F456839

General Info

Members Datasets Scaffolds Average Seq Length
508 231 1016 138

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0485025|Ga0395901_0485025_610_1101
Length 163
Sequence LCDEDVDGRVKPGHDDMDGLARMNGEIFFAAAGMGAKARGQALVAKDGFSARYDLDRVRGIFSRPDHKLAGESYVGRVLVLAAAKGGVATAWMLREMKARGVMPAALVLNAVNPIMVQGAALADFTMISGFDVDITQAIPNGAWVEVDPTGERPFIRVARLRA

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
81 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
82 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
83 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
84 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
88 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
89 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
90 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
212 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
213 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
228 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.36
Nodule 0
Rhizoplane 9.25
Rhizosphere 87.4
Stem 0
Stem Tuber 0
Unclassified 10.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0485025 3300038443 Bacteria 1260
2 JGI25405J52794_10104233 3300003911 Bacteria 634
3 Ga0070670_100009759 3300005331 Bacteria 8197
4 Ga0070668_100186681 3300005347 Bacteria 1696
5 Ga0070674_100932120 3300005356 Bacteria 758
6 Ga0070667_100450622 3300005367 Bacteria 1176
7 Ga0070703_10201106 3300005406 Bacteria 782
8 Ga0070709_10134328 3300005434 Bacteria 1693
9 Ga0070709_10973963 3300005434 Unclassified 674
10 Ga0070709_11327882 3300005434 Bacteria 581
11 Ga0070714_100070167 3300005435 Bacteria 3028
12 Ga0070714_100204477 3300005435 Bacteria 1808
13 Ga0070714_100852282 3300005435 Bacteria 884
14 Ga0070713_100078736 3300005436 Bacteria 2806
15 Ga0070713_100179023 3300005436 Bacteria 1904
16 Ga0070713_100422041 3300005436 Bacteria 1249
17 Ga0070713_100650178 3300005436 Bacteria 1004
18 Ga0070713_100730025 3300005436 Bacteria 947
19 Ga0070710_10090884 3300005437 Bacteria 1800
20 Ga0070710_11537416 3300005437 Bacteria 501
21 Ga0070705_100211132 3300005440 Bacteria 1338
22 Ga0070706_100829360 3300005467 Bacteria 855
23 Ga0070706_101316960 3300005467 Bacteria 662
24 Ga0070707_100636063 3300005468 Bacteria 1029
25 Ga0070698_100686789 3300005471 Bacteria 965
26 Ga0070699_100115686 3300005518 Bacteria 2357
27 Ga0070699_100748826 3300005518 Bacteria 893
28 Ga0070697_101077984 3300005536 Bacteria 715
29 Ga0068853_100351659 3300005539 Bacteria 1371
30 Ga0070693_100600903 3300005547 Bacteria 794
31 Ga0070665_101047417 3300005548 Unclassified 828
32 Ga0070665_101643996 3300005548 Bacteria 650
33 Ga0070704_100217908 3300005549 Bacteria 1550
34 Ga0068856_100633207 3300005614 Bacteria 1090
35 Ga0068864_101849820 3300005618 Unclassified 609
36 Ga0081455_10002333 3300005937 Bacteria 22645
37 Ga0081455_10031569 3300005937 Bacteria 4790
38 Ga0081455_10040053 3300005937 Bacteria 4135
39 Ga0081455_10146179 3300005937 Bacteria 1829
40 Ga0081538_10003269 3300005981 Bacteria 15388
41 Ga0081538_10132992 3300005981 Bacteria 1165
42 Ga0081538_10154343 3300005981 Bacteria 1033
43 Ga0081540_1096430 3300005983 Bacteria 1286
44 Ga0081539_10030612 3300005985 Bacteria 3336
45 Ga0081539_10041520 3300005985 Bacteria 2687
46 Ga0070717_10045994 3300006028 Bacteria 3570
47 Ga0070717_10163922 3300006028 Bacteria 1930
48 Ga0070717_10473898 3300006028 Bacteria 1130
49 Ga0070717_11188672 3300006028 Unclassified 694
50 Ga0075365_10129999 3300006038 Bacteria 1742
51 Ga0075365_10197290 3300006038 Bacteria 1410
52 Ga0075365_10401119 3300006038 Bacteria 968
53 Ga0075364_10101671 3300006051 Bacteria 1914
54 Ga0070715_10428810 3300006163 Bacteria 741
55 Ga0070716_100035378 3300006173 Bacteria 2746
56 Ga0070716_100147610 3300006173 Bacteria 1508
57 Ga0070716_101111874 3300006173 Bacteria 631
58 Ga0070712_100041896 3300006175 Bacteria 3146
59 Ga0070712_100169466 3300006175 Bacteria 1693
60 Ga0070712_100533700 3300006175 Bacteria 987
61 Ga0075362_10081256 3300006177 Unclassified 1494
62 Ga0097621_100617442 3300006237 Bacteria 992
63 Ga0075428_100066323 3300006844 Bacteria 3952
64 Ga0075428_100815371 3300006844 Bacteria 992
65 Ga0075428_101211995 3300006844 Bacteria 795
66 Ga0075430_100190483 3300006846 Bacteria 1705
67 Ga0075430_100291568 3300006846 Bacteria 1350
68 Ga0075430_101059174 3300006846 Bacteria 668
69 Ga0075430_101216071 3300006846 Bacteria 620
70 Ga0075431_100125914 3300006847 Bacteria 2643
71 Ga0075431_100180538 3300006847 Bacteria 2166
72 Ga0075431_100980615 3300006847 Bacteria 812
73 Ga0075434_100049589 3300006871 Bacteria 4169
74 Ga0075434_100127137 3300006871 Bacteria 2565
75 Ga0075434_100136710 3300006871 Bacteria 2470
76 Ga0075429_100050073 3300006880 Bacteria 3634
77 Ga0068865_101312000 3300006881 Bacteria 644
78 Ga0075436_100349956 3300006914 Bacteria 1065
79 Ga0075436_100362516 3300006914 Bacteria 1046
80 Ga0075435_100218570 3300007076 Bacteria 1618
81 Ga0099794_10202907 3300007265 Bacteria 1016
82 Ga0099794_10237581 3300007265 Bacteria 938
83 Ga0105250_10287462 3300009092 Unclassified 709
84 Ga0111539_10375081 3300009094 Bacteria 1656
85 Ga0111539_11115039 3300009094 Bacteria 917
86 Ga0105245_10845876 3300009098 Bacteria 955
87 Ga0114129_10157666 3300009147 Bacteria 3103
88 Ga0114129_10251743 3300009147 Bacteria 2371
89 Ga0114129_10580679 3300009147 Unclassified 1454
90 Ga0114129_10754271 3300009147 Bacteria 1246
91 Ga0114129_11499792 3300009147 Bacteria 828
92 Ga0105243_10120969 3300009148 Bacteria 2207
93 Ga0105242_11442408 3300009176 Bacteria 717
94 Ga0105249_11183257 3300009553 Unclassified 835
95 Ga0099796_10467285 3300010159 Bacteria 563
96 Ga0105239_10215726 3300010375 Bacteria 2151
97 Ga0105246_10095367 3300011119 Bacteria 2154
98 Ga0163162_10116079 3300013306 Bacteria 2777
99 Ga0163162_10389467 3300013306 Unclassified 1526
100 Ga0157380_13078626 3300014326 Unclassified 532
101 Ga0157379_10347324 3300014968 Bacteria 1358
102 Ga0182005_1124310 3300015265 Bacteria 736
103 Ga0213875_10000025 3300021388 Bacteria 197787
104 Ga0207653_10037390 3300025885 Bacteria 1583
105 Ga0207692_10067274 3300025898 Bacteria 1875
106 Ga0207692_10379014 3300025898 Unclassified 878
107 Ga0207692_11162762 3300025898 Bacteria 512
108 Ga0207685_10031853 3300025905 Bacteria 1893
109 Ga0207699_10024548 3300025906 Bacteria 3298
110 Ga0207699_10081778 3300025906 Bacteria 2005
111 Ga0207699_10102150 3300025906 Bacteria 1821
112 Ga0207684_10024559 3300025910 Bacteria 5138
113 Ga0207684_10722898 3300025910 Bacteria 845
114 Ga0207684_11048561 3300025910 Bacteria 680
115 Ga0207693_10065302 3300025915 Bacteria 2850
116 Ga0207693_10153894 3300025915 Bacteria 1809
117 Ga0207693_10220490 3300025915 Bacteria 1490
118 Ga0207693_10275744 3300025915 Bacteria 1318
119 Ga0207693_10652133 3300025915 Bacteria 818
120 Ga0207663_10134091 3300025916 Bacteria 1716
121 Ga0207649_11349613 3300025920 Unclassified 564
122 Ga0207646_10222252 3300025922 Bacteria 1706
123 Ga0207681_10247391 3300025923 Bacteria 1391
124 Ga0207650_10011441 3300025925 Bacteria 6109
125 Ga0207659_10367741 3300025926 Bacteria 1197
126 Ga0207700_10085643 3300025928 Bacteria 2474
127 Ga0207700_10282282 3300025928 Bacteria 1429
128 Ga0207700_10294128 3300025928 Bacteria 1400
129 Ga0207700_11337299 3300025928 Unclassified 638
130 Ga0207664_10100777 3300025929 Bacteria 2385
131 Ga0207664_10115148 3300025929 Bacteria 2241
132 Ga0207664_10440463 3300025929 Bacteria 1162
133 Ga0207686_11233196 3300025934 Bacteria 613
134 Ga0207665_10115653 3300025939 Bacteria 1890
135 Ga0207665_10224420 3300025939 Bacteria 1378
136 Ga0207665_10834481 3300025939 Bacteria 729
137 Ga0207703_10816784 3300026035 Unclassified 891
138 Ga0207678_10154111 3300026067 Bacteria 1962
139 Ga0207702_12097893 3300026078 Unclassified 555
140 Ga0209588_1133377 3300027671 Bacteria 791
141 Ga0265334_10050066 3300028573 Bacteria 1606
142 Ga0373926_0023382 3300035083 Bacteria 2146
143 Ga0373926_0179627 3300035083 Bacteria 811
144 Ga0373934_0052706 3300035086 Bacteria 1614
145 Ga0373944_0012240 3300035089 Bacteria 2361
146 Ga0373923_0000212 3300035111 Bacteria 12051
147 Ga0373936_0003590 3300035113 Bacteria 5833
148 Ga0373936_0019115 3300035113 Bacteria 2653
149 Ga0373936_0129019 3300035113 Bacteria 1085
150 Ga0373939_0104492 3300035114 Bacteria 977
151 Ga0373945_0047634 3300035116 Bacteria 1568
152 Ga0373945_0060613 3300035116 Bacteria 1411
153 Ga0373945_0088922 3300035116 Bacteria 1194
154 Ga0373954_0003106 3300035118 Bacteria 7012
155 Ga0373954_0032971 3300035118 Unclassified 2396
156 Ga0373954_0118234 3300035118 Bacteria 1286
157 Ga0373956_0052904 3300035119 Bacteria 1827
158 Ga0373956_0070882 3300035119 Bacteria 1590
159 Ga0373957_0013541 3300035120 Bacteria 2769
160 Ga0373957_0070126 3300035120 Unclassified 1369
161 Ga0373943_0001213 3300035170 Bacteria 11521
162 Ga0373943_0001439 3300035170 Bacteria 10744
163 Ga0373943_0016107 3300035170 Bacteria 3405
164 Ga0373943_0329148 3300035170 Unclassified 872
165 Ga0373946_0001549 3300035171 Bacteria 8013
166 Ga0373946_0009238 3300035171 Bacteria 3627
167 Ga0373946_0102777 3300035171 Bacteria 1283
168 Ga0373955_0000673 3300035172 Bacteria 14609
169 Ga0373924_0003208 3300035410 Bacteria 5594
170 Ga0373924_0038637 3300035410 Unclassified 1948
171 Ga0373924_0112999 3300035410 Bacteria 1175
172 Ga0373931_0111634 3300035691 Bacteria 1552
173 Ga0373931_0300649 3300035691 Bacteria 991
174 Ga0373935_0000017 3300035692 Bacteria 70368
175 Ga0373935_0002067 3300035692 Bacteria 11381
176 Ga0373935_0024948 3300035692 Bacteria 3683
177 Ga0373935_0041919 3300035692 Bacteria 2877
178 Ga0373935_0226017 3300035692 Unclassified 1302
179 Ga0373935_1069760 3300035692 Bacteria 600
180 Ga0373927_0001755 3300035695 Bacteria 16180
181 Ga0373927_0014215 3300035695 Bacteria 5279
182 Ga0373927_0096026 3300035695 Bacteria 1926
183 Ga0373933_0001228 3300035724 Bacteria 15165
184 Ga0373933_0046723 3300035724 Unclassified 2572
185 Ga0373947_0001167 3300035725 Bacteria 16142
186 Ga0373947_0002599 3300035725 Bacteria 10839
187 Ga0373947_0042669 3300035725 Bacteria 2708
188 Ga0373947_0057289 3300035725 Bacteria 2357
189 Ga0373947_0316242 3300035725 Bacteria 1043
190 Ga0373947_0771213 3300035725 Bacteria 656
191 Ga0373937_0000103 3300036401 Bacteria 80386
192 Ga0373937_0030604 3300036401 Bacteria 4874
193 Ga0373937_0448731 3300036401 Bacteria 1225
194 Ga0373937_1539520 3300036401 Bacteria 612
195 Ga0373925_0000058 3300037068 Bacteria 122682
196 Ga0373925_0000344 3300037068 Bacteria 48419
197 Ga0373925_0018162 3300037068 Bacteria 5109
198 Ga0373925_0199842 3300037068 Bacteria 1589
199 Ga0373925_1020410 3300037068 Bacteria 681
200 Ga0395899_0242810 3300037312 Bacteria 1239
201 Ga0395898_0427358 3300037466 Bacteria 1262
202 Ga0395905_0187591 3300037471 Bacteria 1941
203 Ga0436364_0206987 3300037853 Bacteria 14423
204 Ga0395901_0323792 3300038443 Bacteria 1594
205 Ga0436365_0527675 3300039437 Unclassified 563
206 Ga0436365_1307987 3300039437 Unclassified 850
207 Ga0436360_0131211 3300039438 Bacteria 588
208 Ga0436360_0259805 3300039438 Bacteria 741
209 Ga0436361_0608086 3300039447 Bacteria 2672
210 Ga0436361_0624946 3300039447 Bacteria 2246
211 Ga0436362_0053075 3300039453 Bacteria 589
212 Ga0436362_0131183 3300039453 Bacteria 659
213 Ga0466966_0243209 3300044684 Bacteria 1085
214 Ga0466966_0445825 3300044684 Unclassified 778
215 Ga0466963_0015116 3300044694 Bacteria 4773
216 Ga0466963_0064523 3300044694 Bacteria 2454
217 Ga0466963_0085916 3300044694 Bacteria 2137
218 Ga0466964_0039336 3300044706 Bacteria 1905
219 Ga0466957_0042259 3300044842 Bacteria 2757
220 Ga0466957_0559941 3300044842 Unclassified 797
221 Ga0466959_0369358 3300045049 Unclassified 977
222 Ga0466958_0541042 3300045836 Unclassified 756
223 Ga0466967_0052054 3300045976 Bacteria 3592
224 Ga0466967_0165427 3300045976 Bacteria 2078
225 Ga0466967_0669945 3300045976 Bacteria 1027
226 Ga0466967_2361375 3300045976 Bacteria 527
227 Ga0495617_228285 3300046452 Bacteria 577
228 Ga0495592_0000062 3300046454 Bacteria 99207
229 Ga0495592_0159578 3300046454 Bacteria 1553
230 Ga0495592_0255982 3300046454 Bacteria 1155
231 Ga0495592_0710580 3300046454 Unclassified 604
232 Ga0495629_0001807 3300046459 Bacteria 16771
233 Ga0495629_0014822 3300046459 Bacteria 5607
234 Ga0495629_0018411 3300046459 Bacteria 5000
235 Ga0495629_0037531 3300046459 Bacteria 3415
236 Ga0495629_0039437 3300046459 Bacteria 3324
237 Ga0495629_0086068 3300046459 Bacteria 2193
238 Ga0495641_0277072 3300046461 Bacteria 755
239 Ga0495651_0001912 3300046462 Bacteria 16134
240 Ga0495651_0842109 3300046462 Bacteria 564
241 Ga0495653_0000072 3300046463 Bacteria 85266
242 Ga0495653_0060004 3300046463 Bacteria 2883
243 Ga0495653_0431503 3300046463 Bacteria 832
244 Ga0495653_0870293 3300046463 Bacteria 538
245 Ga0495580_0365669 3300046472 Bacteria 976
246 Ga0495582_0218728 3300046473 Bacteria 1090
247 Ga0495582_0336173 3300046473 Bacteria 869
248 Ga0495639_0062989 3300046475 Bacteria 1702
249 Ga0495639_0307472 3300046475 Bacteria 791
250 Ga0495662_0005607 3300046476 Bacteria 6280
251 Ga0495664_0000009 3300046477 Bacteria 289534
252 Ga0495664_0000292 3300046477 Bacteria 23928
253 Ga0495584_0022367 3300046491 Bacteria 3208
254 Ga0495584_0124873 3300046491 Bacteria 1304
255 Ga0495584_0237173 3300046491 Bacteria 927
256 Ga0495585_0383421 3300046492 Bacteria 679
257 Ga0495608_0000061 3300046511 Bacteria 86891
258 Ga0495608_0332523 3300046511 Unclassified 937
259 Ga0495608_0519778 3300046511 Bacteria 720
260 Ga0495618_0000061 3300046514 Bacteria 78337
261 Ga0495618_0008078 3300046514 Bacteria 6372
262 Ga0495628_0000012 3300046516 Bacteria 224162
263 Ga0495630_0002587 3300046517 Bacteria 12540
264 Ga0495630_0014489 3300046517 Bacteria 5745
265 Ga0495630_0026705 3300046517 Bacteria 4277
266 Ga0495630_0074376 3300046517 Bacteria 2559
267 Ga0495666_0018998 3300046526 Bacteria 3414
268 Ga0495666_0464443 3300046526 Bacteria 567
269 Ga0495652_0000021 3300046529 Bacteria 181454
270 Ga0495652_0122334 3300046529 Bacteria 2073
271 Ga0495652_0124953 3300046529 Bacteria 2046
272 Ga0495665_0004286 3300046531 Bacteria 7708
273 Ga0495665_0064120 3300046531 Bacteria 1939
274 Ga0495665_0064668 3300046531 Bacteria 1930
275 Ga0495640_0000028 3300046533 Bacteria 79904
276 Ga0495640_0009869 3300046533 Bacteria 7406
277 Ga0495640_0022723 3300046533 Bacteria 4580
278 Ga0495640_0030822 3300046533 Bacteria 3835
279 Ga0495640_0067148 3300046533 Bacteria 2416
280 Ga0495586_0006645 3300046535 Bacteria 6175
281 Ga0495587_0000033 3300046536 Bacteria 123885
282 Ga0495587_0087315 3300046536 Unclassified 1805
283 Ga0495587_0386825 3300046536 Bacteria 778
284 Ga0495645_0000017 3300046543 Bacteria 156865
285 Ga0495645_0001428 3300046543 Bacteria 16090
286 Ga0495622_0257401 3300046557 Unclassified 767
287 Ga0495667_0000011 3300046559 Bacteria 222545
288 Ga0495667_0130635 3300046559 Bacteria 1620
289 Ga0495667_0203664 3300046559 Unclassified 1266
290 Ga0495667_0260348 3300046559 Bacteria 1103
291 Ga0495667_0739606 3300046559 Bacteria 608
292 Ga0495656_0306537 3300046615 Bacteria 815
293 Ga0495668_0053066 3300046616 Bacteria 2243
294 Ga0495634_0000220 3300046642 Bacteria 53609
295 Ga0495634_0002756 3300046642 Bacteria 14441
296 Ga0495634_0037495 3300046642 Bacteria 3312
297 Ga0495634_0055184 3300046642 Bacteria 2657
298 Ga0495634_0093420 3300046642 Bacteria 1951
299 Ga0495611_0139700 3300046648 Bacteria 1131
300 Ga0495635_0000019 3300046663 Bacteria 193402
301 Ga0495635_0000545 3300046663 Bacteria 23993
302 Ga0495635_0152695 3300046663 Bacteria 1572
303 Ga0495635_0175692 3300046663 Bacteria 1456
304 Ga0495635_0672728 3300046663 Bacteria 672
305 Ga0495659_0002501 3300046664 Bacteria 5928
306 Ga0495657_0000378 3300046675 Bacteria 41496
307 Ga0495657_0103696 3300046675 Unclassified 1809
308 Ga0495599_0000024 3300046678 Bacteria 121388
309 Ga0495623_0000022 3300046679 Bacteria 98899
310 Ga0495623_0562704 3300046679 Bacteria 596
311 Ga0495646_0000033 3300046680 Bacteria 83930
312 Ga0495647_0131463 3300046681 Bacteria 1061
313 Ga0495647_0220096 3300046681 Unclassified 838
314 Ga0495658_0032288 3300046683 Bacteria 2858
315 Ga0495658_0561034 3300046683 Bacteria 731
316 Ga0495613_0009938 3300046689 Bacteria 7072
317 Ga0495613_0014624 3300046689 Bacteria 5823
318 Ga0495613_0108899 3300046689 Bacteria 1998
319 Ga0495613_0193321 3300046689 Bacteria 1437
320 Ga0495624_0015309 3300046690 Bacteria 5182
321 Ga0495624_0543122 3300046690 Bacteria 694
322 Ga0495670_0075722 3300046691 Bacteria 1709
323 Ga0495600_0000028 3300046809 Bacteria 90661
324 Ga0495600_0381531 3300046809 Unclassified 879
325 Ga0495660_0235341 3300046810 Bacteria 856
326 Ga0495581_0001914 3300047315 Bacteria 11661
327 Ga0495581_0009720 3300047315 Bacteria 5567
328 Ga0495581_0265281 3300047315 Bacteria 1004
329 Ga0495604_0000011 3300047317 Bacteria 292024
330 Ga0495604_0227762 3300047317 Unclassified 1280
331 Ga0495674_0000015 3300047319 Bacteria 224071
332 Ga0495674_0000996 3300047319 Bacteria 27247
333 Ga0495674_0370380 3300047319 Bacteria 1160
334 Ga0495674_0479935 3300047319 Bacteria 996
335 Ga0495674_0484670 3300047319 Bacteria 991
336 Ga0495674_0947894 3300047319 Unclassified 662
337 Ga0495676_0318947 3300047321 Bacteria 1044
338 Ga0495676_0331513 3300047321 Bacteria 1020
339 Ga0495676_0511876 3300047321 Bacteria 787
340 Ga0495680_0009066 3300047322 Bacteria 8982
341 Ga0495680_0185630 3300047322 Unclassified 1498
342 Ga0495675_0000295 3300047444 Bacteria 35782
343 Ga0495675_0636827 3300047444 Unclassified 602
344 Ga0495684_0000036 3300047471 Bacteria 107181
345 Ga0495684_0011282 3300047471 Bacteria 6902
346 Ga0495684_0029312 3300047471 Bacteria 4224
347 Ga0495684_0035611 3300047471 Bacteria 3817
348 Ga0495684_0423679 3300047471 Bacteria 930
349 Ga0495593_0007137 3300047673 Bacteria 6551
350 Ga0495593_0630128 3300047673 Bacteria 538
351 Ga0495602_0000018 3300048088 Bacteria 183837
352 Ga0495602_0395337 3300048088 Bacteria 987
353 Ga0495602_0657923 3300048088 Unclassified 715
354 Ga0495602_1069409 3300048088 Bacteria 530
355 Ga0496100_0080684 3300048903 Bacteria 2196
356 Ga0496100_0429404 3300048903 Bacteria 1010
357 Ga0496100_0805022 3300048903 Bacteria 736
358 Ga0496101_0029194 3300048904 Bacteria 3857
359 Ga0496101_0296989 3300048904 Bacteria 1265
360 Ga0496102_0114046 3300048905 Bacteria 2521
361 Ga0496102_0887621 3300048905 Unclassified 813
362 Ga0496102_1405764 3300048905 Bacteria 617
363 Ga0496103_0551680 3300048906 Bacteria 736
364 Ga0496104_0000711 3300048907 Bacteria 28620
365 Ga0496104_0000925 3300048907 Bacteria 25187
366 Ga0496104_0038677 3300048907 Bacteria 4464
367 Ga0496104_1270847 3300048907 Bacteria 639
368 Ga0496105_0005447 3300048908 Bacteria 9657
369 Ga0496105_0011770 3300048908 Bacteria 6924
370 Ga0496105_0021122 3300048908 Bacteria 5266
371 Ga0496106_0023046 3300048909 Bacteria 4624
372 Ga0496106_0260398 3300048909 Unclassified 1388
373 Ga0496106_0278969 3300048909 Bacteria 1339
374 Ga0496107_0165335 3300048910 Bacteria 1640
375 Ga0496107_0204089 3300048910 Bacteria 1469
376 Ga0496107_0371909 3300048910 Bacteria 1063
377 Ga0496107_0999228 3300048910 Bacteria 607
378 Ga0496108_0024155 3300048911 Bacteria 5003
379 Ga0496108_0521868 3300048911 Bacteria 1037
380 Ga0496109_0004500 3300048912 Bacteria 11644
381 Ga0496109_0140056 3300048912 Bacteria 2262
382 Ga0496109_0238253 3300048912 Bacteria 1712
383 Ga0496110_0006127 3300048913 Bacteria 9484
384 Ga0496110_0109653 3300048913 Bacteria 2479
385 Ga0496110_0294872 3300048913 Bacteria 1477
386 Ga0496111_0022942 3300048914 Bacteria 4376
387 Ga0496111_0119747 3300048914 Bacteria 1944
388 Ga0496111_0294672 3300048914 Bacteria 1203
389 Ga0496111_0867750 3300048914 Bacteria 651
390 Ga0496112_0002146 3300048915 Bacteria 15661
391 Ga0496112_0475878 3300048915 Bacteria 1186
392 Ga0496113_0001106 3300048916 Bacteria 14611
393 Ga0496113_0945146 3300048916 Bacteria 680
394 Ga0496114_0011065 3300048917 Bacteria 7199
395 Ga0496114_0141032 3300048917 Bacteria 2087
396 Ga0496114_0250146 3300048917 Bacteria 1560
397 Ga0496115_0006464 3300048918 Bacteria 8591
398 Ga0496115_0015161 3300048918 Bacteria 5841
399 Ga0496115_0166597 3300048918 Bacteria 1822
400 Ga0496115_0675761 3300048918 Bacteria 814
401 Ga0496115_0908352 3300048918 Bacteria 678
402 Ga0496126_0698405 3300048929 Unclassified 789
403 Ga0501032_0222397 3300049569 Unclassified 1228
404 Ga0501033_0014053 3300049570 Bacteria 6091
405 Ga0501036_0154203 3300049572 Bacteria 1937
406 Ga0501036_0273364 3300049572 Bacteria 1414
407 Ga0501037_0039582 3300049573 Bacteria 3471
408 Ga0501037_0531614 3300049573 Bacteria 795
409 Ga0501038_0001136 3300049574 Bacteria 24136
410 Ga0501039_0009399 3300049575 Bacteria 7452
411 Ga0501040_0000196 3300049576 Bacteria 35200
412 Ga0501040_0666087 3300049576 Bacteria 752
413 Ga0501041_0000776 3300049577 Bacteria 17119
414 Ga0501041_0098787 3300049577 Bacteria 1806
415 Ga0501042_0029558 3300049578 Bacteria 3865
416 Ga0501042_0734767 3300049578 Bacteria 718
417 Ga0501043_0039407 3300049579 Bacteria 3713
418 Ga0501046_0000992 3300049580 Bacteria 27750
419 Ga0501046_0118559 3300049580 Bacteria 2016
420 Ga0501046_0811443 3300049580 Bacteria 655
421 Ga0501048_0020030 3300049582 Bacteria 4907
422 Ga0501048_0346233 3300049582 Bacteria 1060
423 Ga0501069_0237088 3300049585 Bacteria 1063
424 Ga0501070_0301497 3300049586 Bacteria 1305
425 Ga0501071_0001226 3300049587 Bacteria 14507
426 Ga0501072_0001619 3300049588 Bacteria 16840
427 Ga0501072_0134778 3300049588 Bacteria 1969
428 Ga0501073_1275780 3300049589 Bacteria 504
429 Ga0501075_0000045 3300049591 Bacteria 50874
430 Ga0501075_0255976 3300049591 Bacteria 1334
431 Ga0501076_0020034 3300049592 Bacteria 5116
432 Ga0501076_0300940 3300049592 Bacteria 1315
433 Ga0501076_0459077 3300049592 Unclassified 1049
434 Ga0501076_0522159 3300049592 Bacteria 979
435 Ga0501076_0661984 3300049592 Bacteria 862
436 Ga0501076_1424539 3300049592 Bacteria 569
437 Ga0501077_0000629 3300049593 Bacteria 21374
438 Ga0501077_0033565 3300049593 Bacteria 3267
439 Ga0501077_0194658 3300049593 Bacteria 1288
440 Ga0501077_0322998 3300049593 Bacteria 984
441 Ga0501079_0009483 3300049741 Bacteria 7379
442 Ga0501079_0701879 3300049741 Bacteria 796
443 Ga0501080_0036440 3300049742 Bacteria 4591
444 Ga0501080_0940897 3300049742 Bacteria 752
445 Ga0501081_0005411 3300049743 Bacteria 8239
446 Ga0501081_0164081 3300049743 Bacteria 1602
447 Ga0501035_0038720 3300049822 Bacteria 4316
448 Ga0501045_0002359 3300049824 Bacteria 12822
449 Ga0501045_0037087 3300049824 Bacteria 3543
450 Ga0501045_0156735 3300049824 Bacteria 1694
451 nmdc:mga03683_179599_c1 3300050489 Unclassified 965
452 nmdc:mga03683_61879_c1 3300050489 Bacteria 1584
453 nmdc:mga0yw44_518061_c1 3300050492 Bacteria 809
454 nmdc:mga0yw44_7465_c1 3300050492 Bacteria 5382
455 nmdc:mga06z11_861011_c1 3300050494 Bacteria 552
456 nmdc:mga05p37_1491839_c1 3300050507 Bacteria 674
457 nmdc:mga05p37_186448_c1 3300050507 Bacteria 2522
458 nmdc:mga05p37_629382_c1 3300050507 Unclassified 1206
459 nmdc:mga05p37_669134_c1 3300050507 Bacteria 1159
460 nmdc:mga05p37_80845_c1 3300050507 Bacteria 4003
461 nmdc:mga09592_44293_c1 3300050508 Bacteria 3745
462 nmdc:mga0qj67_114195_c1 3300050509 Bacteria 2181
463 nmdc:mga0qj67_499254_c1 3300050509 Bacteria 978
464 nmdc:mga0qj67_872219_c1 3300050509 Bacteria 710
465 nmdc:mga06r32_258571_c1 3300050510 Bacteria 1729
466 nmdc:mga06r32_393164_c2 3300050510 Bacteria 937
467 nmdc:mga08y16_2172662_c1 3300050511 Unclassified 502
468 nmdc:mga0n895_265886_c1 3300050512 Bacteria 1740
469 nmdc:mga0n895_415153_c1 3300050512 Bacteria 1361
470 nmdc:mga0n895_60706_c1 3300050512 Bacteria 3731
471 nmdc:mga0rr50_153824_c1 3300050513 Bacteria 1861
472 nmdc:mga0rr50_373627_c1 3300050513 Bacteria 1201
473 nmdc:mga0rr50_49730_c1 3300050513 Bacteria 3104
474 nmdc:mga08x19_190399_c1 3300050514 Unclassified 1403
475 nmdc:mga08x19_359764_c1 3300050514 Bacteria 1017
476 nmdc:mga08x19_647712_c1 3300050514 Bacteria 749
477 nmdc:mga08x19_716491_c1 3300050514 Bacteria 710
478 nmdc:mga08x19_72510_c1 3300050514 Bacteria 2246
479 nmdc:mga0a205_601446_c1 3300050515 Bacteria 953
480 Ga0495601_0000024 3300053077 Bacteria 133160
481 Ga0495601_0020926 3300053077 Bacteria 3999
482 Ga0495601_0045511 3300053077 Bacteria 2760
483 Ga0495601_0138897 3300053077 Unclassified 1584
484 Ga0495601_0183404 3300053077 Bacteria 1368
485 Ga0495612_0000079 3300053078 Bacteria 44236
486 Ga0495612_0000121 3300053078 Bacteria 32966
487 Ga0495595_0000036 3300053084 Bacteria 79035
488 Ga0495595_0139223 3300053084 Bacteria 1190
489 Ga0495595_0308276 3300053084 Bacteria 797
490 Ga0495619_0000034 3300053085 Bacteria 129851
491 Ga0495619_0000639 3300053085 Bacteria 23071
492 Ga0495619_0011454 3300053085 Bacteria 5588
493 Ga0495619_0032840 3300053085 Bacteria 3369
494 Ga0495619_0195124 3300053085 Bacteria 1402
495 Ga0495619_0226062 3300053085 Unclassified 1296
496 Ga0495619_0317530 3300053085 Bacteria 1078
497 Ga0500628_024145 3300053129 Bacteria 1260
498 Ga0500657_172334 3300053728 Bacteria 765
499 Ga0501084_0063952 3300054114 Bacteria 3081
500 Ga0501084_0070395 3300054114 Bacteria 2929
501 Ga0501084_1598864 3300054114 Bacteria 545
502 Ga0501082_0002076 3300060353 Bacteria 17636
503 Ga0501082_0622295 3300060353 Bacteria 945
504 Ga0501082_1130389 3300060353 Bacteria 685
505 Ga0530510_0000909 3300061734 Bacteria 19527
506 Ga0530510_0063777 3300061734 Bacteria 2668
507 Ga0530510_0365192 3300061734 Bacteria 1085
508 Ga0530510_0429601 3300061734 Bacteria 997
509 Ga0395901_0485025
510 JGI25405J52794_10104233
511 Ga0070670_100009759
512 Ga0070668_100186681
513 Ga0070674_100932120
514 Ga0070667_100450622
515 Ga0070703_10201106
516 Ga0070709_10134328
517 Ga0070709_10973963
518 Ga0070709_11327882
519 Ga0070714_100070167
520 Ga0070714_100204477
521 Ga0070714_100852282
522 Ga0070713_100078736
523 Ga0070713_100179023
524 Ga0070713_100422041
525 Ga0070713_100650178
526 Ga0070713_100730025
527 Ga0070710_10090884
528 Ga0070710_11537416
529 Ga0070705_100211132
530 Ga0070706_100829360
531 Ga0070706_101316960
532 Ga0070707_100636063
533 Ga0070698_100686789
534 Ga0070699_100115686
535 Ga0070699_100748826
536 Ga0070697_101077984
537 Ga0068853_100351659
538 Ga0070693_100600903
539 Ga0070665_101047417
540 Ga0070665_101643996
541 Ga0070704_100217908
542 Ga0068856_100633207
543 Ga0068864_101849820
544 Ga0081455_10002333
545 Ga0081455_10031569
546 Ga0081455_10040053
547 Ga0081455_10146179
548 Ga0081538_10003269
549 Ga0081538_10132992
550 Ga0081538_10154343
551 Ga0081540_1096430
552 Ga0081539_10030612
553 Ga0081539_10041520
554 Ga0070717_10045994
555 Ga0070717_10163922
556 Ga0070717_10473898
557 Ga0070717_11188672
558 Ga0075365_10129999
559 Ga0075365_10197290
560 Ga0075365_10401119
561 Ga0075364_10101671
562 Ga0070715_10428810
563 Ga0070716_100035378
564 Ga0070716_100147610
565 Ga0070716_101111874
566 Ga0070712_100041896
567 Ga0070712_100169466
568 Ga0070712_100533700
569 Ga0075362_10081256
570 Ga0097621_100617442
571 Ga0075428_100066323
572 Ga0075428_100815371
573 Ga0075428_101211995
574 Ga0075430_100190483
575 Ga0075430_100291568
576 Ga0075430_101059174
577 Ga0075430_101216071
578 Ga0075431_100125914
579 Ga0075431_100180538
580 Ga0075431_100980615
581 Ga0075434_100049589
582 Ga0075434_100127137
583 Ga0075434_100136710
584 Ga0075429_100050073
585 Ga0068865_101312000
586 Ga0075436_100349956
587 Ga0075436_100362516
588 Ga0075435_100218570
589 Ga0099794_10202907
590 Ga0099794_10237581
591 Ga0105250_10287462
592 Ga0111539_10375081
593 Ga0111539_11115039
594 Ga0105245_10845876
595 Ga0114129_10157666
596 Ga0114129_10251743
597 Ga0114129_10580679
598 Ga0114129_10754271
599 Ga0114129_11499792
600 Ga0105243_10120969
601 Ga0105242_11442408
602 Ga0105249_11183257
603 Ga0099796_10467285
604 Ga0105239_10215726
605 Ga0105246_10095367
606 Ga0163162_10116079
607 Ga0163162_10389467
608 Ga0157380_13078626
609 Ga0157379_10347324
610 Ga0182005_1124310
611 Ga0213875_10000025
612 Ga0207653_10037390
613 Ga0207692_10067274
614 Ga0207692_10379014
615 Ga0207692_11162762
616 Ga0207685_10031853
617 Ga0207699_10024548
618 Ga0207699_10081778
619 Ga0207699_10102150
620 Ga0207684_10024559
621 Ga0207684_10722898
622 Ga0207684_11048561
623 Ga0207693_10065302
624 Ga0207693_10153894
625 Ga0207693_10220490
626 Ga0207693_10275744
627 Ga0207693_10652133
628 Ga0207663_10134091
629 Ga0207649_11349613
630 Ga0207646_10222252
631 Ga0207681_10247391
632 Ga0207650_10011441
633 Ga0207659_10367741
634 Ga0207700_10085643
635 Ga0207700_10282282
636 Ga0207700_10294128
637 Ga0207700_11337299
638 Ga0207664_10100777
639 Ga0207664_10115148
640 Ga0207664_10440463
641 Ga0207686_11233196
642 Ga0207665_10115653
643 Ga0207665_10224420
644 Ga0207665_10834481
645 Ga0207703_10816784
646 Ga0207678_10154111
647 Ga0207702_12097893
648 Ga0209588_1133377
649 Ga0265334_10050066
650 Ga0373926_0023382
651 Ga0373926_0179627
652 Ga0373934_0052706
653 Ga0373944_0012240
654 Ga0373923_0000212
655 Ga0373936_0003590
656 Ga0373936_0019115
657 Ga0373936_0129019
658 Ga0373939_0104492
659 Ga0373945_0047634
660 Ga0373945_0060613
661 Ga0373945_0088922
662 Ga0373954_0003106
663 Ga0373954_0032971
664 Ga0373954_0118234
665 Ga0373956_0052904
666 Ga0373956_0070882
667 Ga0373957_0013541
668 Ga0373957_0070126
669 Ga0373943_0001213
670 Ga0373943_0001439
671 Ga0373943_0016107
672 Ga0373943_0329148
673 Ga0373946_0001549
674 Ga0373946_0009238
675 Ga0373946_0102777
676 Ga0373955_0000673
677 Ga0373924_0003208
678 Ga0373924_0038637
679 Ga0373924_0112999
680 Ga0373931_0111634
681 Ga0373931_0300649
682 Ga0373935_0000017
683 Ga0373935_0002067
684 Ga0373935_0024948
685 Ga0373935_0041919
686 Ga0373935_0226017
687 Ga0373935_1069760
688 Ga0373927_0001755
689 Ga0373927_0014215
690 Ga0373927_0096026
691 Ga0373933_0001228
692 Ga0373933_0046723
693 Ga0373947_0001167
694 Ga0373947_0002599
695 Ga0373947_0042669
696 Ga0373947_0057289
697 Ga0373947_0316242
698 Ga0373947_0771213
699 Ga0373937_0000103
700 Ga0373937_0030604
701 Ga0373937_0448731
702 Ga0373937_1539520
703 Ga0373925_0000058
704 Ga0373925_0000344
705 Ga0373925_0018162
706 Ga0373925_0199842
707 Ga0373925_1020410
708 Ga0395899_0242810
709 Ga0395898_0427358
710 Ga0395905_0187591
711 Ga0436364_0206987
712 Ga0395901_0323792
713 Ga0436365_0527675
714 Ga0436365_1307987
715 Ga0436360_0131211
716 Ga0436360_0259805
717 Ga0436361_0608086
718 Ga0436361_0624946
719 Ga0436362_0053075
720 Ga0436362_0131183
721 Ga0466966_0243209
722 Ga0466966_0445825
723 Ga0466963_0015116
724 Ga0466963_0064523
725 Ga0466963_0085916
726 Ga0466964_0039336
727 Ga0466957_0042259
728 Ga0466957_0559941
729 Ga0466959_0369358
730 Ga0466958_0541042
731 Ga0466967_0052054
732 Ga0466967_0165427
733 Ga0466967_0669945
734 Ga0466967_2361375
735 Ga0495617_228285
736 Ga0495592_0000062
737 Ga0495592_0159578
738 Ga0495592_0255982
739 Ga0495592_0710580
740 Ga0495629_0001807
741 Ga0495629_0014822
742 Ga0495629_0018411
743 Ga0495629_0037531
744 Ga0495629_0039437
745 Ga0495629_0086068
746 Ga0495641_0277072
747 Ga0495651_0001912
748 Ga0495651_0842109
749 Ga0495653_0000072
750 Ga0495653_0060004
751 Ga0495653_0431503
752 Ga0495653_0870293
753 Ga0495580_0365669
754 Ga0495582_0218728
755 Ga0495582_0336173
756 Ga0495639_0062989
757 Ga0495639_0307472
758 Ga0495662_0005607
759 Ga0495664_0000009
760 Ga0495664_0000292
761 Ga0495584_0022367
762 Ga0495584_0124873
763 Ga0495584_0237173
764 Ga0495585_0383421
765 Ga0495608_0000061
766 Ga0495608_0332523
767 Ga0495608_0519778
768 Ga0495618_0000061
769 Ga0495618_0008078
770 Ga0495628_0000012
771 Ga0495630_0002587
772 Ga0495630_0014489
773 Ga0495630_0026705
774 Ga0495630_0074376
775 Ga0495666_0018998
776 Ga0495666_0464443
777 Ga0495652_0000021
778 Ga0495652_0122334
779 Ga0495652_0124953
780 Ga0495665_0004286
781 Ga0495665_0064120
782 Ga0495665_0064668
783 Ga0495640_0000028
784 Ga0495640_0009869
785 Ga0495640_0022723
786 Ga0495640_0030822
787 Ga0495640_0067148
788 Ga0495586_0006645
789 Ga0495587_0000033
790 Ga0495587_0087315
791 Ga0495587_0386825
792 Ga0495645_0000017
793 Ga0495645_0001428
794 Ga0495622_0257401
795 Ga0495667_0000011
796 Ga0495667_0130635
797 Ga0495667_0203664
798 Ga0495667_0260348
799 Ga0495667_0739606
800 Ga0495656_0306537
801 Ga0495668_0053066
802 Ga0495634_0000220
803 Ga0495634_0002756
804 Ga0495634_0037495
805 Ga0495634_0055184
806 Ga0495634_0093420
807 Ga0495611_0139700
808 Ga0495635_0000019
809 Ga0495635_0000545
810 Ga0495635_0152695
811 Ga0495635_0175692
812 Ga0495635_0672728
813 Ga0495659_0002501
814 Ga0495657_0000378
815 Ga0495657_0103696
816 Ga0495599_0000024
817 Ga0495623_0000022
818 Ga0495623_0562704
819 Ga0495646_0000033
820 Ga0495647_0131463
821 Ga0495647_0220096
822 Ga0495658_0032288
823 Ga0495658_0561034
824 Ga0495613_0009938
825 Ga0495613_0014624
826 Ga0495613_0108899
827 Ga0495613_0193321
828 Ga0495624_0015309
829 Ga0495624_0543122
830 Ga0495670_0075722
831 Ga0495600_0000028
832 Ga0495600_0381531
833 Ga0495660_0235341
834 Ga0495581_0001914
835 Ga0495581_0009720
836 Ga0495581_0265281
837 Ga0495604_0000011
838 Ga0495604_0227762
839 Ga0495674_0000015
840 Ga0495674_0000996
841 Ga0495674_0370380
842 Ga0495674_0479935
843 Ga0495674_0484670
844 Ga0495674_0947894
845 Ga0495676_0318947
846 Ga0495676_0331513
847 Ga0495676_0511876
848 Ga0495680_0009066
849 Ga0495680_0185630
850 Ga0495675_0000295
851 Ga0495675_0636827
852 Ga0495684_0000036
853 Ga0495684_0011282
854 Ga0495684_0029312
855 Ga0495684_0035611
856 Ga0495684_0423679
857 Ga0495593_0007137
858 Ga0495593_0630128
859 Ga0495602_0000018
860 Ga0495602_0395337
861 Ga0495602_0657923
862 Ga0495602_1069409
863 Ga0496100_0080684
864 Ga0496100_0429404
865 Ga0496100_0805022
866 Ga0496101_0029194
867 Ga0496101_0296989
868 Ga0496102_0114046
869 Ga0496102_0887621
870 Ga0496102_1405764
871 Ga0496103_0551680
872 Ga0496104_0000711
873 Ga0496104_0000925
874 Ga0496104_0038677
875 Ga0496104_1270847
876 Ga0496105_0005447
877 Ga0496105_0011770
878 Ga0496105_0021122
879 Ga0496106_0023046
880 Ga0496106_0260398
881 Ga0496106_0278969
882 Ga0496107_0165335
883 Ga0496107_0204089
884 Ga0496107_0371909
885 Ga0496107_0999228
886 Ga0496108_0024155
887 Ga0496108_0521868
888 Ga0496109_0004500
889 Ga0496109_0140056
890 Ga0496109_0238253
891 Ga0496110_0006127
892 Ga0496110_0109653
893 Ga0496110_0294872
894 Ga0496111_0022942
895 Ga0496111_0119747
896 Ga0496111_0294672
897 Ga0496111_0867750
898 Ga0496112_0002146
899 Ga0496112_0475878
900 Ga0496113_0001106
901 Ga0496113_0945146
902 Ga0496114_0011065
903 Ga0496114_0141032
904 Ga0496114_0250146
905 Ga0496115_0006464
906 Ga0496115_0015161
907 Ga0496115_0166597
908 Ga0496115_0675761
909 Ga0496115_0908352
910 Ga0496126_0698405
911 Ga0501032_0222397
912 Ga0501033_0014053
913 Ga0501036_0154203
914 Ga0501036_0273364
915 Ga0501037_0039582
916 Ga0501037_0531614
917 Ga0501038_0001136
918 Ga0501039_0009399
919 Ga0501040_0000196
920 Ga0501040_0666087
921 Ga0501041_0000776
922 Ga0501041_0098787
923 Ga0501042_0029558
924 Ga0501042_0734767
925 Ga0501043_0039407
926 Ga0501046_0000992
927 Ga0501046_0118559
928 Ga0501046_0811443
929 Ga0501048_0020030
930 Ga0501048_0346233
931 Ga0501069_0237088
932 Ga0501070_0301497
933 Ga0501071_0001226
934 Ga0501072_0001619
935 Ga0501072_0134778
936 Ga0501073_1275780
937 Ga0501075_0000045
938 Ga0501075_0255976
939 Ga0501076_0020034
940 Ga0501076_0300940
941 Ga0501076_0459077
942 Ga0501076_0522159
943 Ga0501076_0661984
944 Ga0501076_1424539
945 Ga0501077_0000629
946 Ga0501077_0033565
947 Ga0501077_0194658
948 Ga0501077_0322998
949 Ga0501079_0009483
950 Ga0501079_0701879
951 Ga0501080_0036440
952 Ga0501080_0940897
953 Ga0501081_0005411
954 Ga0501081_0164081
955 Ga0501035_0038720
956 Ga0501045_0002359
957 Ga0501045_0037087
958 Ga0501045_0156735
959 nmdc:mga03683_179599_c1
960 nmdc:mga03683_61879_c1
961 nmdc:mga0yw44_518061_c1
962 nmdc:mga0yw44_7465_c1
963 nmdc:mga06z11_861011_c1
964 nmdc:mga05p37_1491839_c1
965 nmdc:mga05p37_186448_c1
966 nmdc:mga05p37_629382_c1
967 nmdc:mga05p37_669134_c1
968 nmdc:mga05p37_80845_c1
969 nmdc:mga09592_44293_c1
970 nmdc:mga0qj67_114195_c1
971 nmdc:mga0qj67_499254_c1
972 nmdc:mga0qj67_872219_c1
973 nmdc:mga06r32_258571_c1
974 nmdc:mga06r32_393164_c2
975 nmdc:mga08y16_2172662_c1
976 nmdc:mga0n895_265886_c1
977 nmdc:mga0n895_415153_c1
978 nmdc:mga0n895_60706_c1
979 nmdc:mga0rr50_153824_c1
980 nmdc:mga0rr50_373627_c1
981 nmdc:mga0rr50_49730_c1
982 nmdc:mga08x19_190399_c1
983 nmdc:mga08x19_359764_c1
984 nmdc:mga08x19_647712_c1
985 nmdc:mga08x19_716491_c1
986 nmdc:mga08x19_72510_c1
987 nmdc:mga0a205_601446_c1
988 Ga0495601_0000024
989 Ga0495601_0020926
990 Ga0495601_0045511
991 Ga0495601_0138897
992 Ga0495601_0183404
993 Ga0495612_0000079
994 Ga0495612_0000121
995 Ga0495595_0000036
996 Ga0495595_0139223
997 Ga0495595_0308276
998 Ga0495619_0000034
999 Ga0495619_0000639
1000 Ga0495619_0011454
1001 Ga0495619_0032840
1002 Ga0495619_0195124
1003 Ga0495619_0226062
1004 Ga0495619_0317530
1005 Ga0500628_024145
1006 Ga0500657_172334
1007 Ga0501084_0063952
1008 Ga0501084_0070395
1009 Ga0501084_1598864
1010 Ga0501082_0002076
1011 Ga0501082_0622295
1012 Ga0501082_1130389
1013 Ga0530510_0000909
1014 Ga0530510_0063777
1015 Ga0530510_0365192
1016 Ga0530510_0429601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01989

AcnX_swivel_put

Aconitase X swivel domain

49

128

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cns-assembly1.cif.gz_B crystal structure of thermococcus kodakaraensis aconitase x (holo-form) 0.9201 3 138
7cns-assembly1.cif.gz_B crystal structure of thermococcus kodakaraensis aconitase x (holo-form) 0.9135 3 138
2hi6-assembly1.cif.gz_A solution nmr structure of upf0107 protein af_0055, northeast structural genomics consortium target gr101 0.8769 4 138
2hi6-assembly1.cif.gz_A solution nmr structure of upf0107 protein af_0055, northeast structural genomics consortium target gr101 0.8709 4 138
7cnp-assembly1.cif.gz_A crystal structure of agrobacterium tumefaciens aconitase x (apo-form) 0.8111 5 126
ID Description Score Start End Superfamily
af_Q58802_1_129_3.50.30.10 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Phosphohistidine domain 0.8822 7 139 3.50.30.10
2hi6A00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Phosphohistidine domain 0.8769 4 138 3.50.30.10
2hi6A00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Phosphohistidine domain 0.8709 4 138 3.50.30.10
af_Q58802_1_129_3.50.30.10 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Phosphohistidine domain 0.8634 7 139 3.50.30.10
af_A0A0R0EFF0_27_190_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7551 68 107 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A537N1E6-F1-model_v4 DUF126 domain-containing protein 0.9828 32 137 GO:0016829
AF-A0A537N1E6-F1-model_v4 DUF126 domain-containing protein 0.9737 32 137 GO:0016829
AF-A0A6N1BEY1-F1-model_v4 deleted 0.9733 12 139
AF-A0A4Q3QJE9-F1-model_v4 deleted 0.9719 12 98
AF-A0A7W0X2B8-F1-model_v4 DUF126 domain-containing protein 0.9717 12 79 GO:0016829

Map