F456911

General Info

Members Datasets Scaffolds Average Seq Length
508 302 1016 167

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8048127548|8048128179
Length 185
Sequence VQIAGDPLDIPHLLPPVPAHPSTVSAFAGLARTIAADRDGWAPLVRYDATSRWYHRLRTGPGYEVWLLSWVPGQGSGAHDHGRSSGVLTVLQGELTERVGTRGVGHTLRAGAQRVFAPGYVHDVVNDSLEPAVSLHIYFPGLTEMPLHPTQSAELSAATALVTAPVAAPSVPPAAAPGTLGVMGG

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
14 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
17 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
25 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
26 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
27 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
28 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
29 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
30 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
37 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
38 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
39 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
40 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
41 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
42 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
43 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
44 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
45 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
46 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
47 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
48 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
49 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
50 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
51 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
52 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
55 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
56 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
57 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
58 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
59 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
60 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
61 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
62 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
63 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
64 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
65 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
66 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
67 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
68 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
69 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
70 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
71 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
72 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
73 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
74 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
75 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
76 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
77 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
80 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
83 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
84 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
85 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
86 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
87 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
88 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
92 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
95 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
109 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
110 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
113 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
114 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
115 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
119 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
120 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
121 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
130 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
161 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
165 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
166 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
172 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
173 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
183 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
207 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
210 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
211 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
212 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
213 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
214 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
215 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
216 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
217 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
218 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
219 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
220 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
221 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
222 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
225 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
226 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
227 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
228 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
229 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
230 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
231 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
232 2643221548 Streptomyces sp. Root55 Isolate Unclassified
233 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
234 2643221647 Streptomyces sp. Root369 Isolate Unclassified
235 2643221670 Streptomyces sp. Root431 Isolate Unclassified
236 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
237 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
238 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
239 2643221714 Streptomyces sp. Root264 Isolate Unclassified
240 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
241 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
242 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
243 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
244 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
245 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
246 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
247 2808606448 Streptomyces sp. 193411 Isolate Unclassified
248 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
249 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
250 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
251 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
252 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
253 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
254 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
255 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
256 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
257 2862574272 Streptomyces sp. AcE210 Isolate Nodule
258 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
259 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
260 2867369537 Streptomyces sp. Z26 Isolate Unclassified
261 2867428634 Streptomyces sp. RP5T Isolate Unclassified
262 2867475112 Streptomyces sp. TM32 Isolate Unclassified
263 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
264 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
265 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
266 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
267 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
268 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
269 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
270 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
271 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
272 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
273 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
274 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
275 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
276 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
277 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
278 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
279 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
280 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
281 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
282 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
283 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
284 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
285 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
286 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
287 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
288 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
289 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
290 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
291 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
292 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
293 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
294 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
295 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
296 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
297 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
298 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
299 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
300 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
301 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
302 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.86
Metatranscriptomes 0.59
Isolates 15.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.12
Nodule 0.2
Rhizoplane 2.17
Rhizosphere 77.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10011848 3300003316 Bacteria 3599
2 rootH1_10019277 3300003316 Bacteria 2654
3 rootH2_10005257 3300003320 Bacteria 3607
4 rootL2_10139515 3300003322 Bacteria 1508
5 rootH1_10010079 3300003323 Bacteria 4907
6 rootH1_10010098 3300003323 Bacteria 3650
7 Ga0006562J51391_1122988 3300003578 Bacteria 1448
8 Ga0006562J51391_1122989 3300003578 Bacteria 1220
9 Ga0006562J51391_1140152 3300003578 Bacteria 1130
10 Ga0068853_100004360 3300005539 Bacteria 10951
11 Ga0068856_100047398 3300005614 Bacteria 4233
12 Ga0068851_10232878 3300005834 Bacteria 1039
13 Ga0081455_10055390 3300005937 Bacteria 3373
14 Ga0075365_10017422 3300006038 Bacteria 4394
15 Ga0075363_100014181 3300006048 Bacteria 3886
16 Ga0075363_100124254 3300006048 Bacteria 1443
17 Ga0075367_10018023 3300006178 Bacteria 3888
18 Ga0075367_10530635 3300006178 Bacteria 747
19 Ga0105244_10225922 3300009036 Bacteria 877
20 Ga0105250_10122164 3300009092 Bacteria 1071
21 Ga0105245_10561330 3300009098 Bacteria 1164
22 Ga0105247_10144038 3300009101 Bacteria 1564
23 Ga0105243_10437242 3300009148 Bacteria 1224
24 Ga0105243_10554062 3300009148 Bacteria 1099
25 Ga0105242_10793302 3300009176 Bacteria 937
26 Ga0105238_10177667 3300009551 Bacteria 2106
27 Ga0105238_10816939 3300009551 Bacteria 948
28 Ga0105246_10098705 3300011119 Bacteria 2122
29 Ga0105246_10192376 3300011119 Bacteria 1580
30 Ga0157369_10053273 3300013105 Bacteria 4374
31 Ga0157372_10088717 3300013307 Bacteria 3512
32 Ga0182008_10000929 3300014497 Bacteria 20392
33 Ga0182007_10001450 3300015262 Bacteria 12722
34 Ga0182005_1014891 3300015265 Bacteria 2173
35 Ga0183367_1005 3300015688 Bacteria 652063
36 Ga0163161_11137540 3300017792 Bacteria 672
37 Ga0209758_1001238 3300025297 Bacteria 31885
38 Ga0207426_1006756 3300025302 Bacteria 4914
39 Ga0207426_1057235 3300025302 Bacteria 1135
40 Ga0207696_1071578 3300025711 Bacteria 963
41 Ga0207647_10005923 3300025904 Bacteria 8914
42 Ga0207694_10353416 3300025924 Bacteria 1217
43 Ga0207639_10028469 3300026041 Bacteria 4080
44 Ga0207702_10077473 3300026078 Bacteria 2875
45 Ga0268266_10866647 3300028379 Bacteria 873
46 Ga0307517_10048157 3300028786 Bacteria 4396
47 Ga0307515_10000054 3300028794 Bacteria 265489
48 Ga0307515_10076657 3300028794 Bacteria 4430
49 Ga0307515_10093407 3300028794 Bacteria 3730
50 Ga0307511_10028569 3300030521 Bacteria 5058
51 Ga0307512_10002026 3300030522 Bacteria 26815
52 Ga0307512_10020823 3300030522 Bacteria 5926
53 Ga0307513_10003169 3300031456 Bacteria 22457
54 Ga0307513_10075621 3300031456 Bacteria 3496
55 Ga0307513_10536624 3300031456 Bacteria 883
56 Ga0307509_10116597 3300031507 Bacteria 2660
57 Ga0307509_10364483 3300031507 Bacteria 1163
58 Ga0307408_100560379 3300031548 Bacteria 1010
59 Ga0307508_10011754 3300031616 Bacteria 8001
60 Ga0307508_10041711 3300031616 Bacteria 4117
61 Ga0307508_10059008 3300031616 Bacteria 3394
62 Ga0307508_10313658 3300031616 Bacteria 1160
63 Ga0307514_10004357 3300031649 Bacteria 13046
64 Ga0307514_10029655 3300031649 Bacteria 4396
65 Ga0307514_10066601 3300031649 Bacteria 2723
66 Ga0307514_10282155 3300031649 Bacteria 949
67 Ga0307516_10006631 3300031730 Bacteria 13535
68 Ga0307516_10009273 3300031730 Bacteria 11003
69 Ga0307516_10454453 3300031730 Bacteria 937
70 Ga0307413_10602591 3300031824 Bacteria 899
71 Ga0307518_10051086 3300031838 Bacteria 3006
72 Ga0307412_10921499 3300031911 Bacteria 767
73 Ga0307416_100111185 3300032002 Bacteria 2415
74 Ga0307416_100430706 3300032002 Bacteria 1366
75 Ga0307507_10056236 3300033179 Bacteria 3720
76 Ga0307510_10017828 3300033180 Bacteria 8364
77 Ga0307510_10220138 3300033180 Bacteria 1410
78 Ga0307510_10240476 3300033180 Bacteria 1305
79 Ga0307510_10249948 3300033180 Bacteria 1261
80 Ga0395898_0015186 3300037466 Bacteria 7905
81 Ga0395898_0035965 3300037466 Bacteria 4922
82 Ga0395901_0070511 3300038443 Bacteria 3641
83 Ga0439436_0000715 3300041404 Bacteria 8957
84 Ga0439436_0001354 3300041404 Bacteria 7050
85 Ga0439436_0196576 3300041404 Bacteria 576
86 Ga0439439_0008556 3300041406 Bacteria 2420
87 Ga0451793_1899773 3300041452 Bacteria 882
88 Ga0451797_1354984 3300041453 Bacteria 737
89 Ga0451849_0307807 3300041505 Bacteria 1030
90 Ga0451853_0476296 3300041512 Bacteria 2085
91 Ga0451853_1376733 3300041512 Bacteria 1280
92 Ga0439433_0002539 3300041999 Bacteria 3874
93 Ga0439433_0005844 3300041999 Bacteria 2644
94 Ga0439442_010135 3300042002 Bacteria 1909
95 Ga0439448_0005005 3300042005 Bacteria 3766
96 Ga0439449_0000470 3300042007 Bacteria 15054
97 Ga0439449_0024546 3300042007 Bacteria 2253
98 Ga0439449_0025405 3300042007 Bacteria 2214
99 Ga0439449_0293341 3300042007 Bacteria 613
100 Ga0439450_025681 3300042008 Bacteria 1293
101 Ga0439455_0000687 3300042012 Bacteria 4989
102 Ga0439457_000081 3300042014 Bacteria 21387
103 Ga0439457_001368 3300042014 Bacteria 7338
104 Ga0439462_0002757 3300042015 Bacteria 4125
105 Ga0450895_006888 3300042132 Bacteria 936
106 Ga0450896_003111 3300042133 Bacteria 2183
107 Ga0450898_001504 3300042134 Bacteria 3084
108 Ga0450899_000035 3300042135 Bacteria 10107
109 Ga0450900_003617 3300042136 Bacteria 1725
110 Ga0450902_015702 3300042137 Bacteria 1230
111 Ga0450903_000534 3300042138 Bacteria 7949
112 Ga0450906_003642 3300042145 Bacteria 3289
113 Ga0439458_0007805 3300042157 Bacteria 2382
114 Ga0450901_012646 3300042533 Bacteria 882
115 Ga0466969_0097331 3300044656 Bacteria 1388
116 Ga0466972_0002192 3300044658 Bacteria 9582
117 Ga0466972_0006575 3300044658 Bacteria 5837
118 Ga0466972_0042472 3300044658 Bacteria 2210
119 Ga0466972_0532986 3300044658 Bacteria 553
120 Ga0466965_0005677 3300044683 Bacteria 5631
121 Ga0466966_0000217 3300044684 Bacteria 38595
122 Ga0466966_0000611 3300044684 Bacteria 22672
123 Ga0466966_0113116 3300044684 Bacteria 1672
124 Ga0466961_0006969 3300044693 Bacteria 7189
125 Ga0466961_0013793 3300044693 Bacteria 5179
126 Ga0466963_0000212 3300044694 Bacteria 24897
127 Ga0466963_0002268 3300044694 Bacteria 10686
128 Ga0466964_0013683 3300044706 Bacteria 3079
129 Ga0466964_0046685 3300044706 Bacteria 1766
130 Ga0466971_0000341 3300044719 Bacteria 17902
131 Ga0466971_0020035 3300044719 Bacteria 2973
132 Ga0466971_0083727 3300044719 Bacteria 1456
133 Ga0466970_0000466 3300044765 Bacteria 20041
134 Ga0466970_0014376 3300044765 Bacteria 4064
135 Ga0466957_0000214 3300044842 Bacteria 27239
136 Ga0466957_0110044 3300044842 Bacteria 1746
137 Ga0466960_0005755 3300044901 Bacteria 4933
138 Ga0466958_0000477 3300045836 Bacteria 16762
139 Ga0466958_0043457 3300045836 Bacteria 2706
140 Ga0466958_0262166 3300045836 Bacteria 1106
141 Ga0466967_0036607 3300045976 Bacteria 4191
142 Ga0466967_0049093 3300045976 Bacteria 3689
143 Ga0495617_011906 3300046452 Bacteria 2967
144 Ga0495617_122329 3300046452 Bacteria 838
145 Ga0495627_011956 3300046453 Bacteria 3094
146 Ga0495627_117727 3300046453 Bacteria 751
147 Ga0495592_0018516 3300046454 Bacteria 5297
148 Ga0495592_0047592 3300046454 Bacteria 3193
149 Ga0495603_0002506 3300046455 Bacteria 10800
150 Ga0495603_0002594 3300046455 Bacteria 10668
151 Ga0495603_0014669 3300046455 Bacteria 4737
152 Ga0495603_0035177 3300046455 Bacteria 3009
153 Ga0495603_0120402 3300046455 Bacteria 1529
154 Ga0495590_0202094 3300046457 Bacteria 730
155 Ga0495590_0211148 3300046457 Bacteria 715
156 Ga0495629_0001149 3300046459 Bacteria 20896
157 Ga0495629_0002541 3300046459 Bacteria 13992
158 Ga0495629_0041100 3300046459 Bacteria 3254
159 Ga0495629_0089542 3300046459 Bacteria 2146
160 Ga0495629_0117203 3300046459 Bacteria 1855
161 Ga0495629_0313641 3300046459 Bacteria 1073
162 Ga0495629_0315267 3300046459 Bacteria 1069
163 Ga0495629_0509863 3300046459 Bacteria 810
164 Ga0495638_0064097 3300046460 Bacteria 2264
165 Ga0495638_0164840 3300046460 Bacteria 1275
166 Ga0495651_0001081 3300046462 Bacteria 21021
167 Ga0495651_0367558 3300046462 Bacteria 946
168 Ga0495580_0081342 3300046472 Bacteria 2257
169 Ga0495582_0059392 3300046473 Bacteria 2110
170 Ga0495582_0208635 3300046473 Bacteria 1116
171 Ga0495582_0463147 3300046473 Bacteria 732
172 Ga0495605_0069889 3300046474 Bacteria 1661
173 Ga0495639_0007863 3300046475 Bacteria 4582
174 Ga0495662_0012229 3300046476 Bacteria 4191
175 Ga0495662_0075156 3300046476 Bacteria 1639
176 Ga0495662_0115429 3300046476 Bacteria 1316
177 Ga0495662_0183086 3300046476 Bacteria 1032
178 Ga0495662_0405443 3300046476 Bacteria 669
179 Ga0495664_0006458 3300046477 Bacteria 6479
180 Ga0495584_0661799 3300046491 Bacteria 532
181 Ga0495585_0009078 3300046492 Bacteria 5988
182 Ga0495585_0047782 3300046492 Bacteria 2382
183 Ga0495585_0088458 3300046492 Bacteria 1670
184 Ga0495594_0000163 3300046499 Bacteria 31842
185 Ga0495594_0022448 3300046499 Bacteria 3375
186 Ga0495594_0033409 3300046499 Bacteria 2797
187 Ga0495594_0134198 3300046499 Bacteria 1402
188 Ga0495596_0017793 3300046500 Bacteria 2938
189 Ga0495583_0038384 3300046506 Bacteria 2262
190 Ga0495583_0243831 3300046506 Bacteria 722
191 Ga0495583_0255721 3300046506 Bacteria 701
192 Ga0495606_0004999 3300046507 Bacteria 12929
193 Ga0495606_0410754 3300046507 Bacteria 702
194 Ga0495608_0026683 3300046511 Bacteria 3936
195 Ga0495610_0181047 3300046512 Bacteria 876
196 Ga0495616_0050110 3300046513 Bacteria 2089
197 Ga0495618_0037473 3300046514 Bacteria 3045
198 Ga0495618_0083278 3300046514 Bacteria 2043
199 Ga0495620_0053830 3300046515 Bacteria 1702
200 Ga0495620_0068039 3300046515 Bacteria 1463
201 Ga0495628_0165896 3300046516 Bacteria 1676
202 Ga0495628_0294024 3300046516 Bacteria 1203
203 Ga0495630_0279991 3300046517 Bacteria 1274
204 Ga0495630_0281511 3300046517 Bacteria 1270
205 Ga0495631_0003558 3300046518 Bacteria 8515
206 Ga0495632_0075309 3300046519 Bacteria 1615
207 Ga0495637_0037016 3300046520 Bacteria 2121
208 Ga0495637_0162864 3300046520 Bacteria 836
209 Ga0495644_0091854 3300046523 Bacteria 1146
210 Ga0495644_0137513 3300046523 Bacteria 932
211 Ga0495648_0412533 3300046524 Bacteria 600
212 Ga0495648_0448631 3300046524 Bacteria 565
213 Ga0495666_0022175 3300046526 Bacteria 3144
214 Ga0495666_0134280 3300046526 Bacteria 1155
215 Ga0495652_0037607 3300046529 Bacteria 4197
216 Ga0495652_0045461 3300046529 Bacteria 3774
217 Ga0495654_0012238 3300046530 Bacteria 4614
218 Ga0495640_0042935 3300046533 Bacteria 3151
219 Ga0495640_0079904 3300046533 Bacteria 2176
220 Ga0495586_0248623 3300046535 Bacteria 1014
221 Ga0495586_0295407 3300046535 Bacteria 928
222 Ga0495587_0004877 3300046536 Bacteria 8803
223 Ga0495587_0216725 3300046536 Bacteria 1080
224 Ga0495609_0022277 3300046538 Bacteria 2918
225 Ga0495597_0017132 3300046542 Bacteria 3414
226 Ga0495645_0006917 3300046543 Bacteria 7881
227 Ga0495645_0114622 3300046543 Bacteria 1904
228 Ga0495622_0045997 3300046557 Bacteria 2027
229 Ga0495622_0220491 3300046557 Bacteria 840
230 Ga0495633_0005854 3300046558 Bacteria 7400
231 Ga0495633_0161213 3300046558 Bacteria 1035
232 Ga0495656_0209450 3300046615 Bacteria 971
233 Ga0495668_0013932 3300046616 Bacteria 4726
234 Ga0495668_0311252 3300046616 Bacteria 863
235 Ga0495634_0054339 3300046642 Bacteria 2681
236 Ga0495634_0060547 3300046642 Bacteria 2518
237 Ga0495634_0285695 3300046642 Bacteria 1001
238 Ga0495611_0043671 3300046648 Bacteria 2004
239 Ga0495611_0224797 3300046648 Bacteria 873
240 Ga0495611_0391027 3300046648 Bacteria 636
241 Ga0495625_0011317 3300046660 Bacteria 7284
242 Ga0495625_0118627 3300046660 Bacteria 1802
243 Ga0495625_0128737 3300046660 Bacteria 1716
244 Ga0495625_0421060 3300046660 Bacteria 830
245 Ga0495635_0004210 3300046663 Bacteria 9978
246 Ga0495635_0066282 3300046663 Bacteria 2476
247 Ga0495661_0026300 3300046665 Bacteria 3749
248 Ga0495661_0151963 3300046665 Bacteria 1250
249 Ga0495661_0305512 3300046665 Bacteria 795
250 Ga0495588_0000781 3300046674 Bacteria 14423
251 Ga0495588_0042715 3300046674 Bacteria 2318
252 Ga0495588_0242656 3300046674 Bacteria 950
253 Ga0495588_0248177 3300046674 Bacteria 938
254 Ga0495588_0475241 3300046674 Bacteria 655
255 Ga0495588_0539474 3300046674 Bacteria 611
256 Ga0495657_0008322 3300046675 Bacteria 7948
257 Ga0495657_0011980 3300046675 Bacteria 6457
258 Ga0495657_0230442 3300046675 Bacteria 1120
259 Ga0495599_0502928 3300046678 Bacteria 713
260 Ga0495623_0637776 3300046679 Bacteria 550
261 Ga0495646_0001196 3300046680 Bacteria 15185
262 Ga0495646_0206978 3300046680 Bacteria 1066
263 Ga0495613_0003624 3300046689 Bacteria 11564
264 Ga0495613_0012654 3300046689 Bacteria 6272
265 Ga0495613_0138543 3300046689 Bacteria 1739
266 Ga0495613_0165268 3300046689 Bacteria 1572
267 Ga0495613_0320635 3300046689 Bacteria 1069
268 Ga0495624_0077908 3300046690 Bacteria 2056
269 Ga0495624_0125758 3300046690 Bacteria 1573
270 Ga0495624_0546781 3300046690 Bacteria 691
271 Ga0495670_0036055 3300046691 Bacteria 2464
272 Ga0495670_0114515 3300046691 Bacteria 1397
273 Ga0495671_0010678 3300046692 Bacteria 5081
274 Ga0495649_0059161 3300046694 Bacteria 2063
275 Ga0495649_0129953 3300046694 Bacteria 1329
276 Ga0495589_0012131 3300046794 Bacteria 4468
277 Ga0495589_0111783 3300046794 Bacteria 1318
278 Ga0495589_0128710 3300046794 Bacteria 1216
279 Ga0495589_0132998 3300046794 Bacteria 1193
280 Ga0495600_0034292 3300046809 Bacteria 3294
281 Ga0495600_0203271 3300046809 Bacteria 1271
282 Ga0495600_0404049 3300046809 Bacteria 849
283 Ga0495660_0179270 3300046810 Bacteria 1026
284 Ga0495660_0273875 3300046810 Bacteria 774
285 Ga0495581_0035597 3300047315 Bacteria 2880
286 Ga0495581_0052993 3300047315 Bacteria 2343
287 Ga0495581_0083029 3300047315 Bacteria 1856
288 Ga0495581_0122613 3300047315 Bacteria 1513
289 Ga0495604_0052569 3300047317 Bacteria 3153
290 Ga0495604_0426464 3300047317 Bacteria 870
291 Ga0495636_0001844 3300047318 Bacteria 8110
292 Ga0495636_0025178 3300047318 Bacteria 2414
293 Ga0495636_0088489 3300047318 Bacteria 1342
294 Ga0495636_0095414 3300047318 Bacteria 1295
295 Ga0495636_0218584 3300047318 Bacteria 874
296 Ga0495636_0300335 3300047318 Bacteria 751
297 Ga0495636_0321579 3300047318 Bacteria 726
298 Ga0495674_0042932 3300047319 Bacteria 4029
299 Ga0495674_0156422 3300047319 Bacteria 1909
300 Ga0495676_0132671 3300047321 Bacteria 1795
301 Ga0495676_0139810 3300047321 Bacteria 1736
302 Ga0495676_0158005 3300047321 Bacteria 1606
303 Ga0495676_0377535 3300047321 Bacteria 943
304 Ga0495680_0506722 3300047322 Bacteria 818
305 Ga0495680_0756330 3300047322 Bacteria 638
306 Ga0495683_0022425 3300047323 Bacteria 3247
307 Ga0495683_0046460 3300047323 Bacteria 2179
308 Ga0495683_0156153 3300047323 Bacteria 1058
309 Ga0495687_001961 3300047443 Bacteria 17573
310 Ga0495687_010889 3300047443 Bacteria 4940
311 Ga0495687_136276 3300047443 Bacteria 861
312 Ga0495687_230661 3300047443 Bacteria 565
313 Ga0495675_0008278 3300047444 Bacteria 6435
314 Ga0495675_0051183 3300047444 Bacteria 2624
315 Ga0495675_0191168 3300047444 Bacteria 1249
316 Ga0495677_0012850 3300047445 Bacteria 3050
317 Ga0495679_070166 3300047446 Bacteria 1011
318 Ga0495685_009066 3300047447 Bacteria 3316
319 Ga0495685_019639 3300047447 Bacteria 2322
320 Ga0495685_021282 3300047447 Bacteria 2231
321 Ga0495685_022912 3300047447 Bacteria 2148
322 Ga0495685_039900 3300047447 Bacteria 1606
323 Ga0495685_047704 3300047447 Bacteria 1456
324 Ga0495685_050249 3300047447 Bacteria 1415
325 Ga0495685_078172 3300047447 Bacteria 1103
326 Ga0495685_080217 3300047447 Bacteria 1087
327 Ga0495681_0000977 3300047470 Bacteria 21843
328 Ga0495681_0025296 3300047470 Bacteria 3107
329 Ga0495681_0089640 3300047470 Bacteria 1360
330 Ga0495684_0183224 3300047471 Bacteria 1551
331 Ga0495686_0015711 3300047472 Bacteria 5158
332 Ga0495686_0025046 3300047472 Bacteria 3913
333 Ga0495593_0011674 3300047673 Bacteria 5040
334 Ga0495593_0059036 3300047673 Bacteria 2010
335 Ga0495602_0124474 3300048088 Bacteria 2068
336 Ga0495602_0259707 3300048088 Bacteria 1289
337 Ga0495614_0001133 3300048089 Bacteria 11463
338 Ga0495614_0101743 3300048089 Bacteria 1256
339 Ga0495615_0071213 3300048090 Bacteria 937
340 Ga0495626_0082278 3300048091 Bacteria 1428
341 Ga0496102_0786412 3300048905 Bacteria 874
342 Ga0496102_1105984 3300048905 Bacteria 712
343 Ga0496104_1513041 3300048907 Bacteria 574
344 Ga0496108_0402211 3300048911 Bacteria 1196
345 Ga0496109_0062693 3300048912 Bacteria 3400
346 Ga0496110_0937929 3300048913 Bacteria 772
347 Ga0496111_0593480 3300048914 Bacteria 811
348 Ga0496112_1429737 3300048915 Bacteria 606
349 Ga0496125_0421749 3300048928 Bacteria 773
350 Ga0495678_083572 3300049459 Bacteria 1140
351 Ga0495678_234340 3300049459 Bacteria 551
352 Ga0495682_0012251 3300049460 Bacteria 3291
353 Ga0501031_0253961 3300049568 Bacteria 1142
354 Ga0501031_0665473 3300049568 Bacteria 669
355 Ga0501032_0118816 3300049569 Bacteria 1748
356 Ga0501032_0140131 3300049569 Bacteria 1593
357 Ga0501032_0218364 3300049569 Bacteria 1241
358 Ga0501033_0001282 3300049570 Bacteria 22418
359 Ga0501033_0015075 3300049570 Bacteria 5864
360 Ga0501033_0016506 3300049570 Bacteria 5590
361 Ga0501033_0241513 3300049570 Bacteria 1281
362 Ga0501034_0021336 3300049571 Bacteria 6603
363 Ga0501034_0024979 3300049571 Bacteria 6079
364 Ga0501034_0034100 3300049571 Bacteria 5161
365 Ga0501034_0111860 3300049571 Bacteria 2721
366 Ga0501036_0001577 3300049572 Bacteria 17639
367 Ga0501036_0004558 3300049572 Bacteria 11193
368 Ga0501036_0316952 3300049572 Bacteria 1303
369 Ga0501036_0652189 3300049572 Bacteria 871
370 Ga0501036_1132640 3300049572 Bacteria 639
371 Ga0501037_0002052 3300049573 Bacteria 14603
372 Ga0501037_0029472 3300049573 Bacteria 4054
373 Ga0501037_0089835 3300049573 Bacteria 2223
374 Ga0501038_0100248 3300049574 Bacteria 2413
375 Ga0501038_0289307 3300049574 Bacteria 1288
376 Ga0501039_0521059 3300049575 Bacteria 933
377 Ga0501039_0565074 3300049575 Bacteria 892
378 Ga0501043_0058840 3300049579 Bacteria 3016
379 Ga0501043_0078032 3300049579 Bacteria 2602
380 Ga0501046_0072698 3300049580 Bacteria 2669
381 Ga0501046_0081496 3300049580 Bacteria 2499
382 Ga0501047_0013258 3300049581 Bacteria 7807
383 Ga0501047_0292979 3300049581 Bacteria 1471
384 Ga0501047_0331074 3300049581 Bacteria 1361
385 Ga0501047_0529908 3300049581 Bacteria 1003
386 Ga0501048_0145603 3300049582 Bacteria 1676
387 Ga0501048_0437512 3300049582 Bacteria 936
388 Ga0501069_0634480 3300049585 Bacteria 642
389 Ga0501072_0554344 3300049588 Bacteria 908
390 Ga0501074_0942705 3300049590 Bacteria 607
391 Ga0501076_1035935 3300049592 Bacteria 676
392 Ga0501206_073684 3300049653 Bacteria 582
393 Ga0501080_0439647 3300049742 Bacteria 1170
394 Ga0501035_0038322 3300049822 Bacteria 4340
395 Ga0501035_0141095 3300049822 Bacteria 2095
396 Ga0501035_0151111 3300049822 Bacteria 2015
397 Ga0501035_0201897 3300049822 Bacteria 1704
398 Ga0501035_0276773 3300049822 Bacteria 1419
399 Ga0501035_0466086 3300049822 Bacteria 1043
400 Ga0501035_0884569 3300049822 Bacteria 708
401 Ga0501044_0003766 3300049823 Bacteria 17036
402 Ga0501044_0005505 3300049823 Bacteria 14065
403 Ga0501044_0024166 3300049823 Bacteria 6455
404 Ga0501044_0109153 3300049823 Bacteria 2776
405 Ga0501044_0222758 3300049823 Bacteria 1836
406 nmdc:mga03n38_239019_c1 3300050490 Bacteria 955
407 nmdc:mga03n38_32875_c1 3300050490 Bacteria 2202
408 nmdc:mga06z11_68162_c1 3300050494 Bacteria 1875
409 Ga0495612_0279130 3300053078 Bacteria 746
410 Ga0495655_0044964 3300053083 Bacteria 1145
411 Ga0495619_0439820 3300053085 Bacteria 899
412 Ga0500578_0039979 3300053086 Bacteria 3014
413 Ga0500644_0014613 3300053088 Bacteria 2220
414 Ga0500647_0272489 3300053091 Bacteria 735
415 Ga0500641_0020262 3300053096 Bacteria 2524
416 Ga0500650_0026702 3300053098 Bacteria 2593
417 Ga0500553_045732 3300053101 Bacteria 2122
418 Ga0500560_000463 3300053107 Bacteria 5646
419 Ga0500572_005113 3300053111 Bacteria 2967
420 Ga0500559_0302591 3300053136 Bacteria 751
421 Ga0500573_0119960 3300053140 Bacteria 1465
422 Ga0500577_0189800 3300053142 Bacteria 884
423 Ga0500600_0096668 3300053149 Bacteria 1566
424 Ga0500600_0328839 3300053149 Bacteria 640
425 Ga0500624_003649 3300053157 Bacteria 2017
426 Ga0500565_033757 3300053734 Bacteria 686
427 Ga0501082_0454110 3300060353 Bacteria 1120
428 Ga0466962_0000800 3300061719 Bacteria 14178
429 Ga0466962_0067193 3300061719 Bacteria 1711
430 8048128179 8048127548 Bacteria 11053136
431 2547412909 2547132111 Bacteria 8013147
432 2585302480 2582581312 Bacteria 7308206
433 2585310340 2582581313 Bacteria 10042643
434 2585319714 2582581314 Bacteria 11452267
435 2616695463 2616644814 Bacteria 11555299
436 2616905028 2616644941 Bacteria 8510691
437 2643765551 2643221548 Bacteria 8053412
438 2643945559 2643221587 Bacteria 7586415
439 2644265239 2643221647 Bacteria 10741251
440 2644388948 2643221670 Bacteria 6497041
441 2644432405 2643221677 Bacteria 7584031
442 2644436835 2643221678 Bacteria 9540101
443 2644459664 2643221682 Bacteria 6743283
444 2644628572 2643221714 Bacteria 9015452
445 2644631011 2643221714 Bacteria 9015452
446 2768647423 2767802112 Bacteria 6465194
447 2784588304 2784132148 Bacteria 8627943
448 2785343711 2784746763 Bacteria 9783172
449 2785369116 2784746768 Bacteria 10036182
450 2793978204 2791355406 Bacteria 11364898
451 2808841731 2808606359 Bacteria 9866990
452 2808920262 2808606375 Bacteria 9466072
453 2809231918 2808606448 Bacteria 8656184
454 2811848664 2808606982 Bacteria 7791042
455 2812358521 2811994879 Bacteria 9313447
456 2812480845 2811994917 Bacteria 7761064
457 2819697791 2818991463 Bacteria 7948711
458 2852637013 2852635781 Bacteria 8251373
459 2862184384 2862178590 Bacteria 8583590
460 2862285159 2862281513 Bacteria 9621493
461 2862294304 2862290372 Bacteria 7471434
462 2862509709 2862507626 Bacteria 9425308
463 2862579532 2862574272 Bacteria 10567477
464 2862705674 2862705112 Bacteria 6563286
465 2867349651 2867346516 Bacteria 7608576
466 2867371601 2867369537 Bacteria 6501581
467 2867430783 2867428634 Bacteria 9590268
468 2867475277 2867475112 Bacteria 6909112
469 2875394215 2875391855 Bacteria 7600475
470 2877681429 2877676314 Bacteria 9512378
471 2912720406 2912715099 Bacteria 9460473
472 2912760345 2912757875 Bacteria 7940295
473 2918504201 2918501144 Bacteria 8668083
474 2919475250 2919468124 Bacteria 9133025
475 2935395104 2935390628 Bacteria 7043367
476 2946067357 2946064051 Bacteria 8957905
477 2946075616 2946072368 Bacteria 8999607
478 2954007866 2954002825 Bacteria 9173742
479 2954386573 2954380949 Bacteria 10050426
480 2954697385 2954691527 Bacteria 10720516
481 2954704886 2954701450 Bacteria 10834262
482 2954716551 2954711539 Bacteria 10867210
483 2954726496 2954721474 Bacteria 10456478
484 2954735311 2954731030 Bacteria 10243860
485 2954745421 2954740390 Bacteria 10229294
486 2954754167 2954749733 Bacteria 10366972
487 2954764395 2954759201 Bacteria 9358192
488 2966602861 2966598605 Bacteria 7676064
489 2990047252 2990044586 Bacteria 6603797
490 2990067531 2990059506 Bacteria 9321252
491 2997454459 2997451912 Bacteria 8492419
492 2997604069 2997600082 Bacteria 9896405
493 3006426982 3006425503 Bacteria 6491253
494 3006486501 3006486233 Bacteria 8157040
495 3006499769 3006493962 Bacteria 8825450
496 8008488286 8008485437 Bacteria 7198341
497 8008579146 8008574985 Bacteria 7815457
498 8023631156 8023623736 Bacteria 8593882
499 8025530255 8025524527 Bacteria 7197316
500 8025536788 8025530807 Bacteria 8495698
501 8033691029 8033684223 Bacteria 6906479
502 8047898378 8047893842 Bacteria 11723082
503 8048360516 8048356638 Bacteria 11044339
504 8048375341 8048369669 Bacteria 11666822
505 8048382864 8048379754 Bacteria 11877923
506 8056451261 8056447290 Bacteria 7680491
507 8056671471 8056667051 Bacteria 6953971
508 8056835340 8056829672 Bacteria 9045328
509 rootH1_10011848
510 rootH1_10019277
511 rootH2_10005257
512 rootL2_10139515
513 rootH1_10010079
514 rootH1_10010098
515 Ga0006562J51391_1122988
516 Ga0006562J51391_1122989
517 Ga0006562J51391_1140152
518 Ga0068853_100004360
519 Ga0068856_100047398
520 Ga0068851_10232878
521 Ga0081455_10055390
522 Ga0075365_10017422
523 Ga0075363_100014181
524 Ga0075363_100124254
525 Ga0075367_10018023
526 Ga0075367_10530635
527 Ga0105244_10225922
528 Ga0105250_10122164
529 Ga0105245_10561330
530 Ga0105247_10144038
531 Ga0105243_10437242
532 Ga0105243_10554062
533 Ga0105242_10793302
534 Ga0105238_10177667
535 Ga0105238_10816939
536 Ga0105246_10098705
537 Ga0105246_10192376
538 Ga0157369_10053273
539 Ga0157372_10088717
540 Ga0182008_10000929
541 Ga0182007_10001450
542 Ga0182005_1014891
543 Ga0183367_1005
544 Ga0163161_11137540
545 Ga0209758_1001238
546 Ga0207426_1006756
547 Ga0207426_1057235
548 Ga0207696_1071578
549 Ga0207647_10005923
550 Ga0207694_10353416
551 Ga0207639_10028469
552 Ga0207702_10077473
553 Ga0268266_10866647
554 Ga0307517_10048157
555 Ga0307515_10000054
556 Ga0307515_10076657
557 Ga0307515_10093407
558 Ga0307511_10028569
559 Ga0307512_10002026
560 Ga0307512_10020823
561 Ga0307513_10003169
562 Ga0307513_10075621
563 Ga0307513_10536624
564 Ga0307509_10116597
565 Ga0307509_10364483
566 Ga0307408_100560379
567 Ga0307508_10011754
568 Ga0307508_10041711
569 Ga0307508_10059008
570 Ga0307508_10313658
571 Ga0307514_10004357
572 Ga0307514_10029655
573 Ga0307514_10066601
574 Ga0307514_10282155
575 Ga0307516_10006631
576 Ga0307516_10009273
577 Ga0307516_10454453
578 Ga0307413_10602591
579 Ga0307518_10051086
580 Ga0307412_10921499
581 Ga0307416_100111185
582 Ga0307416_100430706
583 Ga0307507_10056236
584 Ga0307510_10017828
585 Ga0307510_10220138
586 Ga0307510_10240476
587 Ga0307510_10249948
588 Ga0395898_0015186
589 Ga0395898_0035965
590 Ga0395901_0070511
591 Ga0439436_0000715
592 Ga0439436_0001354
593 Ga0439436_0196576
594 Ga0439439_0008556
595 Ga0451793_1899773
596 Ga0451797_1354984
597 Ga0451849_0307807
598 Ga0451853_0476296
599 Ga0451853_1376733
600 Ga0439433_0002539
601 Ga0439433_0005844
602 Ga0439442_010135
603 Ga0439448_0005005
604 Ga0439449_0000470
605 Ga0439449_0024546
606 Ga0439449_0025405
607 Ga0439449_0293341
608 Ga0439450_025681
609 Ga0439455_0000687
610 Ga0439457_000081
611 Ga0439457_001368
612 Ga0439462_0002757
613 Ga0450895_006888
614 Ga0450896_003111
615 Ga0450898_001504
616 Ga0450899_000035
617 Ga0450900_003617
618 Ga0450902_015702
619 Ga0450903_000534
620 Ga0450906_003642
621 Ga0439458_0007805
622 Ga0450901_012646
623 Ga0466969_0097331
624 Ga0466972_0002192
625 Ga0466972_0006575
626 Ga0466972_0042472
627 Ga0466972_0532986
628 Ga0466965_0005677
629 Ga0466966_0000217
630 Ga0466966_0000611
631 Ga0466966_0113116
632 Ga0466961_0006969
633 Ga0466961_0013793
634 Ga0466963_0000212
635 Ga0466963_0002268
636 Ga0466964_0013683
637 Ga0466964_0046685
638 Ga0466971_0000341
639 Ga0466971_0020035
640 Ga0466971_0083727
641 Ga0466970_0000466
642 Ga0466970_0014376
643 Ga0466957_0000214
644 Ga0466957_0110044
645 Ga0466960_0005755
646 Ga0466958_0000477
647 Ga0466958_0043457
648 Ga0466958_0262166
649 Ga0466967_0036607
650 Ga0466967_0049093
651 Ga0495617_011906
652 Ga0495617_122329
653 Ga0495627_011956
654 Ga0495627_117727
655 Ga0495592_0018516
656 Ga0495592_0047592
657 Ga0495603_0002506
658 Ga0495603_0002594
659 Ga0495603_0014669
660 Ga0495603_0035177
661 Ga0495603_0120402
662 Ga0495590_0202094
663 Ga0495590_0211148
664 Ga0495629_0001149
665 Ga0495629_0002541
666 Ga0495629_0041100
667 Ga0495629_0089542
668 Ga0495629_0117203
669 Ga0495629_0313641
670 Ga0495629_0315267
671 Ga0495629_0509863
672 Ga0495638_0064097
673 Ga0495638_0164840
674 Ga0495651_0001081
675 Ga0495651_0367558
676 Ga0495580_0081342
677 Ga0495582_0059392
678 Ga0495582_0208635
679 Ga0495582_0463147
680 Ga0495605_0069889
681 Ga0495639_0007863
682 Ga0495662_0012229
683 Ga0495662_0075156
684 Ga0495662_0115429
685 Ga0495662_0183086
686 Ga0495662_0405443
687 Ga0495664_0006458
688 Ga0495584_0661799
689 Ga0495585_0009078
690 Ga0495585_0047782
691 Ga0495585_0088458
692 Ga0495594_0000163
693 Ga0495594_0022448
694 Ga0495594_0033409
695 Ga0495594_0134198
696 Ga0495596_0017793
697 Ga0495583_0038384
698 Ga0495583_0243831
699 Ga0495583_0255721
700 Ga0495606_0004999
701 Ga0495606_0410754
702 Ga0495608_0026683
703 Ga0495610_0181047
704 Ga0495616_0050110
705 Ga0495618_0037473
706 Ga0495618_0083278
707 Ga0495620_0053830
708 Ga0495620_0068039
709 Ga0495628_0165896
710 Ga0495628_0294024
711 Ga0495630_0279991
712 Ga0495630_0281511
713 Ga0495631_0003558
714 Ga0495632_0075309
715 Ga0495637_0037016
716 Ga0495637_0162864
717 Ga0495644_0091854
718 Ga0495644_0137513
719 Ga0495648_0412533
720 Ga0495648_0448631
721 Ga0495666_0022175
722 Ga0495666_0134280
723 Ga0495652_0037607
724 Ga0495652_0045461
725 Ga0495654_0012238
726 Ga0495640_0042935
727 Ga0495640_0079904
728 Ga0495586_0248623
729 Ga0495586_0295407
730 Ga0495587_0004877
731 Ga0495587_0216725
732 Ga0495609_0022277
733 Ga0495597_0017132
734 Ga0495645_0006917
735 Ga0495645_0114622
736 Ga0495622_0045997
737 Ga0495622_0220491
738 Ga0495633_0005854
739 Ga0495633_0161213
740 Ga0495656_0209450
741 Ga0495668_0013932
742 Ga0495668_0311252
743 Ga0495634_0054339
744 Ga0495634_0060547
745 Ga0495634_0285695
746 Ga0495611_0043671
747 Ga0495611_0224797
748 Ga0495611_0391027
749 Ga0495625_0011317
750 Ga0495625_0118627
751 Ga0495625_0128737
752 Ga0495625_0421060
753 Ga0495635_0004210
754 Ga0495635_0066282
755 Ga0495661_0026300
756 Ga0495661_0151963
757 Ga0495661_0305512
758 Ga0495588_0000781
759 Ga0495588_0042715
760 Ga0495588_0242656
761 Ga0495588_0248177
762 Ga0495588_0475241
763 Ga0495588_0539474
764 Ga0495657_0008322
765 Ga0495657_0011980
766 Ga0495657_0230442
767 Ga0495599_0502928
768 Ga0495623_0637776
769 Ga0495646_0001196
770 Ga0495646_0206978
771 Ga0495613_0003624
772 Ga0495613_0012654
773 Ga0495613_0138543
774 Ga0495613_0165268
775 Ga0495613_0320635
776 Ga0495624_0077908
777 Ga0495624_0125758
778 Ga0495624_0546781
779 Ga0495670_0036055
780 Ga0495670_0114515
781 Ga0495671_0010678
782 Ga0495649_0059161
783 Ga0495649_0129953
784 Ga0495589_0012131
785 Ga0495589_0111783
786 Ga0495589_0128710
787 Ga0495589_0132998
788 Ga0495600_0034292
789 Ga0495600_0203271
790 Ga0495600_0404049
791 Ga0495660_0179270
792 Ga0495660_0273875
793 Ga0495581_0035597
794 Ga0495581_0052993
795 Ga0495581_0083029
796 Ga0495581_0122613
797 Ga0495604_0052569
798 Ga0495604_0426464
799 Ga0495636_0001844
800 Ga0495636_0025178
801 Ga0495636_0088489
802 Ga0495636_0095414
803 Ga0495636_0218584
804 Ga0495636_0300335
805 Ga0495636_0321579
806 Ga0495674_0042932
807 Ga0495674_0156422
808 Ga0495676_0132671
809 Ga0495676_0139810
810 Ga0495676_0158005
811 Ga0495676_0377535
812 Ga0495680_0506722
813 Ga0495680_0756330
814 Ga0495683_0022425
815 Ga0495683_0046460
816 Ga0495683_0156153
817 Ga0495687_001961
818 Ga0495687_010889
819 Ga0495687_136276
820 Ga0495687_230661
821 Ga0495675_0008278
822 Ga0495675_0051183
823 Ga0495675_0191168
824 Ga0495677_0012850
825 Ga0495679_070166
826 Ga0495685_009066
827 Ga0495685_019639
828 Ga0495685_021282
829 Ga0495685_022912
830 Ga0495685_039900
831 Ga0495685_047704
832 Ga0495685_050249
833 Ga0495685_078172
834 Ga0495685_080217
835 Ga0495681_0000977
836 Ga0495681_0025296
837 Ga0495681_0089640
838 Ga0495684_0183224
839 Ga0495686_0015711
840 Ga0495686_0025046
841 Ga0495593_0011674
842 Ga0495593_0059036
843 Ga0495602_0124474
844 Ga0495602_0259707
845 Ga0495614_0001133
846 Ga0495614_0101743
847 Ga0495615_0071213
848 Ga0495626_0082278
849 Ga0496102_0786412
850 Ga0496102_1105984
851 Ga0496104_1513041
852 Ga0496108_0402211
853 Ga0496109_0062693
854 Ga0496110_0937929
855 Ga0496111_0593480
856 Ga0496112_1429737
857 Ga0496125_0421749
858 Ga0495678_083572
859 Ga0495678_234340
860 Ga0495682_0012251
861 Ga0501031_0253961
862 Ga0501031_0665473
863 Ga0501032_0118816
864 Ga0501032_0140131
865 Ga0501032_0218364
866 Ga0501033_0001282
867 Ga0501033_0015075
868 Ga0501033_0016506
869 Ga0501033_0241513
870 Ga0501034_0021336
871 Ga0501034_0024979
872 Ga0501034_0034100
873 Ga0501034_0111860
874 Ga0501036_0001577
875 Ga0501036_0004558
876 Ga0501036_0316952
877 Ga0501036_0652189
878 Ga0501036_1132640
879 Ga0501037_0002052
880 Ga0501037_0029472
881 Ga0501037_0089835
882 Ga0501038_0100248
883 Ga0501038_0289307
884 Ga0501039_0521059
885 Ga0501039_0565074
886 Ga0501043_0058840
887 Ga0501043_0078032
888 Ga0501046_0072698
889 Ga0501046_0081496
890 Ga0501047_0013258
891 Ga0501047_0292979
892 Ga0501047_0331074
893 Ga0501047_0529908
894 Ga0501048_0145603
895 Ga0501048_0437512
896 Ga0501069_0634480
897 Ga0501072_0554344
898 Ga0501074_0942705
899 Ga0501076_1035935
900 Ga0501206_073684
901 Ga0501080_0439647
902 Ga0501035_0038322
903 Ga0501035_0141095
904 Ga0501035_0151111
905 Ga0501035_0201897
906 Ga0501035_0276773
907 Ga0501035_0466086
908 Ga0501035_0884569
909 Ga0501044_0003766
910 Ga0501044_0005505
911 Ga0501044_0024166
912 Ga0501044_0109153
913 Ga0501044_0222758
914 nmdc:mga03n38_239019_c1
915 nmdc:mga03n38_32875_c1
916 nmdc:mga06z11_68162_c1
917 Ga0495612_0279130
918 Ga0495655_0044964
919 Ga0495619_0439820
920 Ga0500578_0039979
921 Ga0500644_0014613
922 Ga0500647_0272489
923 Ga0500641_0020262
924 Ga0500650_0026702
925 Ga0500553_045732
926 Ga0500560_000463
927 Ga0500572_005113
928 Ga0500559_0302591
929 Ga0500573_0119960
930 Ga0500577_0189800
931 Ga0500600_0096668
932 Ga0500600_0328839
933 Ga0500624_003649
934 Ga0500565_033757
935 Ga0501082_0454110
936 Ga0466962_0000800
937 Ga0466962_0067193
938 8048128179
939 2547412909
940 2585302480
941 2585310340
942 2585319714
943 2616695463
944 2616905028
945 2643765551
946 2643945559
947 2644265239
948 2644388948
949 2644432405
950 2644436835
951 2644459664
952 2644628572
953 2644631011
954 2768647423
955 2784588304
956 2785343711
957 2785369116
958 2793978204
959 2808841731
960 2808920262
961 2809231918
962 2811848664
963 2812358521
964 2812480845
965 2819697791
966 2852637013
967 2862184384
968 2862285159
969 2862294304
970 2862509709
971 2862579532
972 2862705674
973 2867349651
974 2867371601
975 2867430783
976 2867475277
977 2875394215
978 2877681429
979 2912720406
980 2912760345
981 2918504201
982 2919475250
983 2935395104
984 2946067357
985 2946075616
986 2954007866
987 2954386573
988 2954697385
989 2954704886
990 2954716551
991 2954726496
992 2954735311
993 2954745421
994 2954754167
995 2954764395
996 2966602861
997 2990047252
998 2990067531
999 2997454459
1000 2997604069
1001 3006426982
1002 3006486501
1003 3006499769
1004 8008488286
1005 8008579146
1006 8023631156
1007 8025530255
1008 8025536788
1009 8033691029
1010 8047898378
1011 8048360516
1012 8048375341
1013 8048382864
1014 8056451261
1015 8056671471
1016 8056835340

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

66

138

0.92

PF05995

CDO_I

Cysteine dioxygenase type I

21

148

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fpz-assembly1.cif.gz_A-2 the structure of kdgf from yersinia enterocolitica with malonate bound in the active site. 0.9348 60 144
8hfb-assembly1.cif.gz_B evolved variant of quercetin 2,4-dioxygenase from bacillus subtilis 0.9307 69 143
3h9a-assembly1.cif.gz_A crystal structure of bacb, an enzyme involved in bacilysin synthesis, in triclinic form 0.9304 69 144
1y3t-assembly1.cif.gz_B crystal structure of yxag, a dioxygenase from bacillus subtilis 0.9303 69 143
2h0v-assembly1.cif.gz_B crystal structure of a putative quercetin 2,3-dioxygenase (yxag, bsu39980) from bacillus subtilis at 2.60 a resolution 0.9294 69 145
ID Description Score Start End Superfamily
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9343 61 143 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.93 69 143 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9276 60 144 2.60.120.10
2h0vB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9233 69 145 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9216 57 152 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A0C1IHP0-F1-model_v4 Cupin type-2 domain-containing protein 0.9641 68 145
AF-A0A3R9VHM8-F1-model_v4 deleted 0.9609 32 161
AF-A0A4Q1KLG7-F1-model_v4 Cupin domain-containing protein 0.9581 68 144
AF-B0C6M5-F1-model_v4 Mannose-6-phosphate isomerase 0.9565 60 143 GO:0004475
GO:0005976
GO:0009298
GO:0016853
AF-A0A3A0CGC9-F1-model_v4 Cupin domain-containing protein 0.9561 68 144

Map