F456903

General Info

Members Datasets Scaffolds Average Seq Length
508 318 1016 347

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2842888712|2842891817
Length 342
Sequence LGINYTDGFKATADEVLDLERAGLDIVFVPEAYSFDAVSALGYLAAKTERVQLASGILQIYTRTPTLTAMTAAGLDNVSDGRFILGLGASGPQVIEGFHGVKYDAPIGRTREIIEVCRKVWRRERLEHRGKFYQMPLTAEDGGTGLGKPLKLINHPVRADIPVLLAALGQKNVALAAEVANGWQPIFFLPEKAKDVWGDAVAEGKAKRDPALGELDVYAGPTLAIGENVDHLLGFVKPHLALYIGGMGAKGKNFYHTLATNYGYGAEADRIQELYLAGDKAAAAEVVPDELARNVSLIGPKGFVKERLAAFAEAGATVLNVAPIAEDSAGRVKQVEALRELL

Samples

Sample ID Description Type Environment
1 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
104 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
105 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
106 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
124 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
133 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
134 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
135 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
136 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
137 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
187 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
242 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
251 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
252 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
253 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
258 2508501039 Frankia saprophytica CN3 Isolate Nodule
259 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
260 2547132424 Nocardia nova SH22a Isolate Unclassified
261 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
262 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
263 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
264 2643221549 Agromyces sp. Root1464 Isolate Unclassified
265 2643221572 Leifsonia sp. Root60 Isolate Unclassified
266 2643221617 Nocardioides sp. Root79 Isolate Unclassified
267 2643221619 Agromyces sp. Root81 Isolate Unclassified
268 2643221620 Nocardioides sp. Root240 Isolate Unclassified
269 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
270 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
271 2643221692 Nocardia sp. Root136 Isolate Unclassified
272 2671180195 Frankia sp. CcI49 Isolate Nodule
273 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
274 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
275 2687453737 Frankia sp. BMG5.36 Isolate Nodule
276 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
277 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
278 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
279 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
280 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
281 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
282 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
283 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
284 2773857922 Frankia sp. CcI49 Isolate Nodule
285 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
286 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
287 2808606372 Agromyces sp. 23-23 Isolate Unclassified
288 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
289 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
290 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
291 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
292 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
293 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
294 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
295 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
296 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
297 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
298 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
299 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
300 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
301 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
302 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
303 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
304 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
305 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
306 2922554459 Rhodococcus sp. 66b Isolate Unclassified
307 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
308 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
309 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
310 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
311 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
312 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
313 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
314 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
315 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
316 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
317 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
318 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.2
Metatranscriptomes 0.59
Isolates 12.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.71
Nodule 1.18
Rhizoplane 6.69
Rhizosphere 74.02
Stem 0
Stem Tuber 0.2
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1000038 3300003792 Bacteria 161988
2 Ga0055540_1000975 3300003792 Bacteria 18482
3 Ga0055540_1005563 3300003792 Bacteria 5259
4 Ga0070658_10111047 3300005327 Bacteria 2271
5 Ga0070683_100234214 3300005329 Bacteria 1746
6 Ga0070666_10080584 3300005335 Bacteria 2225
7 Ga0070682_100045102 3300005337 Bacteria 2731
8 Ga0070668_100038770 3300005347 Bacteria 3643
9 Ga0070667_100003108 3300005367 Bacteria 14284
10 Ga0070667_100005061 3300005367 Bacteria 11035
11 Ga0070709_10019262 3300005434 Bacteria 3943
12 Ga0070714_100017152 3300005435 Bacteria 5863
13 Ga0070714_100042117 3300005435 Bacteria 3856
14 Ga0070714_100106443 3300005435 Bacteria 2478
15 Ga0070714_100128039 3300005435 Bacteria 2266
16 Ga0070714_100368904 3300005435 Bacteria 1351
17 Ga0070713_100039445 3300005436 Bacteria 3833
18 Ga0070713_100104751 3300005436 Bacteria 2456
19 Ga0070713_100320916 3300005436 Bacteria 1430
20 Ga0070710_10000611 3300005437 Bacteria 17012
21 Ga0070710_10004599 3300005437 Bacteria 6523
22 Ga0070711_100011617 3300005439 Bacteria 5473
23 Ga0070711_100020140 3300005439 Bacteria 4293
24 Ga0070663_100000266 3300005455 Bacteria 26287
25 Ga0070663_100136232 3300005455 Bacteria 1870
26 Ga0070706_100002685 3300005467 Bacteria 17812
27 Ga0070706_100027670 3300005467 Bacteria 5216
28 Ga0070706_100032736 3300005467 Bacteria 4796
29 Ga0070707_100000199 3300005468 Bacteria 60047
30 Ga0070707_100001332 3300005468 Bacteria 24324
31 Ga0070707_100004647 3300005468 Bacteria 12854
32 Ga0070707_100065369 3300005468 Bacteria 3493
33 Ga0070707_100073141 3300005468 Bacteria 3305
34 Ga0070698_100000223 3300005471 Bacteria 55997
35 Ga0070698_100000264 3300005471 Bacteria 52985
36 Ga0070698_100001732 3300005471 Bacteria 24325
37 Ga0070698_100028899 3300005471 Bacteria 5756
38 Ga0070699_100148248 3300005518 Bacteria 2074
39 Ga0070684_100050391 3300005535 Bacteria 3616
40 Ga0070697_100059980 3300005536 Bacteria 3100
41 Ga0068853_100064059 3300005539 Bacteria 3186
42 Ga0070696_100058066 3300005546 Bacteria 2702
43 Ga0068856_100025195 3300005614 Bacteria 5796
44 Ga0068859_100481729 3300005617 Bacteria 1336
45 Ga0068864_100045142 3300005618 Bacteria 3780
46 Ga0068866_10035376 3300005718 Bacteria 2439
47 Ga0068863_100076534 3300005841 Bacteria 3165
48 Ga0081455_10000025 3300005937 Bacteria 157583
49 Ga0081455_10015602 3300005937 Bacteria 7373
50 Ga0081455_10039445 3300005937 Bacteria 4173
51 Ga0081455_10164994 3300005937 Bacteria 1693
52 Ga0081538_10060846 3300005981 Bacteria 2167
53 Ga0070717_10002214 3300006028 Bacteria 13665
54 Ga0070717_10009466 3300006028 Bacteria 7325
55 Ga0070717_10155739 3300006028 Bacteria 1979
56 Ga0075365_10007904 3300006038 Bacteria 5992
57 Ga0075365_10189846 3300006038 Bacteria 1438
58 Ga0075363_100001381 3300006048 Bacteria 9151
59 Ga0075364_10001646 3300006051 Bacteria 12265
60 Ga0075364_10037090 3300006051 Bacteria 3154
61 Ga0070715_10000727 3300006163 Bacteria 8894
62 Ga0070715_10066829 3300006163 Bacteria 1595
63 Ga0070716_100004229 3300006173 Bacteria 6834
64 Ga0070716_100009642 3300006173 Bacteria 4817
65 Ga0070716_100010061 3300006173 Bacteria 4732
66 Ga0070712_100005276 3300006175 Bacteria 7995
67 Ga0070712_100117055 3300006175 Bacteria 1999
68 Ga0070712_100159973 3300006175 Bacteria 1738
69 Ga0075362_10037121 3300006177 Bacteria 2135
70 Ga0075367_10000416 3300006178 Bacteria 15750
71 Ga0075369_10004658 3300006186 Bacteria 5086
72 Ga0075369_10013900 3300006186 Bacteria 3206
73 Ga0097621_100148565 3300006237 Bacteria 2008
74 Ga0075370_10043069 3300006353 Bacteria 2551
75 Ga0075370_10046590 3300006353 Bacteria 2454
76 Ga0075428_100000419 3300006844 Bacteria 42277
77 Ga0075428_100014964 3300006844 Bacteria 8622
78 Ga0075431_100409879 3300006847 Bacteria 1355
79 Ga0075433_10005623 3300006852 Bacteria 9854
80 Ga0075434_100010037 3300006871 Bacteria 8866
81 Ga0075436_100168017 3300006914 Bacteria 1548
82 Ga0097620_100481684 3300006931 Bacteria 1336
83 Ga0075435_100058691 3300007076 Bacteria 3117
84 Ga0105245_10310846 3300009098 Bacteria 1549
85 Ga0114129_10082223 3300009147 Bacteria 4476
86 Ga0105243_10013615 3300009148 Bacteria 6152
87 Ga0105241_10134989 3300009174 Bacteria 2002
88 Ga0105242_10139931 3300009176 Bacteria 2099
89 Ga0105248_10000039 3300009177 Bacteria 179700
90 Ga0105248_10411083 3300009177 Bacteria 1523
91 Ga0105237_10089925 3300009545 Bacteria 3060
92 Ga0105249_10041750 3300009553 Bacteria 4170
93 Ga0105239_10024667 3300010375 Bacteria 6624
94 Ga0105239_10043347 3300010375 Bacteria 4931
95 Ga0157369_10178110 3300013105 Bacteria 2238
96 Ga0157374_10124498 3300013296 Bacteria 2491
97 Ga0163162_10570268 3300013306 Bacteria 1259
98 Ga0157375_10373906 3300013308 Bacteria 1591
99 Ga0163163_10068860 3300014325 Bacteria 3522
100 Ga0157380_10120126 3300014326 Bacteria 2225
101 Ga0157379_10008303 3300014968 Bacteria 9024
102 Ga0206356_11597841 3300020070 Bacteria 1298
103 Ga0213876_10001381 3300021384 Bacteria 15159
104 Ga0213875_10041900 3300021388 Bacteria 2153
105 Ga0224712_10008805 3300022467 Bacteria 3010
106 Ga0224712_10084634 3300022467 Bacteria 1316
107 Ga0209051_1000014 3300025303 Bacteria 552732
108 Ga0209051_1001226 3300025303 Bacteria 23070
109 Ga0209051_1003054 3300025303 Bacteria 11323
110 Ga0207692_10003927 3300025898 Bacteria 5835
111 Ga0207692_10011680 3300025898 Bacteria 3747
112 Ga0207692_10035403 3300025898 Bacteria 2425
113 Ga0207692_10048745 3300025898 Bacteria 2134
114 Ga0207642_10041102 3300025899 Bacteria 2022
115 Ga0207680_10087731 3300025903 Bacteria 1971
116 Ga0207685_10006538 3300025905 Bacteria 3182
117 Ga0207699_10000610 3300025906 Bacteria 17490
118 Ga0207699_10002485 3300025906 Bacteria 8701
119 Ga0207699_10061539 3300025906 Bacteria 2259
120 Ga0207684_10001106 3300025910 Bacteria 30154
121 Ga0207684_10045208 3300025910 Bacteria 3736
122 Ga0207684_10305570 3300025910 Bacteria 1371
123 Ga0207671_10009553 3300025914 Bacteria 8093
124 Ga0207693_10007904 3300025915 Bacteria 8736
125 Ga0207693_10008472 3300025915 Bacteria 8414
126 Ga0207693_10021219 3300025915 Bacteria 5162
127 Ga0207693_10123797 3300025915 Bacteria 2032
128 Ga0207663_10005467 3300025916 Bacteria 6400
129 Ga0207663_10016022 3300025916 Bacteria 4148
130 Ga0207660_10139046 3300025917 Bacteria 1855
131 Ga0207657_10074422 3300025919 Bacteria 2868
132 Ga0207657_10170043 3300025919 Bacteria 1766
133 Ga0207652_10080147 3300025921 Bacteria 2853
134 Ga0207646_10000278 3300025922 Bacteria 70066
135 Ga0207646_10002274 3300025922 Bacteria 22856
136 Ga0207646_10036214 3300025922 Bacteria 4455
137 Ga0207646_10049115 3300025922 Bacteria 3780
138 Ga0207700_10006157 3300025928 Bacteria 7228
139 Ga0207700_10031151 3300025928 Bacteria 3785
140 Ga0207700_10176400 3300025928 Bacteria 1786
141 Ga0207700_10263373 3300025928 Bacteria 1477
142 Ga0207664_10001479 3300025929 Bacteria 15414
143 Ga0207664_10015079 3300025929 Bacteria 5598
144 Ga0207664_10068871 3300025929 Bacteria 2844
145 Ga0207664_10073149 3300025929 Bacteria 2765
146 Ga0207664_10156245 3300025929 Bacteria 1942
147 Ga0207664_10189834 3300025929 Bacteria 1768
148 Ga0207709_10140663 3300025935 Bacteria 1658
149 Ga0207665_10000215 3300025939 Bacteria 38950
150 Ga0207665_10005165 3300025939 Bacteria 8719
151 Ga0207665_10022901 3300025939 Bacteria 4112
152 Ga0207691_10075207 3300025940 Bacteria 3045
153 Ga0207711_10000151 3300025941 Bacteria 74004
154 Ga0207667_10313195 3300025949 Bacteria 1603
155 Ga0207668_10125096 3300025972 Bacteria 1953
156 Ga0207668_10288867 3300025972 Bacteria 1348
157 Ga0207658_10012940 3300025986 Bacteria 5699
158 Ga0207658_10014679 3300025986 Bacteria 5367
159 Ga0207639_10152738 3300026041 Bacteria 1936
160 Ga0207678_10000248 3300026067 Bacteria 48560
161 Ga0207678_10052626 3300026067 Bacteria 3511
162 Ga0207678_10155857 3300026067 Bacteria 1950
163 Ga0207678_10193581 3300026067 Bacteria 1738
164 Ga0207702_10018644 3300026078 Bacteria 5741
165 Ga0207702_10054241 3300026078 Bacteria 3396
166 Ga0207648_10033321 3300026089 Bacteria 4543
167 Ga0207674_10100862 3300026116 Bacteria 2868
168 Ga0207674_10357429 3300026116 Bacteria 1412
169 Ga0207675_100063668 3300026118 Bacteria 3446
170 Ga0268266_10088449 3300028379 Bacteria 2711
171 Ga0268265_10102041 3300028380 Bacteria 2319
172 Ga0265336_10003410 3300028666 Bacteria 6233
173 Ga0307515_10084358 3300028794 Bacteria 4081
174 Ga0265338_10000827 3300028800 Bacteria 52237
175 Ga0265327_10000230 3300031251 Bacteria 113245
176 Ga0265327_10069115 3300031251 Bacteria 1774
177 Ga0265327_10088844 3300031251 Bacteria 1511
178 Ga0316576_10002574 3300031727 Bacteria 10362
179 Ga0316578_10006282 3300031728 Bacteria 5848
180 Ga0316577_10065133 3300031733 Bacteria 2034
181 Ga0307518_10000573 3300031838 Bacteria 27956
182 Ga0307518_10151040 3300031838 Bacteria 1607
183 Ga0307415_100237238 3300032126 Bacteria 1473
184 Ga0307507_10006423 3300033179 Bacteria 18062
185 Ga0307510_10215208 3300033180 Bacteria 1439
186 Ga0373944_0074400 3300035089 Bacteria 1112
187 Ga0373936_0000285 3300035113 Bacteria 16957
188 Ga0373953_0020659 3300035117 Bacteria 2461
189 Ga0373953_0040769 3300035117 Bacteria 1845
190 Ga0373954_0018548 3300035118 Bacteria 3133
191 Ga0373956_0085877 3300035119 Bacteria 1447
192 Ga0373957_0028677 3300035120 Bacteria 2030
193 Ga0373955_0045951 3300035172 Bacteria 2358
194 Ga0373955_0176496 3300035172 Bacteria 1266
195 Ga0316574_0001504 3300035398 Bacteria 11109
196 Ga0373924_0002011 3300035410 Bacteria 6767
197 Ga0373935_0219357 3300035692 Bacteria 1320
198 Ga0373933_0011217 3300035724 Bacteria 4932
199 Ga0373933_0098627 3300035724 Bacteria 1810
200 Ga0373947_0021646 3300035725 Bacteria 3723
201 Ga0373947_0044156 3300035725 Bacteria 2663
202 Ga0373937_0032649 3300036401 Bacteria 4722
203 Ga0373937_0099383 3300036401 Bacteria 2699
204 Ga0316582_0014494 3300036647 Bacteria 4474
205 Ga0316584_0064378 3300036712 Bacteria 2745
206 Ga0373925_0000010 3300037068 Bacteria 229059
207 Ga0373925_0028659 3300037068 Bacteria 4079
208 Ga0373925_0037211 3300037068 Bacteria 3592
209 Ga0373925_0080829 3300037068 Bacteria 2471
210 Ga0395900_0317265 3300037418 Bacteria 1540
211 Ga0395898_0013793 3300037466 Bacteria 8308
212 Ga0436364_0388460 3300037853 Bacteria 5974
213 Ga0436364_0901183 3300037853 Bacteria 3635
214 Ga0395901_0117819 3300038443 Bacteria 2790
215 Ga0436365_0484364 3300039437 Bacteria 53953
216 Ga0436365_0628342 3300039437 Bacteria 21312
217 Ga0436365_1626427 3300039437 Bacteria 29734
218 Ga0451853_2668301 3300041512 Bacteria 4179
219 Ga0439443_005390 3300042003 Bacteria 1708
220 Ga0439448_0017863 3300042005 Bacteria 2169
221 Ga0439454_001256 3300042011 Bacteria 2381
222 Ga0439446_0066181 3300042156 Bacteria 1099
223 Ga0439464_0027140 3300042439 Bacteria 1591
224 Ga0439460_0005131 3300042461 Bacteria 3206
225 Ga0466969_0041255 3300044656 Bacteria 2310
226 Ga0466972_0002507 3300044658 Bacteria 9076
227 Ga0466965_0000767 3300044683 Bacteria 12094
228 Ga0466965_0001962 3300044683 Bacteria 8607
229 Ga0466965_0084305 3300044683 Bacteria 1610
230 Ga0466966_0077432 3300044684 Bacteria 2075
231 Ga0466961_0024253 3300044693 Bacteria 3902
232 Ga0466963_0062940 3300044694 Bacteria 2482
233 Ga0466963_0093696 3300044694 Bacteria 2048
234 Ga0466964_0035364 3300044706 Bacteria 1997
235 Ga0466964_0078773 3300044706 Bacteria 1410
236 Ga0466957_0023741 3300044842 Bacteria 3627
237 Ga0466957_0039050 3300044842 Bacteria 2863
238 Ga0466957_0187709 3300044842 Bacteria 1353
239 Ga0466960_0000734 3300044901 Bacteria 11469
240 Ga0466960_0085849 3300044901 Bacteria 1595
241 Ga0466959_0045583 3300045049 Bacteria 3228
242 Ga0466959_0113874 3300045049 Bacteria 1928
243 Ga0466958_0167574 3300045836 Bacteria 1390
244 Ga0466967_0000535 3300045976 Bacteria 18445
245 Ga0466967_0013718 3300045976 Bacteria 6278
246 Ga0466967_0021916 3300045976 Bacteria 5200
247 Ga0466967_0039513 3300045976 Bacteria 4057
248 Ga0466967_0041779 3300045976 Bacteria 3957
249 Ga0466967_0130476 3300045976 Bacteria 2332
250 Ga0466967_0360532 3300045976 Bacteria 1408
251 Ga0495592_0010367 3300046454 Bacteria 7029
252 Ga0495629_0000784 3300046459 Bacteria 25630
253 Ga0495641_0117985 3300046461 Bacteria 1183
254 Ga0495651_0047479 3300046462 Bacteria 3319
255 Ga0495651_0098157 3300046462 Bacteria 2186
256 Ga0495653_0001916 3300046463 Bacteria 16400
257 Ga0495653_0075381 3300046463 Bacteria 2510
258 Ga0495582_0027247 3300046473 Bacteria 3131
259 Ga0495639_0009415 3300046475 Bacteria 4189
260 Ga0495662_0003615 3300046476 Bacteria 7800
261 Ga0495662_0015682 3300046476 Bacteria 3678
262 Ga0495664_0053239 3300046477 Bacteria 2406
263 Ga0495608_0008626 3300046511 Bacteria 7137
264 Ga0495618_0107487 3300046514 Bacteria 1787
265 Ga0495628_0058648 3300046516 Bacteria 3023
266 Ga0495628_0067189 3300046516 Bacteria 2800
267 Ga0495628_0102115 3300046516 Bacteria 2212
268 Ga0495630_0048213 3300046517 Bacteria 3187
269 Ga0495652_0018219 3300046529 Bacteria 6264
270 Ga0495652_0147335 3300046529 Bacteria 1843
271 Ga0495665_0002081 3300046531 Bacteria 10838
272 Ga0495640_0018526 3300046533 Bacteria 5158
273 Ga0495640_0030181 3300046533 Bacteria 3884
274 Ga0495640_0122372 3300046533 Bacteria 1690
275 Ga0495586_0023192 3300046535 Bacteria 3313
276 Ga0495586_0036854 3300046535 Bacteria 2625
277 Ga0495587_0004107 3300046536 Bacteria 9633
278 Ga0495587_0037837 3300046536 Bacteria 2894
279 Ga0495645_0051591 3300046543 Bacteria 2992
280 Ga0495645_0080700 3300046543 Bacteria 2334
281 Ga0495645_0087011 3300046543 Bacteria 2235
282 Ga0495645_0155901 3300046543 Bacteria 1582
283 Ga0495667_0001290 3300046559 Bacteria 16417
284 Ga0495667_0090340 3300046559 Bacteria 1984
285 Ga0495668_0000928 3300046616 Bacteria 32719
286 Ga0495634_0010662 3300046642 Bacteria 6728
287 Ga0495634_0019607 3300046642 Bacteria 4804
288 Ga0495625_0115039 3300046660 Bacteria 1836
289 Ga0495635_0008641 3300046663 Bacteria 7110
290 Ga0495635_0056355 3300046663 Bacteria 2706
291 Ga0495635_0099765 3300046663 Bacteria 1984
292 Ga0495657_0004735 3300046675 Bacteria 10841
293 Ga0495657_0008845 3300046675 Bacteria 7667
294 Ga0495599_0045024 3300046678 Bacteria 2766
295 Ga0495599_0075167 3300046678 Bacteria 2109
296 Ga0495623_0002864 3300046679 Bacteria 11378
297 Ga0495623_0054610 3300046679 Bacteria 2519
298 Ga0495647_0050713 3300046681 Bacteria 1611
299 Ga0495658_0001706 3300046683 Bacteria 11419
300 Ga0495624_0035572 3300046690 Bacteria 3215
301 Ga0495600_0013002 3300046809 Bacteria 5219
302 Ga0495600_0186264 3300046809 Bacteria 1336
303 Ga0495581_0023847 3300047315 Bacteria 3545
304 Ga0495581_0078192 3300047315 Bacteria 1914
305 Ga0495604_0018973 3300047317 Bacteria 5507
306 Ga0495636_0011132 3300047318 Bacteria 3558
307 Ga0495674_0105781 3300047319 Bacteria 2390
308 Ga0495674_0133485 3300047319 Bacteria 2090
309 Ga0495680_0002183 3300047322 Bacteria 20250
310 Ga0495680_0023048 3300047322 Bacteria 5181
311 Ga0495683_0034974 3300047323 Bacteria 2553
312 Ga0495687_000504 3300047443 Bacteria 47007
313 Ga0495687_002167 3300047443 Bacteria 16359
314 Ga0495675_0011443 3300047444 Bacteria 5570
315 Ga0495675_0014656 3300047444 Bacteria 4953
316 Ga0495684_0023021 3300047471 Bacteria 4791
317 Ga0495684_0289450 3300047471 Bacteria 1179
318 Ga0495593_0002162 3300047673 Bacteria 11754
319 Ga0495602_0137505 3300048088 Bacteria 1938
320 Ga0495602_0190094 3300048088 Bacteria 1575
321 Ga0495614_0041156 3300048089 Bacteria 1982
322 Ga0496100_0003143 3300048903 Bacteria 8556
323 Ga0496101_0000034 3300048904 Bacteria 178045
324 Ga0496102_0023068 3300048905 Bacteria 5523
325 Ga0496102_0024636 3300048905 Bacteria 5350
326 Ga0496102_0261258 3300048905 Bacteria 1632
327 Ga0496103_0001309 3300048906 Bacteria 16928
328 Ga0496103_0042838 3300048906 Bacteria 2786
329 Ga0496104_0000813 3300048907 Bacteria 26826
330 Ga0496105_0018963 3300048908 Bacteria 5542
331 Ga0496106_0007992 3300048909 Bacteria 7816
332 Ga0496106_0028375 3300048909 Bacteria 4169
333 Ga0496107_0000203 3300048910 Bacteria 31208
334 Ga0496107_0037232 3300048910 Bacteria 3491
335 Ga0496107_0236312 3300048910 Bacteria 1360
336 Ga0496108_0029437 3300048911 Bacteria 4547
337 Ga0496108_0083919 3300048911 Bacteria 2703
338 Ga0496108_0141958 3300048911 Bacteria 2069
339 Ga0496109_0000204 3300048912 Bacteria 58449
340 Ga0496109_0003659 3300048912 Bacteria 12848
341 Ga0496110_0049962 3300048913 Bacteria 3671
342 Ga0496110_0201203 3300048913 Bacteria 1810
343 Ga0496110_0352522 3300048913 Bacteria 1340
344 Ga0496111_0071033 3300048914 Bacteria 2533
345 Ga0496112_0000555 3300048915 Bacteria 25563
346 Ga0496112_0031404 3300048915 Bacteria 5152
347 Ga0496112_0063701 3300048915 Bacteria 3637
348 Ga0496113_0107443 3300048916 Bacteria 2168
349 Ga0496114_0000081 3300048917 Bacteria 68644
350 Ga0496114_0035527 3300048917 Bacteria 4116
351 Ga0496114_0077604 3300048917 Bacteria 2801
352 Ga0496115_0031019 3300048918 Bacteria 4210
353 Ga0496115_0116653 3300048918 Bacteria 2196
354 Ga0496115_0320927 3300048918 Bacteria 1267
355 Ga0496116_0008543 3300048919 Bacteria 8871
356 Ga0496117_0045145 3300048920 Bacteria 3186
357 Ga0496117_0115078 3300048920 Bacteria 1665
358 Ga0496118_0000029 3300048921 Bacteria 340978
359 Ga0496118_0011661 3300048921 Bacteria 8548
360 Ga0496119_0028378 3300048922 Bacteria 3819
361 Ga0496121_0000048 3300048924 Bacteria 330242
362 Ga0496122_0000234 3300048925 Bacteria 125042
363 Ga0496123_0034318 3300048926 Bacteria 3636
364 Ga0496124_0000044 3300048927 Bacteria 289064
365 Ga0496125_0000037 3300048928 Bacteria 330242
366 Ga0496125_0085204 3300048928 Bacteria 2395
367 Ga0496126_0000046 3300048929 Bacteria 330242
368 Ga0496126_0003377 3300048929 Bacteria 20229
369 Ga0496126_0031270 3300048929 Bacteria 5032
370 Ga0501032_0006489 3300049569 Bacteria 8602
371 Ga0501032_0016330 3300049569 Bacteria 5224
372 Ga0501032_0043417 3300049569 Bacteria 3045
373 Ga0501032_0092208 3300049569 Bacteria 2009
374 Ga0501033_0023503 3300049570 Bacteria 4648
375 Ga0501033_0059933 3300049570 Bacteria 2810
376 Ga0501033_0129444 3300049570 Bacteria 1829
377 Ga0501034_0004653 3300049571 Bacteria 15198
378 Ga0501034_0005708 3300049571 Bacteria 13528
379 Ga0501034_0036548 3300049571 Bacteria 4975
380 Ga0501034_0107424 3300049571 Bacteria 2783
381 Ga0501034_0193254 3300049571 Bacteria 1996
382 Ga0501036_0000170 3300049572 Bacteria 42985
383 Ga0501036_0073039 3300049572 Bacteria 2900
384 Ga0501037_0010663 3300049573 Bacteria 6755
385 Ga0501037_0015892 3300049573 Bacteria 5542
386 Ga0501037_0121342 3300049573 Bacteria 1879
387 Ga0501038_0014458 3300049574 Bacteria 7193
388 Ga0501038_0066887 3300049574 Bacteria 3059
389 Ga0501038_0101204 3300049574 Bacteria 2399
390 Ga0501039_0000397 3300049575 Bacteria 31220
391 Ga0501039_0090338 3300049575 Bacteria 2387
392 Ga0501042_0009627 3300049578 Bacteria 6453
393 Ga0501043_0000648 3300049579 Bacteria 30700
394 Ga0501043_0016153 3300049579 Bacteria 5854
395 Ga0501043_0071771 3300049579 Bacteria 2719
396 Ga0501046_0010264 3300049580 Bacteria 8061
397 Ga0501046_0060443 3300049580 Bacteria 2965
398 Ga0501047_0028002 3300049581 Bacteria 5430
399 Ga0501047_0064735 3300049581 Bacteria 3526
400 Ga0501047_0165686 3300049581 Bacteria 2080
401 Ga0501048_0001538 3300049582 Bacteria 17507
402 Ga0501048_0019610 3300049582 Bacteria 4959
403 Ga0501067_0071945 3300049583 Bacteria 1915
404 Ga0501067_0106650 3300049583 Bacteria 1557
405 Ga0501069_0022820 3300049585 Bacteria 3408
406 Ga0501070_0000667 3300049586 Bacteria 31628
407 Ga0501070_0001833 3300049586 Bacteria 18733
408 Ga0501070_0200595 3300049586 Bacteria 1638
409 Ga0501071_0015643 3300049587 Bacteria 5209
410 Ga0501073_0004676 3300049589 Bacteria 10285
411 Ga0501073_0047110 3300049589 Bacteria 3030
412 Ga0501074_0000484 3300049590 Bacteria 24222
413 Ga0501080_0021751 3300049742 Bacteria 5942
414 Ga0501080_0036493 3300049742 Bacteria 4587
415 Ga0501083_0003934 3300049744 Bacteria 10436
416 Ga0501035_0002727 3300049822 Bacteria 17136
417 Ga0501035_0004807 3300049822 Bacteria 12802
418 Ga0501035_0021895 3300049822 Bacteria 5871
419 Ga0501044_0000425 3300049823 Bacteria 52201
420 Ga0501044_0000982 3300049823 Bacteria 34265
421 Ga0501044_0017081 3300049823 Bacteria 7787
422 Ga0501044_0019136 3300049823 Bacteria 7330
423 Ga0501044_0057046 3300049823 Bacteria 4008
424 nmdc:mga03683_24799_c1 3300050489 Bacteria 2349
425 nmdc:mga03n38_100172_c1 3300050490 Bacteria 1396
426 nmdc:mga00v17_28625_c1 3300050491 Bacteria 3264
427 nmdc:mga00v17_30514_c1 3300050491 Bacteria 3173
428 nmdc:mga00v17_9573_c1 3300050491 Bacteria 5249
429 nmdc:mga0yw44_57174_c1 3300050492 Bacteria 2379
430 nmdc:mga07m45_26976_c1 3300050496 Bacteria 2472
431 nmdc:mga07m45_3325_c2 3300050496 Bacteria 7311
432 nmdc:mga06r32_263_c3 3300050510 Bacteria 11424
433 nmdc:mga0n895_8441_c1 3300050512 Bacteria 8919
434 nmdc:mga08x19_43027_c1 3300050514 Bacteria 2881
435 nmdc:mga0a205_132603_c1 3300050515 Bacteria 2392
436 nmdc:mga0sz30_12649_c1 3300050516 Bacteria 3286
437 nmdc:mga0sz30_36337_c1 3300050516 Bacteria 2059
438 nmdc:mga0sz30_43565_c1 3300050516 Bacteria 1889
439 Ga0495601_0002571 3300053077 Bacteria 10315
440 Ga0495601_0094776 3300053077 Bacteria 1924
441 Ga0495612_0001928 3300053078 Bacteria 8537
442 Ga0495612_0003769 3300053078 Bacteria 6305
443 Ga0495595_0013582 3300053084 Bacteria 3442
444 Ga0495619_0043559 3300053085 Bacteria 2943
445 Ga0500616_0005275 3300053153 Bacteria 8833
446 Ga0501084_0010802 3300054114 Bacteria 7560
447 2842891817 2842888712 Bacteria 4279094
448 2508673715 2508501039 Bacteria 9978592
449 2523385088 2523231044 Bacteria 6434991
450 2548695537 2547132424 Bacteria 8348532
451 2552108661 2551306166 Bacteria 9731570
452 2566992213 2565956761 Bacteria 6601618
453 2586059638 2585427649 Bacteria 9053857
454 2643768488 2643221549 Bacteria 4042819
455 2643876315 2643221572 Bacteria 3614809
456 2644100820 2643221617 Bacteria 5139111
457 2644111860 2643221619 Bacteria 4158469
458 2644117228 2643221620 Bacteria 5134593
459 2644383370 2643221669 Bacteria 3611286
460 2644489737 2643221687 Bacteria 6500351
461 2644512262 2643221692 Bacteria 7282860
462 2671833305 2671180195 Bacteria 9757215
463 2676201494 2675902999 Bacteria 9438463
464 2676487912 2675903060 Bacteria 10051191
465 2689964479 2687453737 Bacteria 11203906
466 2738664608 2738541264 Bacteria 5935393
467 2738888394 2738541308 Bacteria 7020677
468 2739143743 2738541356 Bacteria 5935017
469 2739204262 2738543005 Bacteria 5278128
470 2739240136 2738543011 Bacteria 5731169
471 2739363042 2738543034 Bacteria 6084756
472 2744956917 2744054611 Bacteria 5611514
473 2774846070 2773857921 Bacteria 9435764
474 2774851461 2773857922 Bacteria 9757215
475 2793977603 2791355406 Bacteria 11364898
476 2795784930 2795385470 Bacteria 8317180
477 2808901179 2808606372 Bacteria 4649509
478 2809591593 2808606522 Bacteria 9488490
479 2866557043 2866552031 Bacteria 5824618
480 2873320803 2873314349 Bacteria 8512634
481 2884697561 2884693830 Bacteria 11273186
482 2889303379 2889300758 Bacteria 5690814
483 2895438122 2895427314 Bacteria 13147766
484 2895447644 2895442618 Bacteria 11027144
485 2895660495 2895660088 Bacteria 3782833
486 2899361936 2899359706 Bacteria 10940472
487 2899376326 2899370129 Bacteria 6781179
488 2904766096 2904765812 Bacteria 5369154
489 2904773412 2904770941 Bacteria 5580202
490 2908812140 2908811453 Bacteria 5478616
491 2915772888 2915768154 Bacteria 8424322
492 2917744685 2917736166 Bacteria 9690793
493 2919421477 2919420072 Bacteria 5390363
494 2919432765 2919432681 Bacteria 5390474
495 2919714359 2919713450 Bacteria 7431245
496 2922557148 2922554459 Bacteria 6683962
497 2928145152 2928142448 Bacteria 5288925
498 2932400347 2932398195 Bacteria 3847976
499 2939748573 2939743619 Bacteria 5762299
500 3003001737 3002998708 Bacteria 11715108
501 8003318622 8003314358 Bacteria 10575343
502 8046353668 8046352972 Bacteria 3613806
503 8047903135 8047893842 Bacteria 11723082
504 8048379424 8048369669 Bacteria 11666822
505 8048389979 8048379754 Bacteria 11877923
506 8053947334 8053945823 Bacteria 8962862
507 8055067357 8055066027 Bacteria 9479577
508 8055179748 8055172936 Bacteria 9305943
509 Ga0055540_1000038
510 Ga0055540_1000975
511 Ga0055540_1005563
512 Ga0070658_10111047
513 Ga0070683_100234214
514 Ga0070666_10080584
515 Ga0070682_100045102
516 Ga0070668_100038770
517 Ga0070667_100003108
518 Ga0070667_100005061
519 Ga0070709_10019262
520 Ga0070714_100017152
521 Ga0070714_100042117
522 Ga0070714_100106443
523 Ga0070714_100128039
524 Ga0070714_100368904
525 Ga0070713_100039445
526 Ga0070713_100104751
527 Ga0070713_100320916
528 Ga0070710_10000611
529 Ga0070710_10004599
530 Ga0070711_100011617
531 Ga0070711_100020140
532 Ga0070663_100000266
533 Ga0070663_100136232
534 Ga0070706_100002685
535 Ga0070706_100027670
536 Ga0070706_100032736
537 Ga0070707_100000199
538 Ga0070707_100001332
539 Ga0070707_100004647
540 Ga0070707_100065369
541 Ga0070707_100073141
542 Ga0070698_100000223
543 Ga0070698_100000264
544 Ga0070698_100001732
545 Ga0070698_100028899
546 Ga0070699_100148248
547 Ga0070684_100050391
548 Ga0070697_100059980
549 Ga0068853_100064059
550 Ga0070696_100058066
551 Ga0068856_100025195
552 Ga0068859_100481729
553 Ga0068864_100045142
554 Ga0068866_10035376
555 Ga0068863_100076534
556 Ga0081455_10000025
557 Ga0081455_10015602
558 Ga0081455_10039445
559 Ga0081455_10164994
560 Ga0081538_10060846
561 Ga0070717_10002214
562 Ga0070717_10009466
563 Ga0070717_10155739
564 Ga0075365_10007904
565 Ga0075365_10189846
566 Ga0075363_100001381
567 Ga0075364_10001646
568 Ga0075364_10037090
569 Ga0070715_10000727
570 Ga0070715_10066829
571 Ga0070716_100004229
572 Ga0070716_100009642
573 Ga0070716_100010061
574 Ga0070712_100005276
575 Ga0070712_100117055
576 Ga0070712_100159973
577 Ga0075362_10037121
578 Ga0075367_10000416
579 Ga0075369_10004658
580 Ga0075369_10013900
581 Ga0097621_100148565
582 Ga0075370_10043069
583 Ga0075370_10046590
584 Ga0075428_100000419
585 Ga0075428_100014964
586 Ga0075431_100409879
587 Ga0075433_10005623
588 Ga0075434_100010037
589 Ga0075436_100168017
590 Ga0097620_100481684
591 Ga0075435_100058691
592 Ga0105245_10310846
593 Ga0114129_10082223
594 Ga0105243_10013615
595 Ga0105241_10134989
596 Ga0105242_10139931
597 Ga0105248_10000039
598 Ga0105248_10411083
599 Ga0105237_10089925
600 Ga0105249_10041750
601 Ga0105239_10024667
602 Ga0105239_10043347
603 Ga0157369_10178110
604 Ga0157374_10124498
605 Ga0163162_10570268
606 Ga0157375_10373906
607 Ga0163163_10068860
608 Ga0157380_10120126
609 Ga0157379_10008303
610 Ga0206356_11597841
611 Ga0213876_10001381
612 Ga0213875_10041900
613 Ga0224712_10008805
614 Ga0224712_10084634
615 Ga0209051_1000014
616 Ga0209051_1001226
617 Ga0209051_1003054
618 Ga0207692_10003927
619 Ga0207692_10011680
620 Ga0207692_10035403
621 Ga0207692_10048745
622 Ga0207642_10041102
623 Ga0207680_10087731
624 Ga0207685_10006538
625 Ga0207699_10000610
626 Ga0207699_10002485
627 Ga0207699_10061539
628 Ga0207684_10001106
629 Ga0207684_10045208
630 Ga0207684_10305570
631 Ga0207671_10009553
632 Ga0207693_10007904
633 Ga0207693_10008472
634 Ga0207693_10021219
635 Ga0207693_10123797
636 Ga0207663_10005467
637 Ga0207663_10016022
638 Ga0207660_10139046
639 Ga0207657_10074422
640 Ga0207657_10170043
641 Ga0207652_10080147
642 Ga0207646_10000278
643 Ga0207646_10002274
644 Ga0207646_10036214
645 Ga0207646_10049115
646 Ga0207700_10006157
647 Ga0207700_10031151
648 Ga0207700_10176400
649 Ga0207700_10263373
650 Ga0207664_10001479
651 Ga0207664_10015079
652 Ga0207664_10068871
653 Ga0207664_10073149
654 Ga0207664_10156245
655 Ga0207664_10189834
656 Ga0207709_10140663
657 Ga0207665_10000215
658 Ga0207665_10005165
659 Ga0207665_10022901
660 Ga0207691_10075207
661 Ga0207711_10000151
662 Ga0207667_10313195
663 Ga0207668_10125096
664 Ga0207668_10288867
665 Ga0207658_10012940
666 Ga0207658_10014679
667 Ga0207639_10152738
668 Ga0207678_10000248
669 Ga0207678_10052626
670 Ga0207678_10155857
671 Ga0207678_10193581
672 Ga0207702_10018644
673 Ga0207702_10054241
674 Ga0207648_10033321
675 Ga0207674_10100862
676 Ga0207674_10357429
677 Ga0207675_100063668
678 Ga0268266_10088449
679 Ga0268265_10102041
680 Ga0265336_10003410
681 Ga0307515_10084358
682 Ga0265338_10000827
683 Ga0265327_10000230
684 Ga0265327_10069115
685 Ga0265327_10088844
686 Ga0316576_10002574
687 Ga0316578_10006282
688 Ga0316577_10065133
689 Ga0307518_10000573
690 Ga0307518_10151040
691 Ga0307415_100237238
692 Ga0307507_10006423
693 Ga0307510_10215208
694 Ga0373944_0074400
695 Ga0373936_0000285
696 Ga0373953_0020659
697 Ga0373953_0040769
698 Ga0373954_0018548
699 Ga0373956_0085877
700 Ga0373957_0028677
701 Ga0373955_0045951
702 Ga0373955_0176496
703 Ga0316574_0001504
704 Ga0373924_0002011
705 Ga0373935_0219357
706 Ga0373933_0011217
707 Ga0373933_0098627
708 Ga0373947_0021646
709 Ga0373947_0044156
710 Ga0373937_0032649
711 Ga0373937_0099383
712 Ga0316582_0014494
713 Ga0316584_0064378
714 Ga0373925_0000010
715 Ga0373925_0028659
716 Ga0373925_0037211
717 Ga0373925_0080829
718 Ga0395900_0317265
719 Ga0395898_0013793
720 Ga0436364_0388460
721 Ga0436364_0901183
722 Ga0395901_0117819
723 Ga0436365_0484364
724 Ga0436365_0628342
725 Ga0436365_1626427
726 Ga0451853_2668301
727 Ga0439443_005390
728 Ga0439448_0017863
729 Ga0439454_001256
730 Ga0439446_0066181
731 Ga0439464_0027140
732 Ga0439460_0005131
733 Ga0466969_0041255
734 Ga0466972_0002507
735 Ga0466965_0000767
736 Ga0466965_0001962
737 Ga0466965_0084305
738 Ga0466966_0077432
739 Ga0466961_0024253
740 Ga0466963_0062940
741 Ga0466963_0093696
742 Ga0466964_0035364
743 Ga0466964_0078773
744 Ga0466957_0023741
745 Ga0466957_0039050
746 Ga0466957_0187709
747 Ga0466960_0000734
748 Ga0466960_0085849
749 Ga0466959_0045583
750 Ga0466959_0113874
751 Ga0466958_0167574
752 Ga0466967_0000535
753 Ga0466967_0013718
754 Ga0466967_0021916
755 Ga0466967_0039513
756 Ga0466967_0041779
757 Ga0466967_0130476
758 Ga0466967_0360532
759 Ga0495592_0010367
760 Ga0495629_0000784
761 Ga0495641_0117985
762 Ga0495651_0047479
763 Ga0495651_0098157
764 Ga0495653_0001916
765 Ga0495653_0075381
766 Ga0495582_0027247
767 Ga0495639_0009415
768 Ga0495662_0003615
769 Ga0495662_0015682
770 Ga0495664_0053239
771 Ga0495608_0008626
772 Ga0495618_0107487
773 Ga0495628_0058648
774 Ga0495628_0067189
775 Ga0495628_0102115
776 Ga0495630_0048213
777 Ga0495652_0018219
778 Ga0495652_0147335
779 Ga0495665_0002081
780 Ga0495640_0018526
781 Ga0495640_0030181
782 Ga0495640_0122372
783 Ga0495586_0023192
784 Ga0495586_0036854
785 Ga0495587_0004107
786 Ga0495587_0037837
787 Ga0495645_0051591
788 Ga0495645_0080700
789 Ga0495645_0087011
790 Ga0495645_0155901
791 Ga0495667_0001290
792 Ga0495667_0090340
793 Ga0495668_0000928
794 Ga0495634_0010662
795 Ga0495634_0019607
796 Ga0495625_0115039
797 Ga0495635_0008641
798 Ga0495635_0056355
799 Ga0495635_0099765
800 Ga0495657_0004735
801 Ga0495657_0008845
802 Ga0495599_0045024
803 Ga0495599_0075167
804 Ga0495623_0002864
805 Ga0495623_0054610
806 Ga0495647_0050713
807 Ga0495658_0001706
808 Ga0495624_0035572
809 Ga0495600_0013002
810 Ga0495600_0186264
811 Ga0495581_0023847
812 Ga0495581_0078192
813 Ga0495604_0018973
814 Ga0495636_0011132
815 Ga0495674_0105781
816 Ga0495674_0133485
817 Ga0495680_0002183
818 Ga0495680_0023048
819 Ga0495683_0034974
820 Ga0495687_000504
821 Ga0495687_002167
822 Ga0495675_0011443
823 Ga0495675_0014656
824 Ga0495684_0023021
825 Ga0495684_0289450
826 Ga0495593_0002162
827 Ga0495602_0137505
828 Ga0495602_0190094
829 Ga0495614_0041156
830 Ga0496100_0003143
831 Ga0496101_0000034
832 Ga0496102_0023068
833 Ga0496102_0024636
834 Ga0496102_0261258
835 Ga0496103_0001309
836 Ga0496103_0042838
837 Ga0496104_0000813
838 Ga0496105_0018963
839 Ga0496106_0007992
840 Ga0496106_0028375
841 Ga0496107_0000203
842 Ga0496107_0037232
843 Ga0496107_0236312
844 Ga0496108_0029437
845 Ga0496108_0083919
846 Ga0496108_0141958
847 Ga0496109_0000204
848 Ga0496109_0003659
849 Ga0496110_0049962
850 Ga0496110_0201203
851 Ga0496110_0352522
852 Ga0496111_0071033
853 Ga0496112_0000555
854 Ga0496112_0031404
855 Ga0496112_0063701
856 Ga0496113_0107443
857 Ga0496114_0000081
858 Ga0496114_0035527
859 Ga0496114_0077604
860 Ga0496115_0031019
861 Ga0496115_0116653
862 Ga0496115_0320927
863 Ga0496116_0008543
864 Ga0496117_0045145
865 Ga0496117_0115078
866 Ga0496118_0000029
867 Ga0496118_0011661
868 Ga0496119_0028378
869 Ga0496121_0000048
870 Ga0496122_0000234
871 Ga0496123_0034318
872 Ga0496124_0000044
873 Ga0496125_0000037
874 Ga0496125_0085204
875 Ga0496126_0000046
876 Ga0496126_0003377
877 Ga0496126_0031270
878 Ga0501032_0006489
879 Ga0501032_0016330
880 Ga0501032_0043417
881 Ga0501032_0092208
882 Ga0501033_0023503
883 Ga0501033_0059933
884 Ga0501033_0129444
885 Ga0501034_0004653
886 Ga0501034_0005708
887 Ga0501034_0036548
888 Ga0501034_0107424
889 Ga0501034_0193254
890 Ga0501036_0000170
891 Ga0501036_0073039
892 Ga0501037_0010663
893 Ga0501037_0015892
894 Ga0501037_0121342
895 Ga0501038_0014458
896 Ga0501038_0066887
897 Ga0501038_0101204
898 Ga0501039_0000397
899 Ga0501039_0090338
900 Ga0501042_0009627
901 Ga0501043_0000648
902 Ga0501043_0016153
903 Ga0501043_0071771
904 Ga0501046_0010264
905 Ga0501046_0060443
906 Ga0501047_0028002
907 Ga0501047_0064735
908 Ga0501047_0165686
909 Ga0501048_0001538
910 Ga0501048_0019610
911 Ga0501067_0071945
912 Ga0501067_0106650
913 Ga0501069_0022820
914 Ga0501070_0000667
915 Ga0501070_0001833
916 Ga0501070_0200595
917 Ga0501071_0015643
918 Ga0501073_0004676
919 Ga0501073_0047110
920 Ga0501074_0000484
921 Ga0501080_0021751
922 Ga0501080_0036493
923 Ga0501083_0003934
924 Ga0501035_0002727
925 Ga0501035_0004807
926 Ga0501035_0021895
927 Ga0501044_0000425
928 Ga0501044_0000982
929 Ga0501044_0017081
930 Ga0501044_0019136
931 Ga0501044_0057046
932 nmdc:mga03683_24799_c1
933 nmdc:mga03n38_100172_c1
934 nmdc:mga00v17_28625_c1
935 nmdc:mga00v17_30514_c1
936 nmdc:mga00v17_9573_c1
937 nmdc:mga0yw44_57174_c1
938 nmdc:mga07m45_26976_c1
939 nmdc:mga07m45_3325_c2
940 nmdc:mga06r32_263_c3
941 nmdc:mga0n895_8441_c1
942 nmdc:mga08x19_43027_c1
943 nmdc:mga0a205_132603_c1
944 nmdc:mga0sz30_12649_c1
945 nmdc:mga0sz30_36337_c1
946 nmdc:mga0sz30_43565_c1
947 Ga0495601_0002571
948 Ga0495601_0094776
949 Ga0495612_0001928
950 Ga0495612_0003769
951 Ga0495595_0013582
952 Ga0495619_0043559
953 Ga0500616_0005275
954 Ga0501084_0010802
955 2842891817
956 2508673715
957 2523385088
958 2548695537
959 2552108661
960 2566992213
961 2586059638
962 2643768488
963 2643876315
964 2644100820
965 2644111860
966 2644117228
967 2644383370
968 2644489737
969 2644512262
970 2671833305
971 2676201494
972 2676487912
973 2689964479
974 2738664608
975 2738888394
976 2739143743
977 2739204262
978 2739240136
979 2739363042
980 2744956917
981 2774846070
982 2774851461
983 2793977603
984 2795784930
985 2808901179
986 2809591593
987 2866557043
988 2873320803
989 2884697561
990 2889303379
991 2895438122
992 2895447644
993 2895660495
994 2899361936
995 2899376326
996 2904766096
997 2904773412
998 2908812140
999 2915772888
1000 2917744685
1001 2919421477
1002 2919432765
1003 2919714359
1004 2922557148
1005 2928145152
1006 2932400347
1007 2939748573
1008 3003001737
1009 8003318622
1010 8046353668
1011 8047903135
1012 8048379424
1013 8048389979
1014 8053947334
1015 8055067357
1016 8055179748

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

2

318

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z69-assembly1.cif.gz_B crystal structure of methylenetetrahydromethanopterin reductase (mer) in complex with coenzyme f420 0.8714 1 339
1f07-assembly1.cif.gz_A structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum 0.8541 1 345
1z69-assembly1.cif.gz_B crystal structure of methylenetetrahydromethanopterin reductase (mer) in complex with coenzyme f420 0.8541 1 339
1f07-assembly1.cif.gz_A structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum 0.8516 1 345
1ezw-assembly1.cif.gz_A structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanopyrus kandleri 0.8141 2 345
ID Description Score Start End Superfamily
af_O53565_5_346_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9151 1 343 3.20.20.30
af_O53565_5_346_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.91 1 343 3.20.20.30
af_O05772_7_317_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8667 15 338 3.20.20.30
af_O05772_7_317_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8335 15 338 3.20.20.30
1ezwA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8141 2 345 3.20.20.30
ID Description Score Start End GO Terms
AF-N1M0Z9-F1-model_v4 deleted 0.9813 1 344
AF-N1M0Z9-F1-model_v4 deleted 0.9757 1 344
AF-A0A7X6P1S8-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9664 158 344 GO:0016705
AF-A0A2S9GG49-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9585 10 92 GO:0016705
AF-A0A829PZV6-F1-model_v4 Luciferase-like monooxygenase family protein 0.9531 1 96 GO:0004497
GO:0016705

Map