0070680_100000287 3300005336 Bacteria 33654
19 Ga0070680_100015090 3300005336 Bacteria 6049
20 Ga0070680_100015861 3300005336 Bacteria 5914
21 Ga0070680_100017738 3300005336 Bacteria 5615
22 Ga0070680_100047927 3300005336 Bacteria 3481
23 Ga0070680_100060013 3300005336 Bacteria 3113
24 Ga0070682_100001082 3300005337 Bacteria 15696
25 Ga0068868_100138097 3300005338 Bacteria 1999
26 Ga0068868_100188379 3300005338 Bacteria 1715
27 Ga0070660_100036003 3300005339 Bacteria 3747
28 Ga0070660_100069290 3300005339 Bacteria 2750
29 Ga0070660_100087615 3300005339 Bacteria 2450
30 Ga0070660_100436326 3300005339 Bacteria 1085
31 Ga0070691_10006128 3300005341 Bacteria 5488
32 Ga0070691_10015643 3300005341 Bacteria 3485
33 Ga0070691_10028351 3300005341 Bacteria 2615
34 Ga0070661_100007789 3300005344 Bacteria 7393
35 Ga0070661_100028532 3300005344 Bacteria 4025
36 Ga0070661_100047389 3300005344 Bacteria 3145
37 Ga0070661_100087884 3300005344 Bacteria 2300
38 Ga0070692_10000184 3300005345 Bacteria 16448
39 Ga0070692_10007662 3300005345 Bacteria 4771
40 Ga0070692_10012796 3300005345 Bacteria 3897
41 Ga0070692_10127703 3300005345 Bacteria 1425
42 Ga0070668_100227182 3300005347 Bacteria 1542
43 Ga0070671_100289769 3300005355 Bacteria 1393
44 Ga0070671_100421256 3300005355 Bacteria 1143
45 Ga0070674_100248750 3300005356 Bacteria 1395
46 Ga0070673_100134827 3300005364 Bacteria 2077
47 Ga0070659_100028956 3300005366 Bacteria 4278
48 Ga0070659_100256860 3300005366 Bacteria 1449
49 Ga0070667_100243846 3300005367 Bacteria 1605
50 Ga0070667_100262531 3300005367 Bacteria 1547
51 Ga0070663_100013775 3300005455 Bacteria 5171
52 Ga0070663_100066318 3300005455 Bacteria 2615
53 Ga0070663_100069220 3300005455 Bacteria 2563
54 Ga0070663_100078765 3300005455 Bacteria 2416
55 Ga0070663_100200167 3300005455 Bacteria 1558
56 Ga0070663_100516485 3300005455 Bacteria 994
57 Ga0070681_10000007 3300005458 Bacteria 159821
58 Ga0070681_10000613 3300005458 Bacteria 29320
59 Ga0070681_10013522 3300005458 Bacteria 8115
60 Ga0070681_10017502 3300005458 Bacteria 7163
61 Ga0070681_10106145 3300005458 Bacteria 2750
62 Ga0070681_10108129 3300005458 Bacteria 2721
63 Ga0068867_100092080 3300005459 Bacteria 2302
64 Ga0070706_100146432 3300005467 Bacteria 2205
65 Ga0070679_100000184 3300005530 Bacteria 50485
66 Ga0070679_100000311 3300005530 Bacteria 41294
67 Ga0070679_100000533 3300005530 Bacteria 32374
68 Ga0070679_100074702 3300005530 Bacteria 3380
69 Ga0070684_100016864 3300005535 Bacteria 5982
70 Ga0070684_100024205 3300005535 Bacteria 5090
71 Ga0068853_100013956 3300005539 Bacteria 6570
72 Ga0068853_100143473 3300005539 Bacteria 2145
73 Ga0068853_100315867 3300005539 Bacteria 1447
74 Ga0068853_100325551 3300005539 Bacteria 1425
75 Ga0070696_100007448 3300005546 Bacteria 7320
76 Ga0070696_100024305 3300005546 Bacteria 4118
77 Ga0070696_100028573 3300005546 Bacteria 3806
78 Ga0070696_100076306 3300005546 Bacteria 2366
79 Ga0070693_100121699 3300005547 Bacteria 1619
80 Ga0070665_100000326 3300005548 Bacteria 73416
81 Ga0070665_100049140 3300005548 Bacteria 4232
82 Ga0070665_100149033 3300005548 Bacteria 2342
83 Ga0070665_100273339 3300005548 Bacteria 1691
84 Ga0070665_100563378 3300005548 Bacteria 1152
85 Ga0068855_100003226 3300005563 Bacteria 19961
86 Ga0068855_100140792 3300005563 Bacteria 2750
87 Ga0068855_100198415 3300005563 Bacteria 2260
88 Ga0068855_100357011 3300005563 Bacteria 1609
89 Ga0068855_100439268 3300005563 Bacteria 1425
90 Ga0068855_100481752 3300005563 Bacteria 1350
91 Ga0068855_100733402 3300005563 Bacteria 1055
92 Ga0070664_100014611 3300005564 Bacteria 6408
93 Ga0070664_100131397 3300005564 Bacteria 2199
94 Ga0068857_100026704 3300005577 Bacteria 5089
95 Ga0068857_100096117 3300005577 Bacteria 2655
96 Ga0068857_100110683 3300005577 Bacteria 2468
97 Ga0068857_100196739 3300005577 Bacteria 1837
98 Ga0068854_100017935 3300005578 Bacteria 4744
99 Ga0068854_100092886 3300005578 Bacteria 2248
100 Ga0068854_100129770 3300005578 Bacteria 1923
101 Ga0068856_100037190 3300005614 Bacteria 4775
102 Ga0068856_100083777 3300005614 Bacteria 3167
103 Ga0068856_100109229 3300005614 Bacteria 2762
104 Ga0068856_100196384 3300005614 Bacteria 2032
105 Ga0068852_100029005 3300005616 Bacteria 4539
106 Ga0068852_100035978 3300005616 Bacteria 4138
107 Ga0068852_100045436 3300005616 Bacteria 3735
108 Ga0068852_100062170 3300005616 Bacteria 3247
109 Ga0068852_100119858 3300005616 Bacteria 2406
110 Ga0068859_100161617 3300005617 Bacteria 2319
111 Ga0068864_100028625 3300005618 Bacteria 4712
112 Ga0068851_10001007 3300005834 Bacteria 12219
113 Ga0068851_10005832 3300005834 Bacteria 5610
114 Ga0068851_10140032 3300005834 Bacteria 1315
115 Ga0068870_10161746 3300005840 Bacteria 1328
116 Ga0068863_100027570 3300005841 Bacteria 5419
117 Ga0068858_100006626 3300005842 Bacteria 11268
118 Ga0068860_100006934 3300005843 Bacteria 11354
119 Ga0068860_100029665 3300005843 Bacteria 5262
120 Ga0068862_100144921 3300005844 Bacteria 2110
121 Ga0081540_1002968 3300005983 Bacteria 13595
122 Ga0075365_10000021 3300006038 Bacteria 64483
123 Ga0097621_100086822 3300006237 Bacteria 2612
124 Ga0075370_10086382 3300006353 Bacteria 1807
125 Ga0068871_100238659 3300006358 Bacteria 1580
126 Ga0068865_100046280 3300006881 Bacteria 2985
127 Ga0068865_100148533 3300006881 Bacteria 1775
128 Ga0097620_100161620 3300006931 Bacteria 2319
129 Ga0105240_10030045 3300009093 Bacteria 7068
130 Ga0105240_10084512 3300009093 Bacteria 3891
131 Ga0105240_10087403 3300009093 Bacteria 3818
132 Ga0105240_10104128 3300009093 Bacteria 3446
133 Ga0105240_10197466 3300009093 Bacteria 2360
134 Ga0105245_10564899 3300009098 Bacteria 1161
135 Ga0105241_10001442 3300009174 Bacteria 18219
136 Ga0105241_10002081 3300009174 Bacteria 15108
137 Ga0105241_10008562 3300009174 Bacteria 7520
138 Ga0105241_10534908 3300009174 Bacteria 1050
139 Ga0105248_10142525 3300009177 Bacteria 2703
140 Ga0105237_10002311 3300009545 Bacteria 23700
141 Ga0105237_10101666 3300009545 Bacteria 2866
142 Ga0105237_10177313 3300009545 Bacteria 2131
143 Ga0105237_10444507 3300009545 Bacteria 1302
144 Ga0105238_10003551 3300009551 Bacteria 15548
145 Ga0105238_10005242 3300009551 Bacteria 12814
146 Ga0105238_10008598 3300009551 Bacteria 10215
147 Ga0105238_10016572 3300009551 Bacteria 7461
148 Ga0105238_10126133 3300009551 Bacteria 2538
149 Ga0105249_10011914 3300009553 Bacteria 7646
150 Ga0105239_10018213 3300010375 Bacteria 7764
151 Ga0105239_10019864 3300010375 Bacteria 7415
152 Ga0105239_10030082 3300010375 Bacteria 5971
153 Ga0157373_10014908 3300013100 Bacteria 5692
154 Ga0157373_10049347 3300013100 Bacteria 2999
155 Ga0157371_10004042 3300013102 Bacteria 12973
156 Ga0157371_10028310 3300013102 Bacteria 4058
157 Ga0157371_10030154 3300013102 Bacteria 3914
158 Ga0157371_10153253 3300013102 Bacteria 1644
159 Ga0157370_10001400 3300013104 Bacteria 29908
160 Ga0157370_10040232 3300013104 Bacteria 4513
161 Ga0157370_10077835 3300013104 Bacteria 3123
162 Ga0157370_10124020 3300013104 Bacteria 2412
163 Ga0157370_10566773 3300013104 Bacteria 1041
164 Ga0157369_10000086 3300013105 Bacteria 128515
165 Ga0157369_10001294 3300013105 Bacteria 31084
166 Ga0157369_10011967 3300013105 Bacteria 9856
167 Ga0157369_10022515 3300013105 Bacteria 7029
168 Ga0157369_10029363 3300013105 Bacteria 6076
169 Ga0157369_10042514 3300013105 Bacteria 4957
170 Ga0157369_10160432 3300013105 Bacteria 2374
171 Ga0157374_10032236 3300013296 Bacteria 4769
172 Ga0157374_10094394 3300013296 Bacteria 2859
173 Ga0157378_10000619 3300013297 Bacteria 33473
174 Ga0157378_10082662 3300013297 Bacteria 2904
175 Ga0163162_10000021 3300013306 Bacteria 214873
176 Ga0157372_10002348 3300013307 Bacteria 20470
177 Ga0157372_10004810 3300013307 Bacteria 14353
178 Ga0157372_10013783 3300013307 Bacteria 8639
179 Ga0157372_10032875 3300013307 Bacteria 5692
180 Ga0157372_10050517 3300013307 Bacteria 4625
181 Ga0157372_10051737 3300013307 Bacteria 4572
182 Ga0157372_10069072 3300013307 Bacteria 3974
183 Ga0157372_10132309 3300013307 Bacteria 2871
184 Ga0157372_10308605 3300013307 Bacteria 1841
185 Ga0157372_10599330 3300013307 Bacteria 1284
186 Ga0157375_10644636 3300013308 Bacteria 1216
187 Ga0163163_10004231 3300014325 Bacteria 12233
188 Ga0182008_10000262 3300014497 Bacteria 41194
189 Ga0157379_10010562 3300014968 Bacteria 8051
190 Ga0157376_10001452 3300014969 Bacteria 15614
191 Ga0157376_10025766 3300014969 Bacteria 4636
192 Ga0157376_10102992 3300014969 Bacteria 2498
193 Ga0157376_10227438 3300014969 Bacteria 1731
194 Ga0157376_10354149 3300014969 Bacteria 1406
195 Ga0157376_10619777 3300014969 Bacteria 1079
196 Ga0182006_1001047 3300015261 Bacteria 17867
197 Ga0182007_10018645 3300015262 Bacteria 2510
198 Ga0182005_1000777 3300015265 Bacteria 14507
199 Ga0182005_1002340 3300015265 Bacteria 6844
200 Ga0197907_10066863 3300020069 Bacteria 1805
201 Ga0197907_11283620 3300020069 Bacteria 1213
202 Ga0206356_10374221 3300020070 Bacteria 4806
203 Ga0206356_11811416 3300020070 Bacteria 2845
204 Ga0206352_10796229 3300020078 Bacteria 2375
205 Ga0206354_10157811 3300020081 Bacteria 1881
206 Ga0206354_10571241 3300020081 Bacteria 6374
207 Ga0206354_10759747 3300020081 Bacteria 2020
208 Ga0206353_10447243 3300020082 Bacteria 2023
209 Ga0206353_10732906 3300020082 Bacteria 7015
210 Ga0206353_11439705 3300020082 Bacteria 1988
211 Ga0213875_10000542 3300021388 Bacteria 30939
212 Ga0207656_10001911 3300025321 Bacteria 6931
213 Ga0207656_10008490 3300025321 Bacteria 3783
214 Ga0207656_10018614 3300025321 Bacteria 2737
215 Ga0207656_10020902 3300025321 Bacteria 2607
216 Ga0207680_10000109 3300025903 Bacteria 37453
217 Ga0207680_10152762 3300025903 Bacteria 1540
218 Ga0207647_10000858 3300025904 Bacteria 23572
219 Ga0207647_10001297 3300025904 Bacteria 19234
220 Ga0207647_10004858 3300025904 Bacteria 9939
221 Ga0207647_10048500 3300025904 Bacteria 2637
222 Ga0207643_10157922 3300025908 Bacteria 1363
223 Ga0207705_10001251 3300025909 Bacteria 20431
224 Ga0207705_10001521 3300025909 Bacteria 18403
225 Ga0207705_10001662 3300025909 Bacteria 17678
226 Ga0207705_10001681 3300025909 Bacteria 17606
227 Ga0207705_10014582 3300025909 Bacteria 5655
228 Ga0207705_10037248 3300025909 Bacteria 3480
229 Ga0207705_10054134 3300025909 Bacteria 2892
230 Ga0207705_10090172 3300025909 Bacteria 2244
231 Ga0207654_10000065 3300025911 Bacteria 69237
232 Ga0207654_10013861 3300025911 Bacteria 4154
233 Ga0207654_10016049 3300025911 Bacteria 3895
234 Ga0207654_10029426 3300025911 Bacteria 3007
235 Ga0207654_10040769 3300025911 Bacteria 2618
236 Ga0207707_10000058 3300025912 Bacteria 111904
237 Ga0207707_10000070 3300025912 Bacteria 103288
238 Ga0207707_10000167 3300025912 Bacteria 69037
239 Ga0207707_10000274 3300025912 Bacteria 55548
240 Ga0207707_10000296 3300025912 Bacteria 53027
241 Ga0207707_10001746 3300025912 Bacteria 19970
242 Ga0207707_10014086 3300025912 Bacteria 6971
243 Ga0207707_10104754 3300025912 Bacteria 2472
244 Ga0207695_10000864 3300025913 Bacteria 55428
245 Ga0207695_10003863 3300025913 Bacteria 20735
246 Ga0207695_10004260 3300025913 Bacteria 19645
247 Ga0207695_10007210 3300025913 Bacteria 14213
248 Ga0207695_10024897 3300025913 Bacteria 6718
249 Ga0207695_10025236 3300025913 Bacteria 6659
250 Ga0207695_10048628 3300025913 Bacteria 4478
251 Ga0207671_10002473 3300025914 Bacteria 19740
252 Ga0207671_10006597 3300025914 Bacteria 10302
253 Ga0207671_10020985 3300025914 Bacteria 4965
254 Ga0207671_10036641 3300025914 Bacteria 3638
255 Ga0207671_10141225 3300025914 Bacteria 1855
256 Ga0207660_10000278 3300025917 Bacteria 33836
257 Ga0207660_10001582 3300025917 Bacteria 15270
258 Ga0207660_10005619 3300025917 Bacteria 8143
259 Ga0207660_10021800 3300025917 Bacteria 4311
260 Ga0207660_10023533 3300025917 Bacteria 4161
261 Ga0207660_10024897 3300025917 Bacteria 4056
262 Ga0207660_10034347 3300025917 Bacteria 3514
263 Ga0207660_10099887 3300025917 Bacteria 2166
264 Ga0207657_10000612 3300025919 Bacteria 37848
265 Ga0207657_10025099 3300025919 Bacteria 5504
266 Ga0207657_10029361 3300025919 Bacteria 5006
267 Ga0207657_10029458 3300025919 Bacteria 4997
268 Ga0207657_10051744 3300025919 Bacteria 3569
269 Ga0207657_10052154 3300025919 Bacteria 3552
270 Ga0207649_10001908 3300025920 Bacteria 11900
271 Ga0207649_10003964 3300025920 Bacteria 8071
272 Ga0207649_10006809 3300025920 Bacteria 6209
273 Ga0207649_10008698 3300025920 Bacteria 5542
274 Ga0207649_10038480 3300025920 Bacteria 2896
275 Ga0207652_10000078 3300025921 Bacteria 106265
276 Ga0207652_10000209 3300025921 Bacteria 61861
277 Ga0207652_10000552 3300025921 Bacteria 37934
278 Ga0207652_10001361 3300025921 Bacteria 21745
279 Ga0207652_10001550 3300025921 Bacteria 20252
280 Ga0207652_10001758 3300025921 Bacteria 18921
281 Ga0207652_10054422 3300025921 Bacteria 3440
282 Ga0207694_10006422 3300025924 Bacteria 8959
283 Ga0207694_10013104 3300025924 Bacteria 6243
284 Ga0207694_10075470 3300025924 Bacteria 2639
285 Ga0207694_10092905 3300025924 Bacteria 2382
286 Ga0207694_10194108 3300025924 Bacteria 1650
287 Ga0207650_10005058 3300025925 Bacteria 8997
288 Ga0207650_10565413 3300025925 Bacteria 954
289 Ga0207650_10592007 3300025925 Bacteria 932
290 Ga0207687_10158411 3300025927 Bacteria 1735
291 Ga0207644_10236668 3300025931 Bacteria 1453
292 Ga0207690_10000371 3300025932 Bacteria 29794
293 Ga0207690_10007382 3300025932 Bacteria 6526
294 Ga0207706_10014188 3300025933 Bacteria 7222
295 Ga0207704_10023471 3300025938 Bacteria 3325
296 Ga0207691_10006050 3300025940 Bacteria 11684
297 Ga0207691_10101139 3300025940 Bacteria 2572
298 Ga0207689_10012766 3300025942 Bacteria 7178
299 Ga0207689_10070361 3300025942 Bacteria 2874
300 Ga0207661_10001380 3300025944 Bacteria 16307
301 Ga0207661_10005991 3300025944 Bacteria 8586
302 Ga0207661_10014565 3300025944 Bacteria 5768
303 Ga0207661_10052462 3300025944 Bacteria 3258
304 Ga0207679_10307212 3300025945 Bacteria 1369
305 Ga0207667_10000740 3300025949 Bacteria 42529
306 Ga0207667_10000932 3300025949 Bacteria 37335
307 Ga0207667_10002142 3300025949 Bacteria 24749
308 Ga0207667_10002819 3300025949 Bacteria 21554
309 Ga0207667_10037260 3300025949 Bacteria 5200
310 Ga0207667_10042509 3300025949 Bacteria 4829
311 Ga0207667_10280527 3300025949 Bacteria 1702
312 Ga0207667_10557951 3300025949 Bacteria 1158
313 Ga0207651_10105012 3300025960 Bacteria 2106
314 Ga0207651_10355840 3300025960 Bacteria 1234
315 Ga0207712_10000340 3300025961 Bacteria 42379
316 Ga0207712_10030582 3300025961 Bacteria 3621
317 Ga0207668_10143897 3300025972 Bacteria 1837
318 Ga0207640_10000264 3300025981 Bacteria 35237
319 Ga0207640_10001219 3300025981 Bacteria 14015
320 Ga0207640_10001768 3300025981 Bacteria 11602
321 Ga0207640_10015465 3300025981 Bacteria 4417
322 Ga0207640_10024172 3300025981 Bacteria 3662
323 Ga0207658_10066618 3300025986 Bacteria 2709
324 Ga0207658_10179315 3300025986 Bacteria 1752
325 Ga0207658_10253444 3300025986 Bacteria 1496
326 Ga0207677_10096480 3300026023 Bacteria 2163
327 Ga0207677_10130146 3300026023 Bacteria 1909
328 Ga0207703_10004638 3300026035 Bacteria 11229
329 Ga0207703_10134797 3300026035 Bacteria 2137
330 Ga0207639_10000399 3300026041 Bacteria 29931
331 Ga0207639_10001582 3300026041 Bacteria 15289
332 Ga0207639_10002331 3300026041 Bacteria 12745
333 Ga0207639_10004509 3300026041 Bacteria 9389
334 Ga0207639_10026244 3300026041 Bacteria 4232
335 Ga0207639_10112548 3300026041 Bacteria 2221
336 Ga0207639_10425660 3300026041 Bacteria 1201
337 Ga0207678_10019481 3300026067 Bacteria 5961
338 Ga0207678_10024454 3300026067 Bacteria 5275
339 Ga0207678_10025343 3300026067 Bacteria 5177
340 Ga0207678_10083008 3300026067 Bacteria 2741
341 Ga0207678_10096606 3300026067 Bacteria 2525
342 Ga0207678_10104441 3300026067 Bacteria 2418
343 Ga0207678_10157760 3300026067 Bacteria 1938
344 Ga0207678_10664706 3300026067 Bacteria 916
345 Ga0207702_10002775 3300026078 Bacteria 16405
346 Ga0207702_10010206 3300026078 Bacteria 7862
347 Ga0207702_10262946 3300026078 Bacteria 1625
348 Ga0207702_10382153 3300026078 Bacteria 1354
349 Ga0207702_10694811 3300026078 Bacteria 1002
350 Ga0207648_10129238 3300026089 Bacteria 2223
351 Ga0207676_10057651 3300026095 Bacteria 3060
352 Ga0207676_10175849 3300026095 Bacteria 1869
353 Ga0207674_10000973 3300026116 Bacteria 37480
354 Ga0207674_10002862 3300026116 Bacteria 21434
355 Ga0207674_10057744 3300026116 Bacteria 3934
356 Ga0207674_10061173 3300026116 Bacteria 3805
357 Ga0207674_10248902 3300026116 Bacteria 1724
358 Ga0207674_10434335 3300026116 Bacteria 1269
359 Ga0207698_10001013 3300026142 Bacteria 16369
360 Ga0207698_10001297 3300026142 Bacteria 14570
361 Ga0207698_10001673 3300026142 Bacteria 12935
362 Ga0207698_10059215 3300026142 Bacteria 2972
363 Ga0207698_10167973 3300026142 Bacteria 1928
364 Ga0207698_10184105 3300026142 Bacteria 1853
365 Ga0207698_10191991 3300026142 Bacteria 1820
366 Ga0207698_10759274 3300026142 Bacteria 969
367 Ga0268266_10000013 3300028379 Bacteria 649715
368 Ga0268266_10138378 3300028379 Bacteria 2183
369 Ga0268264_10003604 3300028381 Bacteria 13337
370 Ga0268264_10030849 3300028381 Bacteria 4394
371 Ga0307508_10039008 3300031616 Bacteria 4268
372 Ga0307516_10141923 3300031730 Bacteria 2170
373 Ga0307412_10005781 3300031911 Bacteria 6954
374 Ga0307412_10151903 3300031911 Bacteria 1710
375 Ga0395899_0013560 3300037312 Bacteria 6230
376 Ga0395900_0007509 3300037418 Bacteria 11265
377 Ga0395900_0010725 3300037418 Bacteria 9372
378 Ga0395900_0536879 3300037418 Bacteria 1116
379 Ga0395898_0102926 3300037466 Bacteria 2740
380 Ga0395898_0120555 3300037466 Bacteria 2513
381 Ga0436364_1187307 3300037853 Bacteria 22707
382 Ga0395901_0016767 3300038443 Bacteria 7464
383 Ga0439436_0000022 3300041404 Bacteria 60408
384 Ga0451853_0534717 3300041512 Bacteria 1629
385 Ga0451577_0001910 3300042876 Bacteria 26415
386 Ga0451577_0005601 3300042876 Bacteria 12775
387 Ga0451577_0097035 3300042876 Bacteria 2632
388 Ga0451577_0344819 3300042876 Bacteria 1351
389 Ga0453683_0044651 3300044673 Bacteria 2780
390 Ga0453684_0000229 3300044712 Bacteria 241494
391 Ga0453684_0004942 3300044712 Bacteria 27181
392 Ga0453684_0010417 3300044712 Bacteria 15906
393 Ga0453684_0011788 3300044712 Bacteria 14570
394 Ga0453684_0014884 3300044712 Bacteria 12373
395 Ga0453684_0480596 3300044712 Bacteria 1378
396 Ga0466970_0216088 3300044765 Bacteria 1069
397 Ga0451576_0000451 3300045051 Bacteria 93335
398 Ga0451576_0102523 3300045051 Bacteria 2977
399 Ga0495638_0000007 3300046460 Bacteria 602783
400 Ga0495580_0440052 3300046472 Bacteria 875
401 Ga0495606_0041938 3300046507 Bacteria 3065
402 Ga0495610_0000341 3300046512 Bacteria 49154
403 Ga0495645_0451066 3300046543 Bacteria 811
404 Ga0495625_0204885 3300046660 Bacteria 1300
405 Ga0495670_0011482 3300046691 Bacteria 4357
406 Ga0496104_0000016 3300048907 Bacteria 335025
407 Ga0496105_0000035 3300048908 Bacteria 123037
408 Ga0496114_0120787 3300048917 Bacteria 2253
409 Ga0496115_0000746 3300048918 Bacteria 23938
410 Ga0496116_0030788 3300048919 Bacteria 3851
411 Ga0496118_0129518 3300048921 Bacteria 1624
412 Ga0496119_0065405 3300048922 Bacteria 2154
413 Ga0496120_0200649 3300048923 Bacteria 966
414 Ga0496125_0211255 3300048928 Bacteria 1260
415 Ga0496126_0000033 3300048929 Bacteria 368851
416 Ga0496126_0301856 3300048929 Bacteria 1321
417 Ga0501031_0181116 3300049568 Bacteria 1376
418 Ga0501032_0116024 3300049569 Bacteria 1771
419 Ga0501034_0006178 3300049571 Bacteria 12914
420 Ga0501034_0327994 3300049571 Bacteria 1462
421 Ga0501034_0487272 3300049571 Bacteria 1148
422 Ga0501034_0653181 3300049571 Bacteria 953
423 Ga0501036_0121669 3300049572 Bacteria 2204
424 Ga0501036_0129120 3300049572 Bacteria 2134
425 Ga0501036_0405680 3300049572 Bacteria 1137
426 Ga0501037_0138081 3300049573 Bacteria 1745
427 Ga0501037_0272434 3300049573 Bacteria 1181
428 Ga0501037_0337040 3300049573 Bacteria 1042
429 Ga0501038_0010027 3300049574 Bacteria 8677
430 Ga0501039_0510214 3300049575 Bacteria 944
431 Ga0501043_0084851 3300049579 Bacteria 2489
432 Ga0501043_0115077 3300049579 Bacteria 2111
433 Ga0501043_0397549 3300049579 Bacteria 1042
434 Ga0501046_0007603 3300049580 Bacteria 9507
435 Ga0501046_0033164 3300049580 Bacteria 4175
436 Ga0501047_0000349 3300049581 Bacteria 52184
437 Ga0501047_0000442 3300049581 Bacteria 45876
438 Ga0501047_0010758 3300049581 Bacteria 8650
439 Ga0501047_0011035 3300049581 Bacteria 8549
440 Ga0501047_0236328 3300049581 Bacteria 1679
441 Ga0501047_0314796 3300049581 Bacteria 1405
442 Ga0501067_0000269 3300049583 Bacteria 28395
443 Ga0501068_0009983 3300049584 Bacteria 5324
444 Ga0501068_0039107 3300049584 Bacteria 2844
445 Ga0501069_0002152 3300049585 Bacteria 9916
446 Ga0501069_0002562 3300049585 Bacteria 9280
447 Ga0501069_0022100 3300049585 Bacteria 3457
448 Ga0501069_0039876 3300049585 Bacteria 2595
449 Ga0501069_0177994 3300049585 Bacteria 1229
450 Ga0501070_0001603 3300049586 Bacteria 20075
451 Ga0501070_0002554 3300049586 Bacteria 15940
452 Ga0501070_0006863 3300049586 Bacteria 9688
453 Ga0501070_0008525 3300049586 Bacteria 8666
454 Ga0501070_0008703 3300049586 Bacteria 8581
455 Ga0501070_0016621 3300049586 Bacteria 6181
456 Ga0501070_0025817 3300049586 Bacteria 4928
457 Ga0501070_0035738 3300049586 Bacteria 4149
458 Ga0501070_0039522 3300049586 Bacteria 3935
459 Ga0501070_0198383 3300049586 Bacteria 1648
460 Ga0501071_0004059 3300049587 Bacteria 9252
461 Ga0501072_0000955 3300049588 Bacteria 21306
462 Ga0501073_0000424 3300049589 Bacteria 28912
463 Ga0501073_0008259 3300049589 Bacteria 7721
464 Ga0501073_0031213 3300049589 Bacteria 3802
465 Ga0501073_0036445 3300049589 Bacteria 3495
466 Ga0501073_0057716 3300049589 Bacteria 2713
467 Ga0501073_0085252 3300049589 Bacteria 2198
468 Ga0501073_0121341 3300049589 Bacteria 1811
469 Ga0501074_0008658 3300049590 Bacteria 7370
470 Ga0501074_0010754 3300049590 Bacteria 6648
471 Ga0501074_0022348 3300049590 Bacteria 4594
472 Ga0501074_0092896 3300049590 Bacteria 2160
473 Ga0501074_0149595 3300049590 Bacteria 1669
474 Ga0501074_0330940 3300049590 Bacteria 1081
475 Ga0501077_0001230 3300049593 Bacteria 15458
476 Ga0501077_0437299 3300049593 Bacteria 837
477 Ga0501079_0019061 3300049741 Bacteria 5240
478 Ga0501079_0080108 3300049741 Bacteria 2525
479 Ga0501079_0496690 3300049741 Bacteria 959
480 Ga0501080_0000828 3300049742 Bacteria 25266
481 Ga0501080_0002423 3300049742 Bacteria 16279
482 Ga0501080_0004456 3300049742 Bacteria 12463
483 Ga0501080_0027187 3300049742 Bacteria 5320
484 Ga0501080_0034157 3300049742 Bacteria 4746
485 Ga0501080_0047857 3300049742 Bacteria 3981
486 Ga0501080_0129961 3300049742 Bacteria 2331
487 Ga0501083_0003137 3300049744 Bacteria 11496
488 Ga0501035_0063315 3300049822 Bacteria 3290
489 Ga0501035_0089508 3300049822 Bacteria 2711
490 Ga0501035_0610916 3300049822 Bacteria 888
491 Ga0501044_0069319 3300049823 Bacteria 3590
492 Ga0501044_0131069 3300049823 Bacteria 2501
493 Ga0501044_0145696 3300049823 Bacteria 2354
494 Ga0501044_0158915 3300049823 Bacteria 2238
495 Ga0501044_0170762 3300049823 Bacteria 2146
496 Ga0501044_0530928 3300049823 Bacteria 1075
497 nmdc:mga0yw44_13_c1 3300050492 Bacteria 120183
498 nmdc:mga07m45_44240_c1 3300050496 Bacteria 2498
499 Ga0500568_0001038 3300053139 Bacteria 18974
500 Ga0501084_0055020 3300054114 Bacteria 3329
501 Ga0501084_0064768 3300054114 Bacteria 3058
502 Ga0501084_0189300 3300054114 Bacteria 1736
503 Ga0501084_0514946 3300054114 Bacteria 1011
504 Ga0501082_0000356 3300060353 Bacteria 40443
505 Ga0501082_0069998 3300060353 Bacteria 3021
506 Ga0501082_0445869 3300060353 Bacteria 1131
507 2644537018 2643221697 Bacteria 3575694
508 2842920178 2842918807 Bacteria 4289178
509 2984594283 2984592036 Bacteria 3670284
510 Ga0070709_10057054
511 JGI24741J21665_1001906
512 JGI24741J21665_1001955
513 JGI24741J21665_1005057
514 JGI24740J21852_10000295
515 JGI24740J21852_10000728
516 JGI24740J21852_10023630
517 JGI24738J21930_10010626
518 Ga0070658_10011453
519 Ga0070658_10042211
520 Ga0070658_10084922
521 Ga0070658_10295285
522 Ga0070658_10388756
523 Ga0070683_100026852
524 Ga0070683_100049159
525 Ga0070666_10066942
526 Ga0070666_10113759
527 Ga0070680_100000287
528 Ga0070680_100015090
529 Ga0070680_100015861
530 Ga0070680_100017738
531 Ga0070680_100047927
532 Ga0070680_100060013
533 Ga0070682_100001082
534 Ga0068868_100138097
535 Ga0068868_100188379
536 Ga0070660_100036003
537 Ga0070660_100069290
538 Ga0070660_100087615
539 Ga0070660_100436326
540 Ga0070691_10006128
541 Ga0070691_10015643
542 Ga0070691_10028351
543 Ga0070661_100007789
544 Ga0070661_100028532
545 Ga0070661_100047389
546 Ga0070661_100087884
547 Ga0070692_10000184
548 Ga0070692_10007662
549 Ga0070692_10012796
550 Ga0070692_10127703
551 Ga0070668_100227182
552 Ga0070671_100289769
553 Ga0070671_100421256
554 Ga0070674_100248750
555 Ga0070673_100134827
556 Ga0070659_100028956
557 Ga0070659_100256860
558 Ga0070667_100243846
559 Ga0070667_100262531
560 Ga0070663_100013775
561 Ga0070663_100066318
562 Ga0070663_100069220
563 Ga0070663_100078765
564 Ga0070663_100200167
565 Ga0070663_100516485
566 Ga0070681_10000007
567 Ga0070681_10000613
568 Ga0070681_10013522
569 Ga0070681_10017502
570 Ga0070681_10106145
571 Ga0070681_10108129
572 Ga0068867_100092080
573 Ga0070706_100146432
574 Ga0070679_100000184
575 Ga0070679_100000311
576 Ga0070679_100000533
577 Ga0070679_100074702
578 Ga0070684_100016864
579 Ga0070684_100024205
580 Ga0068853_100013956
581 Ga0068853_100143473
582 Ga0068853_100315867
583 Ga0068853_100325551
584 Ga0070696_100007448
585 Ga0070696_100024305
586 Ga0070696_100028573
587 Ga0070696_100076306
588 Ga0070693_100121699
589 Ga0070665_100000326
590 Ga0070665_100049140
591 Ga0070665_100149033
592 Ga0070665_100273339
593 Ga0070665_100563378
594 Ga0068855_100003226
595 Ga0068855_100140792
596 Ga0068855_100198415
597 Ga0068855_100357011
598 Ga0068855_100439268
599 Ga0068855_100481752
600 Ga0068855_100733402
601 Ga0070664_100014611
602 Ga0070664_100131397
603 Ga0068857_100026704
604 Ga0068857_100096117
605 Ga0068857_100110683
606 Ga0068857_100196739
607 Ga0068854_100017935
608 Ga0068854_100092886
609 Ga0068854_100129770
610 Ga0068856_100037190
611 Ga0068856_100083777
612 Ga0068856_100109229
613 Ga0068856_100196384
614 Ga0068852_100029005
615 Ga0068852_100035978
616 Ga0068852_100045436
617 Ga0068852_100062170
618 Ga0068852_100119858
619 Ga0068859_100161617
620 Ga0068864_100028625
621 Ga0068851_10001007
622 Ga0068851_10005832
623 Ga0068851_10140032
624 Ga0068870_10161746
625 Ga0068863_100027570
626 Ga0068858_100006626
627 Ga0068860_100006934
628 Ga0068860_100029665
629 Ga0068862_100144921
630 Ga0081540_1002968
631 Ga0075365_10000021
632 Ga0097621_100086822
633 Ga0075370_10086382
634 Ga0068871_100238659
635 Ga0068865_100046280
636 Ga0068865_100148533
637 Ga0097620_100161620
638 Ga0105240_10030045
639 Ga0105240_10084512
640 Ga0105240_10087403
641 Ga0105240_10104128
642 Ga0105240_10197466
643 Ga0105245_10564899
644 Ga0105241_10001442
645 Ga0105241_10002081
646 Ga0105241_10008562
647 Ga0105241_10534908
648 Ga0105248_10142525
649 Ga0105237_10002311
650 Ga0105237_10101666
651 Ga0105237_10177313
652 Ga0105237_10444507
653 Ga0105238_10003551
654 Ga0105238_10005242
655 Ga0105238_10008598
656 Ga0105238_10016572
657 Ga0105238_10126133
658 Ga0105249_10011914
659 Ga0105239_10018213
660 Ga0105239_10019864
661 Ga0105239_10030082
662 Ga0157373_10014908
663 Ga0157373_10049347
664 Ga0157371_10004042
665 Ga0157371_10028310
666 Ga0157371_10030154
667 Ga0157371_10153253
668 Ga0157370_10001400
669 Ga0157370_10040232
670 Ga0157370_10077835
671 Ga0157370_10124020
672 Ga0157370_10566773
673 Ga0157369_10000086
674 Ga0157369_10001294
675 Ga0157369_10011967
676 Ga0157369_10022515
677 Ga0157369_10029363
678 Ga0157369_10042514
679 Ga0157369_10160432
680 Ga0157374_10032236
681 Ga0157374_10094394
682 Ga0157378_10000619
683 Ga0157378_10082662
684 Ga0163162_10000021
685 Ga0157372_10002348
686 Ga0157372_10004810
687 Ga0157372_10013783
688 Ga0157372_10032875
689 Ga0157372_10050517
690 Ga0157372_10051737
691 Ga0157372_10069072
692 Ga0157372_10132309
693 Ga0157372_10308605
694 Ga0157372_10599330
695 Ga0157375_10644636
696 Ga0163163_10004231
697 Ga0182008_10000262
698 Ga0157379_10010562
699 Ga0157376_10001452
700 Ga0157376_10025766
701 Ga0157376_10102992
702 Ga0157376_10227438
703 Ga0157376_10354149
704 Ga0157376_10619777
705 Ga0182006_1001047
706 Ga0182007_10018645
707 Ga0182005_1000777
708 Ga0182005_1002340
709 Ga0197907_10066863
710 Ga0197907_11283620
711 Ga0206356_10374221
712 Ga0206356_11811416
713 Ga0206352_10796229
714 Ga0206354_10157811
715 Ga0206354_10571241
716 Ga0206354_10759747
717 Ga0206353_10447243
718 Ga0206353_10732906
719 Ga0206353_11439705
720 Ga0213875_10000542
721 Ga0207656_10001911
722 Ga0207656_10008490
723 Ga0207656_10018614
724 Ga0207656_10020902
725 Ga0207680_10000109
726 Ga0207680_10152762
727 Ga0207647_10000858
728 Ga0207647_10001297
729 Ga0207647_10004858
730 Ga0207647_10048500
731 Ga0207643_10157922
732 Ga0207705_10001251
733 Ga0207705_10001521
734 Ga0207705_10001662
735 Ga0207705_10001681
736 Ga0207705_10014582
737 Ga0207705_10037248
738 Ga0207705_10054134
739 Ga0207705_10090172
740 Ga0207654_10000065
741 Ga0207654_10013861
742 Ga0207654_10016049
743 Ga0207654_10029426
744 Ga0207654_10040769
745 Ga0207707_10000058
746 Ga0207707_10000070
747 Ga0207707_10000167
748 Ga0207707_10000274
749 Ga0207707_10000296
750 Ga0207707_10001746
751 Ga0207707_10014086
752 Ga0207707_10104754
753 Ga0207695_10000864
754 Ga0207695_10003863
755 Ga0207695_10004260
756 Ga0207695_10007210
757 Ga0207695_10024897
758 Ga0207695_10025236
759 Ga0207695_10048628
760 Ga0207671_10002473
761 Ga0207671_10006597
762 Ga0207671_10020985
763 Ga0207671_10036641
764 Ga0207671_10141225
765 Ga0207660_10000278
766 Ga0207660_10001582
767 Ga0207660_10005619
768 Ga0207660_10021800
769 Ga0207660_10023533
770 Ga0207660_10024897
771 Ga0207660_10034347
772 Ga0207660_10099887
773 Ga0207657_10000612
774 Ga0207657_10025099
775 Ga0207657_10029361
776 Ga0207657_10029458
777 Ga0207657_10051744
778 Ga0207657_10052154
779 Ga0207649_10001908
780 Ga0207649_10003964
781 Ga0207649_10006809
782 Ga0207649_10008698
783 Ga0207649_10038480
784 Ga0207652_10000078
785 Ga0207652_10000209
786 Ga0207652_10000552
787 Ga0207652_10001361
788 Ga0207652_10001550
789 Ga0207652_10001758
790 Ga0207652_10054422
791 Ga0207694_10006422
792 Ga0207694_10013104
793 Ga0207694_10075470
794 Ga0207694_10092905
795 Ga0207694_10194108
796 Ga0207650_10005058
797 Ga0207650_10565413
798 Ga0207650_10592007
799 Ga0207687_10158411
800 Ga0207644_10236668
801 Ga0207690_10000371
802 Ga0207690_10007382
803 Ga0207706_10014188
804 Ga0207704_10023471
805 Ga0207691_10006050
806 Ga0207691_10101139
807 Ga0207689_10012766
808 Ga0207689_10070361
809 Ga0207661_10001380
810 Ga0207661_10005991
811 Ga0207661_10014565
812 Ga0207661_10052462
813 Ga0207679_10307212
814 Ga0207667_10000740
815 Ga0207667_10000932
816 Ga0207667_10002142
817 Ga0207667_10002819
818 Ga0207667_10037260
819 Ga0207667_10042509
820 Ga0207667_10280527
821 Ga0207667_10557951
822 Ga0207651_10105012
823 Ga0207651_10355840
824 Ga0207712_10000340
825 Ga0207712_10030582
826 Ga0207668_10143897
827 Ga0207640_10000264
828 Ga0207640_10001219
829 Ga0207640_10001768
830 Ga0207640_10015465
831 Ga0207640_10024172
832 Ga0207658_10066618
833 Ga0207658_10179315
834 Ga0207658_10253444
835 Ga0207677_10096480
836 Ga0207677_10130146
837 Ga0207703_10004638
838 Ga0207703_10134797
839 Ga0207639_10000399
840 Ga0207639_10001582
841 Ga0207639_10002331
842 Ga0207639_10004509
843 Ga0207639_10026244
844 Ga0207639_10112548
845 Ga0207639_10425660
846 Ga0207678_10019481
847 Ga0207678_10024454
848 Ga0207678_10025343
849 Ga0207678_10083008
850 Ga0207678_10096606
851 Ga0207678_10104441
852 Ga0207678_10157760
853 Ga0207678_10664706
854 Ga0207702_10002775
855 Ga0207702_10010206
856 Ga0207702_10262946
857 Ga0207702_10382153
858 Ga0207702_10694811
859 Ga0207648_10129238
860 Ga0207676_10057651
861 Ga0207676_10175849
862 Ga0207674_10000973
863 Ga0207674_10002862
864 Ga0207674_10057744
865 Ga0207674_10061173
866 Ga0207674_10248902
867 Ga0207674_10434335
868 Ga0207698_10001013
869 Ga0207698_10001297
870 Ga0207698_10001673
871 Ga0207698_10059215
872 Ga0207698_10167973
873 Ga0207698_10184105
874 Ga0207698_10191991
875 Ga0207698_10759274
876 Ga0268266_10000013
877 Ga0268266_10138378
878 Ga0268264_10003604
879 Ga0268264_10030849
880 Ga0307508_10039008
881 Ga0307516_10141923
882 Ga0307412_10005781
883 Ga0307412_10151903
884 Ga0395899_0013560
885 Ga0395900_0007509
886 Ga0395900_0010725
887 Ga0395900_0536879
888 Ga0395898_0102926
889 Ga0395898_0120555
890 Ga0436364_1187307
891 Ga0395901_0016767
892 Ga0439436_0000022
893 Ga0451853_0534717
894 Ga0451577_0001910
895 Ga0451577_0005601
896 Ga0451577_0097035
897 Ga0451577_0344819
898 Ga0453683_0044651
899 Ga0453684_0000229
900 Ga0453684_0004942
901 Ga0453684_0010417
902 Ga0453684_0011788
903 Ga0453684_0014884
904 Ga0453684_0480596
905 Ga0466970_0216088
906 Ga0451576_0000451
907 Ga0451576_0102523
908 Ga0495638_0000007
909 Ga0495580_0440052
910 Ga0495606_0041938
911 Ga0495610_0000341
912 Ga0495645_0451066
913 Ga0495625_0204885
914 Ga0495670_0011482
915 Ga0496104_0000016
916 Ga0496105_0000035
917 Ga0496114_0120787
918 Ga0496115_0000746
919 Ga0496116_0030788
920 Ga0496118_0129518
921 Ga0496119_0065405
922 Ga0496120_0200649
923 Ga0496125_0211255
924 Ga0496126_0000033
925 Ga0496126_0301856
926 Ga0501031_0181116
927 Ga0501032_0116024
928 Ga0501034_0006178
929 Ga0501034_0327994
930 Ga0501034_0487272
931 Ga0501034_0653181
932 Ga0501036_0121669
933 Ga0501036_0129120
934 Ga0501036_0405680
935 Ga0501037_0138081
936 Ga0501037_0272434
937 Ga0501037_0337040
938 Ga0501038_0010027
939 Ga0501039_0510214
940 Ga0501043_0084851
941 Ga0501043_0115077
942 Ga0501043_0397549
943 Ga0501046_0007603
944 Ga0501046_0033164
945 Ga0501047_0000349
946 Ga0501047_0000442
947 Ga0501047_0010758
948 Ga0501047_0011035
949 Ga0501047_0236328
950 Ga0501047_0314796
951 Ga0501067_0000269
952 Ga0501068_0009983
953 Ga0501068_0039107
954 Ga0501069_0002152
955 Ga0501069_0002562
956 Ga0501069_0022100
957 Ga0501069_0039876
958 Ga0501069_0177994
959 Ga0501070_0001603
960 Ga0501070_0002554
961 Ga0501070_0006863
962 Ga0501070_0008525
963 Ga0501070_0008703
964 Ga0501070_0016621
965 Ga0501070_0025817
966 Ga0501070_0035738
967 Ga0501070_0039522
968 Ga0501070_0198383
969 Ga0501071_0004059
970 Ga0501072_0000955
971 Ga0501073_0000424
972 Ga0501073_0008259
973 Ga0501073_0031213
974 Ga0501073_0036445
975 Ga0501073_0057716
976 Ga0501073_0085252
977 Ga0501073_0121341
978 Ga0501074_0008658
979 Ga0501074_0010754
980 Ga0501074_0022348
981 Ga0501074_0092896
982 Ga0501074_0149595
983 Ga0501074_0330940
984 Ga0501077_0001230
985 Ga0501077_0437299
986 Ga0501079_0019061
987 Ga0501079_0080108
988 Ga0501079_0496690
989 Ga0501080_0000828
990 Ga0501080_0002423
991 Ga0501080_0004456
992 Ga0501080_0027187
993 Ga0501080_0034157
994 Ga0501080_0047857
995 Ga0501080_0129961
996 Ga0501083_0003137
997 Ga0501035_0063315
998 Ga0501035_0089508
999 Ga0501035_0610916
1000 Ga0501044_0069319
1001 Ga0501044_0131069
1002 Ga0501044_0145696
1003 Ga0501044_0158915
1004 Ga0501044_0170762
1005 Ga0501044_0530928
1006 nmdc:mga0yw44_13_c1
1007 nmdc:mga07m45_44240_c1
1008 Ga0500568_0001038
1009 Ga0501084_0055020
1010 Ga0501084_0064768
1011 Ga0501084_0189300
1012 Ga0501084_0514946
1013 Ga0501082_0000356
1014 Ga0501082_0069998
1015 Ga0501082_0445869
1016 2644537018
1017 2842920178
1018 2984594283

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01255

Prenyltransf

Putative undecaprenyl diphosphate synthase

61

281

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x07-assembly1.cif.gz_A crystal structure of undecaprenyl pyrophosphate synthase in complex with mg and ipp 0.9727 18 240
1x09-assembly1.cif.gz_A crystal structure of the d26a mutant upps in complex with magnesium and isopentenyl pyrophosphate 0.9712 19 239
5cqj-assembly1.cif.gz_B crystal structure of e. coli undecaprenyl pyrophosphate synthase in complex with clomiphene 0.9668 19 240
6szg-assembly1.cif.gz_A acinetobacter baumannii undecaprenyl pyrophosphate synthase (ab-upps) in complex with gr839 and gsk513 0.9655 16 236
3sgv-assembly1.cif.gz_B crystal structure of e. coli undecaprenyl pyrophosphate synthase in complex with bph-1290 0.9634 18 240
ID Description Score Start End Superfamily
af_O14171_12_259_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9715 13 237 3.40.1180.10
af_K7KA63_68_310_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9683 17 246 3.40.1180.10
af_Q58767_31_280_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9607 14 245 3.40.1180.10
5hc7A00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9592 17 239 3.40.1180.10
af_A0A1D8PFD1_28_274_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9576 13 238 3.40.1180.10
ID Description Score Start End GO Terms
AF-B8L344-F1-model_v4 Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) (EC 2.5.1.31) (Ditrans,polycis-undecaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) (Undecaprenyl pyrophosphate synthase) (UPP synthase) 0.9792 25 246 GO:0000287
GO:0005829
GO:0008360
GO:0008834
GO:0009252
GO:0016094
GO:0045547
GO:0071555
AF-L0GUR1-F1-model_v4 Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) (EC 2.5.1.31) (Ditrans,polycis-undecaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) (Undecaprenyl pyrophosphate synthase) (UPP synthase) 0.9789 17 246 GO:0000287
GO:0005829
GO:0008360
GO:0008834
GO:0009252
GO:0016094
GO:0045547
GO:0071555
AF-A0A7R8WV50-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9786 16 239 GO:0016020
GO:0016024
GO:0016765
GO:0016779
GO:0019288
GO:0030145
GO:0030604
GO:0070402
AF-A0A661J3R4-F1-model_v4 Isoprenyl transferase 0.9775 17 233 GO:0016094
GO:0045547
GO:0046872
AF-A0A1Z9DBU2-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9772 14 240 GO:0016094
GO:0045547
GO:0046872

Map