F456837

General Info

Members Datasets Scaffolds Average Seq Length
508 246 1016 307

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0066944|Ga0395900_0066944_1697_2623
Length 308
Sequence MTRALVTGGGGFLGSHLVERLEGSGHDVTVARRRDYDLTRWDDAERLFEESRPELVFHLAAEVGGIGANRANPGRYWYANLMMGAHVLELARLHGVQKVVIAGTVCAYPKFTPVPFREDELWNGYPEETNAPYGVAKKAVLVGAQAYREQYGLDAIFLLPANLYGPRDNFDLHTSHVIPALIRKMVEAQDGEVVLWGDGSPTREFLYVDDCAAGLALAAERYDGGEPVNLGTGVETSIRELAETIADLTGFDGEIVWDTSMPNGQPRRSLDASRAKELFGFEAGTTLRDGLERTVSWYREHAFERAAR

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
121 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
122 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
141 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
142 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 13.58
Rhizosphere 86.02
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0066944 3300037418 Bacteria 3691
2 JGI25406J46586_10010829 3300003203 Unclassified 4023
3 Ga0070683_100000325 3300005329 Bacteria 32931
4 Ga0070683_100016044 3300005329 Bacteria 6593
5 Ga0070683_100129483 3300005329 Bacteria 2388
6 Ga0070680_100009997 3300005336 Bacteria 7310
7 Ga0070680_100087432 3300005336 Bacteria 2578
8 Ga0070682_100012354 3300005337 Bacteria 4896
9 Ga0068868_100075873 3300005338 Bacteria 2687
10 Ga0068868_100195206 3300005338 Bacteria 1685
11 Ga0070660_100032787 3300005339 Bacteria 3911
12 Ga0070660_100085952 3300005339 Bacteria 2474
13 Ga0070660_100091992 3300005339 Bacteria 2393
14 Ga0070660_100181702 3300005339 Bacteria 1702
15 Ga0070689_100040491 3300005340 Bacteria 3573
16 Ga0070687_100033469 3300005343 Bacteria 2538
17 Ga0070692_10012128 3300005345 Bacteria 3977
18 Ga0070692_10066959 3300005345 Bacteria 1905
19 Ga0070668_100190915 3300005347 Bacteria 1678
20 Ga0070674_100000613 3300005356 Bacteria 17992
21 Ga0070674_100004127 3300005356 Bacteria 8252
22 Ga0070674_100034577 3300005356 Bacteria 3376
23 Ga0070673_100017119 3300005364 Bacteria 5145
24 Ga0070688_100067026 3300005365 Bacteria 2286
25 Ga0070659_100003356 3300005366 Bacteria 11389
26 Ga0070659_100008259 3300005366 Bacteria 7601
27 Ga0070659_100194552 3300005366 Bacteria 1668
28 Ga0070709_10143273 3300005434 Bacteria 1644
29 Ga0070714_100059930 3300005435 Bacteria 3265
30 Ga0070714_100082903 3300005435 Bacteria 2795
31 Ga0070714_100217900 3300005435 Bacteria 1753
32 Ga0070713_100343069 3300005436 Bacteria 1384
33 Ga0070701_10005686 3300005438 Bacteria 5178
34 Ga0070701_10090627 3300005438 Bacteria 1674
35 Ga0070711_100036654 3300005439 Bacteria 3286
36 Ga0070711_100452834 3300005439 Bacteria 1051
37 Ga0070705_100027102 3300005440 Bacteria 3125
38 Ga0070705_100027349 3300005440 Bacteria 3114
39 Ga0070708_100070585 3300005445 Bacteria 3142
40 Ga0070663_100011406 3300005455 Bacteria 5577
41 Ga0070678_100033133 3300005456 Bacteria 3583
42 Ga0070681_10007692 3300005458 Bacteria 10538
43 Ga0070681_10029861 3300005458 Bacteria 5472
44 Ga0070681_10281671 3300005458 Bacteria 1573
45 Ga0068867_100001632 3300005459 Bacteria 15598
46 Ga0068867_100104877 3300005459 Bacteria 2164
47 Ga0070685_10009708 3300005466 Bacteria 4984
48 Ga0070707_100018574 3300005468 Bacteria 6542
49 Ga0070707_100040652 3300005468 Bacteria 4449
50 Ga0070698_100073539 3300005471 Bacteria 3424
51 Ga0070679_100040055 3300005530 Bacteria 4660
52 Ga0070679_100360223 3300005530 Bacteria 1402
53 Ga0070684_100000113 3300005535 Bacteria 52618
54 Ga0070672_100008236 3300005543 Bacteria 7124
55 Ga0070672_100040554 3300005543 Bacteria 3573
56 Ga0070686_100013293 3300005544 Bacteria 4709
57 Ga0070695_100000001 3300005545 Bacteria 150757
58 Ga0070696_100008994 3300005546 Bacteria 6685
59 Ga0070693_100001560 3300005547 Bacteria 10350
60 Ga0070665_100007749 3300005548 Bacteria 10900
61 Ga0070665_100082857 3300005548 Bacteria 3212
62 Ga0070664_100040196 3300005564 Bacteria 3943
63 Ga0068857_100034956 3300005577 Bacteria 4447
64 Ga0068856_100043367 3300005614 Bacteria 4426
65 Ga0068856_100199045 3300005614 Bacteria 2018
66 Ga0068856_100212122 3300005614 Bacteria 1952
67 Ga0068856_100317061 3300005614 Bacteria 1576
68 Ga0068859_100324005 3300005617 Bacteria 1635
69 Ga0068866_10000367 3300005718 Bacteria 21182
70 Ga0068866_10151067 3300005718 Bacteria 1345
71 Ga0068861_100236203 3300005719 Bacteria 1553
72 Ga0068858_100362074 3300005842 Bacteria 1390
73 Ga0081539_10009136 3300005985 Bacteria 8375
74 Ga0081539_10012688 3300005985 Bacteria 6454
75 Ga0070717_10085774 3300006028 Bacteria 2651
76 Ga0070717_10280010 3300006028 Bacteria 1479
77 Ga0075365_10046232 3300006038 Bacteria 2858
78 Ga0075432_10008476 3300006058 Bacteria 3508
79 Ga0075432_10031878 3300006058 Bacteria 1825
80 Ga0097621_100029538 3300006237 Bacteria 4331
81 Ga0068871_100011123 3300006358 Bacteria 6597
82 Ga0075428_100040500 3300006844 Bacteria 5125
83 Ga0075430_100000333 3300006846 Bacteria 33874
84 Ga0075433_10028543 3300006852 Bacteria 4745
85 Ga0075434_100002180 3300006871 Bacteria 17076
86 Ga0075429_100004085 3300006880 Bacteria 12514
87 Ga0068865_100001537 3300006881 Bacteria 13461
88 Ga0068865_100013970 3300006881 Bacteria 5094
89 Ga0068865_100075756 3300006881 Bacteria 2400
90 Ga0075436_100001649 3300006914 Bacteria 15257
91 Ga0097620_100323993 3300006931 Bacteria 1635
92 Ga0075435_100016493 3300007076 Bacteria 5569
93 Ga0111539_10015848 3300009094 Bacteria 9363
94 Ga0111539_10035900 3300009094 Bacteria 6000
95 Ga0105245_10000687 3300009098 Bacteria 30520
96 Ga0105245_10003789 3300009098 Bacteria 13453
97 Ga0105245_10056061 3300009098 Bacteria 3541
98 Ga0105245_10069924 3300009098 Unclassified 3184
99 Ga0105245_10085607 3300009098 Bacteria 2889
100 Ga0105245_10453047 3300009098 Bacteria 1292
101 Ga0105247_10031834 3300009101 Bacteria 3202
102 Ga0114129_10003155 3300009147 Bacteria 23125
103 Ga0114129_10024795 3300009147 Bacteria 8502
104 Ga0114129_10109144 3300009147 Bacteria 3820
105 Ga0114129_10233178 3300009147 Bacteria 2478
106 Ga0105243_10041774 3300009148 Bacteria 3586
107 Ga0105243_10048614 3300009148 Bacteria 3344
108 Ga0105243_10225171 3300009148 Bacteria 1660
109 Ga0105237_10038940 3300009545 Bacteria 4800
110 Ga0105238_10012724 3300009551 Bacteria 8493
111 Ga0105249_10000455 3300009553 Bacteria 38320
112 Ga0105239_10022968 3300010375 Bacteria 6877
113 Ga0105239_10677606 3300010375 Bacteria 1178
114 Ga0157370_10005194 3300013104 Bacteria 14669
115 Ga0157370_10512175 3300013104 Bacteria 1102
116 Ga0157369_10004681 3300013105 Bacteria 16087
117 Ga0157369_10005518 3300013105 Bacteria 14689
118 Ga0157374_10020336 3300013296 Bacteria 5889
119 Ga0157378_10008722 3300013297 Bacteria 8825
120 Ga0157378_10374348 3300013297 Bacteria 1397
121 Ga0157372_10124134 3300013307 Bacteria 2968
122 Ga0157372_10181944 3300013307 Bacteria 2433
123 Ga0157372_10213700 3300013307 Bacteria 2235
124 Ga0157375_10033746 3300013308 Bacteria 4867
125 Ga0157375_10086894 3300013308 Bacteria 3179
126 Ga0163163_10158147 3300014325 Bacteria 2311
127 Ga0157380_10060276 3300014326 Bacteria 3032
128 Ga0157377_10018355 3300014745 Bacteria 3634
129 Ga0157377_10233167 3300014745 Bacteria 1185
130 Ga0157376_10032161 3300014969 Bacteria 4209
131 Ga0206354_10262150 3300020081 Bacteria 1813
132 Ga0206354_11180606 3300020081 Bacteria 1200
133 Ga0206353_11041139 3300020082 Bacteria 2562
134 Ga0206353_11173263 3300020082 Bacteria 2508
135 Ga0206353_11566952 3300020082 Bacteria 7367
136 Ga0207680_10058564 3300025903 Bacteria 2335
137 Ga0207705_10035380 3300025909 Bacteria 3572
138 Ga0207707_10006808 3300025912 Bacteria 9974
139 Ga0207707_10205112 3300025912 Bacteria 1718
140 Ga0207707_10351542 3300025912 Bacteria 1270
141 Ga0207695_10371686 3300025913 Bacteria 1316
142 Ga0207693_10001503 3300025915 Bacteria 20580
143 Ga0207693_10143749 3300025915 Bacteria 1876
144 Ga0207693_10357246 3300025915 Bacteria 1143
145 Ga0207663_10004073 3300025916 Bacteria 7251
146 Ga0207663_10180215 3300025916 Bacteria 1508
147 Ga0207663_10368789 3300025916 Bacteria 1091
148 Ga0207660_10003663 3300025917 Bacteria 10013
149 Ga0207657_10000325 3300025919 Bacteria 50816
150 Ga0207657_10069094 3300025919 Bacteria 2999
151 Ga0207657_10143348 3300025919 Bacteria 1951
152 Ga0207657_10189609 3300025919 Bacteria 1659
153 Ga0207652_10044380 3300025921 Bacteria 3787
154 Ga0207652_10194111 3300025921 Bacteria 1826
155 Ga0207646_10001907 3300025922 Bacteria 25107
156 Ga0207646_10014733 3300025922 Bacteria 7408
157 Ga0207646_10231070 3300025922 Bacteria 1671
158 Ga0207694_10069792 3300025924 Bacteria 2745
159 Ga0207687_10002131 3300025927 Bacteria 13486
160 Ga0207687_10044336 3300025927 Bacteria 3069
161 Ga0207687_10119682 3300025927 Bacteria 1967
162 Ga0207687_10171812 3300025927 Bacteria 1672
163 Ga0207687_10335978 3300025927 Bacteria 1227
164 Ga0207687_10497738 3300025927 Bacteria 1017
165 Ga0207700_10041412 3300025928 Bacteria 3369
166 Ga0207664_10044688 3300025929 Bacteria 3470
167 Ga0207664_10425629 3300025929 Bacteria 1183
168 Ga0207644_10125449 3300025931 Bacteria 1959
169 Ga0207690_10076956 3300025932 Bacteria 2318
170 Ga0207690_10313206 3300025932 Bacteria 1231
171 Ga0207686_10017325 3300025934 Bacteria 4058
172 Ga0207686_10050565 3300025934 Bacteria 2585
173 Ga0207709_10004193 3300025935 Bacteria 8364
174 Ga0207709_10048624 3300025935 Bacteria 2585
175 Ga0207709_10117115 3300025935 Bacteria 1792
176 Ga0207670_10183334 3300025936 Bacteria 1578
177 Ga0207669_10002233 3300025937 Bacteria 8229
178 Ga0207669_10036630 3300025937 Bacteria 2806
179 Ga0207704_10000598 3300025938 Bacteria 15955
180 Ga0207704_10015669 3300025938 Bacteria 3870
181 Ga0207665_10032804 3300025939 Bacteria 3438
182 Ga0207691_10068307 3300025940 Bacteria 3211
183 Ga0207711_10246202 3300025941 Bacteria 1640
184 Ga0207661_10002290 3300025944 Bacteria 13185
185 Ga0207661_10053674 3300025944 Bacteria 3226
186 Ga0207679_10011164 3300025945 Bacteria 5803
187 Ga0207667_10096057 3300025949 Bacteria 3058
188 Ga0207667_10274776 3300025949 Bacteria 1722
189 Ga0207640_10143211 3300025981 Bacteria 1745
190 Ga0207677_10036860 3300026023 Bacteria 3191
191 Ga0207677_10176431 3300026023 Bacteria 1677
192 Ga0207678_10016802 3300026067 Bacteria 6428
193 Ga0207708_10010898 3300026075 Bacteria 6763
194 Ga0207702_10069334 3300026078 Bacteria 3031
195 Ga0207702_10185583 3300026078 Bacteria 1918
196 Ga0207648_10000545 3300026089 Bacteria 42051
197 Ga0207648_10033046 3300026089 Bacteria 4564
198 Ga0207648_10128303 3300026089 Bacteria 2231
199 Ga0207674_10013813 3300026116 Bacteria 8934
200 Ga0207675_100413837 3300026118 Bacteria 1330
201 Ga0207683_10026434 3300026121 Bacteria 5009
202 Ga0207683_10124048 3300026121 Bacteria 2320
203 Ga0207698_10242818 3300026142 Bacteria 1643
204 Ga0207428_10011971 3300027907 Bacteria 7636
205 Ga0207428_10093274 3300027907 Bacteria 2335
206 Ga0268266_10187484 3300028379 Bacteria 1887
207 Ga0265337_1055214 3300028556 Bacteria 1110
208 Ga0265319_1012106 3300028563 Bacteria 3499
209 Ga0265322_10020553 3300028654 Bacteria 1892
210 Ga0265338_10003780 3300028800 Bacteria 21040
211 Ga0265338_10041576 3300028800 Bacteria 4297
212 Ga0265338_10085952 3300028800 Bacteria 2620
213 Ga0265338_10202884 3300028800 Bacteria 1494
214 Ga0265330_10028020 3300031235 Bacteria 2542
215 Ga0265332_10101857 3300031238 Bacteria 1211
216 Ga0265339_10008681 3300031249 Bacteria 6447
217 Ga0265327_10015996 3300031251 Bacteria 4799
218 Ga0265327_10046488 3300031251 Bacteria 2296
219 Ga0265327_10046743 3300031251 Bacteria 2288
220 Ga0265316_10016477 3300031344 Bacteria 6407
221 Ga0265316_10029736 3300031344 Bacteria 4487
222 Ga0265316_10273698 3300031344 Bacteria 1235
223 Ga0307408_100062932 3300031548 Bacteria 2713
224 Ga0265314_10009407 3300031711 Bacteria 8247
225 Ga0265314_10034318 3300031711 Bacteria 3709
226 Ga0307405_10128449 3300031731 Bacteria 1747
227 Ga0307409_100054699 3300031995 Bacteria 3076
228 Ga0307409_100135898 3300031995 Bacteria 2110
229 Ga0307416_100230192 3300032002 Bacteria 1786
230 Ga0307416_100286773 3300032002 Bacteria 1627
231 Ga0307415_100031741 3300032126 Bacteria 3407
232 Ga0373925_0147656 3300037068 Bacteria 1844
233 Ga0395899_0008953 3300037312 Bacteria 7702
234 Ga0395899_0021652 3300037312 Bacteria 4874
235 Ga0395899_0023447 3300037312 Bacteria 4673
236 Ga0395899_0182847 3300037312 Bacteria 1470
237 Ga0395900_0012907 3300037418 Bacteria 8533
238 Ga0395900_0019303 3300037418 Bacteria 6952
239 Ga0395900_0027190 3300037418 Bacteria 5858
240 Ga0395900_0034313 3300037418 Bacteria 5223
241 Ga0395900_0046389 3300037418 Bacteria 4474
242 Ga0395900_0063857 3300037418 Bacteria 3785
243 Ga0395900_0108270 3300037418 Bacteria 2855
244 Ga0395900_0458916 3300037418 Bacteria 1229
245 Ga0395898_0005318 3300037466 Bacteria 13917
246 Ga0395898_0010636 3300037466 Bacteria 9611
247 Ga0395898_0018457 3300037466 Bacteria 7112
248 Ga0395898_0030646 3300037466 Bacteria 5381
249 Ga0395898_0032242 3300037466 Bacteria 5229
250 Ga0395898_0049077 3300037466 Bacteria 4137
251 Ga0395898_0077466 3300037466 Bacteria 3209
252 Ga0395898_0093043 3300037466 Bacteria 2898
253 Ga0395898_0120094 3300037466 Bacteria 2518
254 Ga0395898_0217493 3300037466 Bacteria 1823
255 Ga0395905_0003978 3300037471 Bacteria 15547
256 Ga0395905_0006326 3300037471 Bacteria 11935
257 Ga0395905_0038046 3300037471 Bacteria 4513
258 Ga0395905_0072078 3300037471 Bacteria 3238
259 Ga0395905_0118327 3300037471 Bacteria 2490
260 Ga0395905_0249152 3300037471 Bacteria 1659
261 Ga0395905_0331616 3300037471 Bacteria 1412
262 Ga0395901_0003419 3300038443 Bacteria 15998
263 Ga0395901_0005854 3300038443 Bacteria 12435
264 Ga0395901_0006911 3300038443 Bacteria 11466
265 Ga0395901_0008395 3300038443 Bacteria 10439
266 Ga0395901_0008716 3300038443 Bacteria 10251
267 Ga0395901_0008732 3300038443 Bacteria 10242
268 Ga0395901_0030808 3300038443 Bacteria 5527
269 Ga0395901_0037401 3300038443 Bacteria 5020
270 Ga0395901_0042479 3300038443 Bacteria 4713
271 Ga0395901_0068432 3300038443 Bacteria 3698
272 Ga0395901_0070688 3300038443 Bacteria 3637
273 Ga0395901_0079664 3300038443 Bacteria 3420
274 Ga0395901_0172991 3300038443 Bacteria 2266
275 Ga0395901_0202332 3300038443 Bacteria 2081
276 Ga0395901_0349074 3300038443 Bacteria 1527
277 Ga0395901_0351543 3300038443 Bacteria 1521
278 Ga0395901_0405093 3300038443 Bacteria 1401
279 Ga0439439_0016793 3300041406 Bacteria 1795
280 Ga0439446_0014470 3300042156 Bacteria 2178
281 Ga0439434_0004869 3300042435 Bacteria 3927
282 Ga0466965_0021684 3300044683 Bacteria 3094
283 Ga0466965_0075396 3300044683 Bacteria 1701
284 Ga0466961_0007230 3300044693 Bacteria 7065
285 Ga0466961_0028299 3300044693 Bacteria 3603
286 Ga0466961_0154527 3300044693 Bacteria 1431
287 Ga0466963_0001763 3300044694 Bacteria 11797
288 Ga0466963_0001801 3300044694 Bacteria 11660
289 Ga0466963_0002004 3300044694 Bacteria 11188
290 Ga0466963_0005176 3300044694 Bacteria 7614
291 Ga0466963_0009132 3300044694 Bacteria 5962
292 Ga0466963_0009585 3300044694 Bacteria 5836
293 Ga0466963_0028037 3300044694 Bacteria 3611
294 Ga0466963_0041816 3300044694 Bacteria 3007
295 Ga0466963_0218263 3300044694 Bacteria 1335
296 Ga0466963_0317880 3300044694 Bacteria 1095
297 Ga0466964_0004954 3300044706 Bacteria 4922
298 Ga0466964_0084735 3300044706 Bacteria 1367
299 Ga0466971_0000286 3300044719 Bacteria 19348
300 Ga0466970_0030767 3300044765 Bacteria 2832
301 Ga0466957_0000016 3300044842 Bacteria 66255
302 Ga0466957_0004068 3300044842 Bacteria 8096
303 Ga0466960_0019453 3300044901 Bacteria 2993
304 Ga0466960_0137260 3300044901 Bacteria 1296
305 Ga0466959_0008299 3300045049 Bacteria 7336
306 Ga0466959_0074624 3300045049 Bacteria 2452
307 Ga0466959_0201272 3300045049 Bacteria 1386
308 Ga0466958_0002245 3300045836 Bacteria 9624
309 Ga0466958_0002729 3300045836 Bacteria 8957
310 Ga0466958_0005096 3300045836 Bacteria 7020
311 Ga0466967_0024299 3300045976 Bacteria 4980
312 Ga0466967_0179696 3300045976 Bacteria 1995
313 Ga0466967_0222038 3300045976 Bacteria 1796
314 Ga0466967_0356984 3300045976 Bacteria 1415
315 Ga0466967_0495380 3300045976 Bacteria 1198
316 Ga0495592_0116837 3300046454 Bacteria 1882
317 Ga0495603_0005016 3300046455 Bacteria 7918
318 Ga0495629_0109698 3300046459 Bacteria 1924
319 Ga0495629_0136865 3300046459 Bacteria 1705
320 Ga0495629_0256379 3300046459 Bacteria 1203
321 Ga0495641_0055606 3300046461 Bacteria 1796
322 Ga0495651_0114328 3300046462 Bacteria 1991
323 Ga0495653_0073727 3300046463 Bacteria 2546
324 Ga0495653_0125870 3300046463 Bacteria 1820
325 Ga0495653_0136706 3300046463 Bacteria 1728
326 Ga0495582_0041302 3300046473 Bacteria 2541
327 Ga0495664_0061543 3300046477 Bacteria 2235
328 Ga0495594_0003934 3300046499 Bacteria 7643
329 Ga0495620_0058821 3300046515 Bacteria 1608
330 Ga0495628_0085963 3300046516 Bacteria 2439
331 Ga0495630_0012132 3300046517 Bacteria 6248
332 Ga0495630_0172798 3300046517 Bacteria 1647
333 Ga0495666_0106521 3300046526 Bacteria 1319
334 Ga0495652_0140290 3300046529 Bacteria 1901
335 Ga0495640_0022230 3300046533 Bacteria 4640
336 Ga0495586_0094879 3300046535 Bacteria 1651
337 Ga0495609_0093043 3300046538 Bacteria 1310
338 Ga0495667_0007013 3300046559 Bacteria 7645
339 Ga0495667_0013180 3300046559 Bacteria 5599
340 Ga0495667_0076753 3300046559 Bacteria 2174
341 Ga0495634_0022800 3300046642 Bacteria 4410
342 Ga0495635_0298012 3300046663 Bacteria 1081
343 Ga0495659_0003833 3300046664 Bacteria 4779
344 Ga0495588_0070060 3300046674 Bacteria 1823
345 Ga0495657_0082430 3300046675 Bacteria 2078
346 Ga0495646_0063739 3300046680 Bacteria 2187
347 Ga0495658_0031554 3300046683 Bacteria 2887
348 Ga0495658_0104954 3300046683 Bacteria 1692
349 Ga0495581_0001973 3300047315 Bacteria 11505
350 Ga0495604_0059232 3300047317 Bacteria 2936
351 Ga0495604_0066644 3300047317 Bacteria 2738
352 Ga0495674_0001348 3300047319 Bacteria 23938
353 Ga0495676_0004108 3300047321 Bacteria 13268
354 Ga0495680_0002490 3300047322 Bacteria 18831
355 Ga0495680_0018679 3300047322 Bacteria 5876
356 Ga0495680_0029516 3300047322 Bacteria 4490
357 Ga0495680_0036590 3300047322 Bacteria 3940
358 Ga0495684_0025711 3300047471 Bacteria 4523
359 Ga0495684_0106971 3300047471 Bacteria 2113
360 Ga0495684_0127934 3300047471 Bacteria 1909
361 Ga0495602_0109913 3300048088 Bacteria 2242
362 Ga0495602_0208867 3300048088 Bacteria 1484
363 Ga0496100_0041592 3300048903 Bacteria 2930
364 Ga0496100_0162185 3300048903 Bacteria 1603
365 Ga0496101_0007207 3300048904 Bacteria 7198
366 Ga0496101_0041681 3300048904 Bacteria 3274
367 Ga0496101_0053287 3300048904 Bacteria 2918
368 Ga0496101_0080962 3300048904 Bacteria 2400
369 Ga0496101_0161115 3300048904 Bacteria 1720
370 Ga0496101_0181647 3300048904 Bacteria 1620
371 Ga0496102_0001468 3300048905 Bacteria 20840
372 Ga0496102_0010549 3300048905 Bacteria 7956
373 Ga0496103_0007049 3300048906 Bacteria 6710
374 Ga0496103_0009701 3300048906 Bacteria 5698
375 Ga0496103_0033475 3300048906 Bacteria 3140
376 Ga0496103_0044968 3300048906 Bacteria 2723
377 Ga0496103_0129916 3300048906 Bacteria 1608
378 Ga0496104_0024005 3300048907 Bacteria 5610
379 Ga0496104_0029043 3300048907 Bacteria 5127
380 Ga0496104_0034449 3300048907 Bacteria 4722
381 Ga0496104_0045817 3300048907 Bacteria 4114
382 Ga0496104_0341615 3300048907 Bacteria 1410
383 Ga0496105_0001435 3300048908 Bacteria 16762
384 Ga0496105_0058589 3300048908 Bacteria 3179
385 Ga0496105_0357614 3300048908 Bacteria 1165
386 Ga0496106_0001101 3300048909 Bacteria 19982
387 Ga0496106_0076856 3300048909 Bacteria 2559
388 Ga0496107_0023496 3300048910 Bacteria 4358
389 Ga0496107_0114074 3300048910 Bacteria 1988
390 Ga0496107_0262102 3300048910 Bacteria 1286
391 Ga0496107_0276138 3300048910 Bacteria 1251
392 Ga0496108_0013368 3300048911 Bacteria 6693
393 Ga0496108_0042557 3300048911 Bacteria 3792
394 Ga0496108_0220203 3300048911 Bacteria 1649
395 Ga0496108_0226133 3300048911 Bacteria 1626
396 Ga0496108_0391804 3300048911 Bacteria 1213
397 Ga0496109_0003818 3300048912 Bacteria 12582
398 Ga0496109_0006655 3300048912 Bacteria 9730
399 Ga0496109_0029448 3300048912 Bacteria 4917
400 Ga0496109_0030244 3300048912 Bacteria 4854
401 Ga0496109_0041485 3300048912 Bacteria 4168
402 Ga0496109_0305265 3300048912 Bacteria 1501
403 Ga0496110_0015946 3300048913 Bacteria 6266
404 Ga0496110_0079397 3300048913 Bacteria 2922
405 Ga0496110_0079997 3300048913 Bacteria 2911
406 Ga0496110_0142259 3300048913 Bacteria 2169
407 Ga0496110_0322099 3300048913 Bacteria 1408
408 Ga0496111_0048385 3300048914 Bacteria 3063
409 Ga0496111_0086881 3300048914 Bacteria 2289
410 Ga0496111_0178675 3300048914 Bacteria 1577
411 Ga0496111_0178807 3300048914 Bacteria 1577
412 Ga0496112_0000503 3300048915 Bacteria 26461
413 Ga0496112_0008408 3300048915 Bacteria 9243
414 Ga0496112_0013331 3300048915 Bacteria 7587
415 Ga0496112_0022455 3300048915 Bacteria 6014
416 Ga0496112_0047373 3300048915 Bacteria 4217
417 Ga0496112_0052723 3300048915 Bacteria 3993
418 Ga0496112_0215348 3300048915 Bacteria 1877
419 Ga0496113_0001382 3300048916 Bacteria 13467
420 Ga0496113_0030951 3300048916 Unclassified 3879
421 Ga0496113_0337051 3300048916 Bacteria 1209
422 Ga0496114_0000252 3300048917 Bacteria 38765
423 Ga0496114_0010739 3300048917 Bacteria 7289
424 Ga0496114_0011095 3300048917 Bacteria 7192
425 Ga0496114_0083706 3300048917 Bacteria 2699
426 Ga0496114_0097182 3300048917 Bacteria 2508
427 Ga0496114_0130870 3300048917 Bacteria 2167
428 Ga0496115_0000516 3300048918 Bacteria 30049
429 Ga0496115_0005736 3300048918 Bacteria 9038
430 Ga0496115_0039695 3300048918 Bacteria 3739
431 Ga0496115_0070096 3300048918 Bacteria 2841
432 Ga0501031_0003266 3300049568 Bacteria 10420
433 Ga0501032_0028637 3300049569 Bacteria 3827
434 Ga0501033_0044861 3300049570 Bacteria 3291
435 Ga0501036_0052484 3300049572 Bacteria 3453
436 Ga0501036_0073133 3300049572 Bacteria 2898
437 Ga0501038_0124136 3300049574 Bacteria 2126
438 Ga0501040_0108180 3300049576 Bacteria 1943
439 Ga0501041_0005270 3300049577 Bacteria 7559
440 Ga0501041_0042930 3300049577 Bacteria 2748
441 Ga0501042_0022577 3300049578 Bacteria 4396
442 Ga0501042_0190090 3300049578 Bacteria 1481
443 Ga0501042_0205470 3300049578 Bacteria 1420
444 Ga0501043_0049901 3300049579 Bacteria 3290
445 Ga0501046_0019157 3300049580 Bacteria 5677
446 Ga0501047_0193654 3300049581 Bacteria 1896
447 Ga0501048_0005524 3300049582 Bacteria 9619
448 Ga0501067_0033655 3300049583 Bacteria 2843
449 Ga0501067_0045190 3300049583 Bacteria 2446
450 Ga0501067_0053574 3300049583 Bacteria 2235
451 Ga0501068_0014759 3300049584 Bacteria 4470
452 Ga0501068_0093098 3300049584 Bacteria 1861
453 Ga0501069_0016720 3300049585 Bacteria 3942
454 Ga0501069_0058861 3300049585 Bacteria 2144
455 Ga0501069_0148019 3300049585 Bacteria 1348
456 Ga0501070_0008644 3300049586 Bacteria 8606
457 Ga0501070_0031565 3300049586 Bacteria 4438
458 Ga0501070_0138614 3300049586 Bacteria 2008
459 Ga0501071_0002039 3300049587 Bacteria 12093
460 Ga0501071_0008845 3300049587 Bacteria 6676
461 Ga0501071_0008999 3300049587 Bacteria 6627
462 Ga0501072_0005526 3300049588 Bacteria 9620
463 Ga0501072_0014066 3300049588 Bacteria 6133
464 Ga0501074_0029889 3300049590 Bacteria 3948
465 Ga0501074_0095234 3300049590 Bacteria 2132
466 Ga0501075_0042775 3300049591 Bacteria 3397
467 Ga0501075_0137115 3300049591 Bacteria 1864
468 Ga0501076_0003885 3300049592 Bacteria 10525
469 Ga0501076_0009847 3300049592 Bacteria 7065
470 Ga0501077_0001254 3300049593 Bacteria 15334
471 Ga0501077_0014698 3300049593 Bacteria 4919
472 Ga0501079_0010609 3300049741 Bacteria 7010
473 Ga0501080_0003511 3300049742 Bacteria 13806
474 Ga0501080_0046425 3300049742 Bacteria 4044
475 Ga0501080_0085486 3300049742 Bacteria 2931
476 Ga0501081_0005562 3300049743 Bacteria 8137
477 Ga0501081_0087421 3300049743 Bacteria 2189
478 Ga0501081_0104752 3300049743 Bacteria 2003
479 Ga0501083_0057599 3300049744 Bacteria 2601
480 Ga0501044_0293762 3300049823 Bacteria 1556
481 Ga0501045_0000260 3300049824 Bacteria 30596
482 Ga0501045_0009174 3300049824 Bacteria 6913
483 nmdc:mga0yw44_37492_c1 3300050492 Bacteria 2862
484 nmdc:mga05p37_175181_c1 3300050507 Bacteria 2614
485 nmdc:mga05p37_217374_c1 3300050507 Bacteria 2308
486 nmdc:mga05p37_48650_c1 3300050507 Bacteria 5214
487 nmdc:mga09592_68985_c1 3300050508 Bacteria 3000
488 nmdc:mga0qj67_45334_c1 3300050509 Bacteria 3470
489 nmdc:mga06r32_109255_c1 3300050510 Bacteria 2720
490 nmdc:mga08y16_24650_c1 3300050511 Bacteria 6350
491 nmdc:mga08y16_27196_c1 3300050511 Bacteria 6026
492 nmdc:mga0n895_186796_c1 3300050512 Bacteria 2103
493 nmdc:mga0rr50_20848_c1 3300050513 Bacteria 4462
494 nmdc:mga08x19_24749_c1 3300050514 Bacteria 3735
495 nmdc:mga0a205_176694_c1 3300050515 Bacteria 2030
496 nmdc:mga0a205_179966_c1 3300050515 Bacteria 2009
497 Ga0495595_0166814 3300053084 Bacteria 1088
498 Ga0495619_0035345 3300053085 Bacteria 3249
499 Ga0501084_0016613 3300054114 Bacteria 6111
500 Ga0501084_0204441 3300054114 Bacteria 1667
501 Ga0501084_0313693 3300054114 Bacteria 1324
502 Ga0590077_020278 3300059426 Bacteria 1411
503 Ga0501082_0006823 3300060353 Bacteria 9869
504 Ga0501082_0165081 3300060353 Bacteria 1924
505 Ga0466962_0000594 3300061719 Bacteria 15979
506 Ga0466962_0008194 3300061719 Bacteria 5013
507 Ga0530510_0024468 3300061734 Bacteria 4309
508 Ga0530510_0131518 3300061734 Bacteria 1841
509 Ga0395900_0066944
510 JGI25406J46586_10010829
511 Ga0070683_100000325
512 Ga0070683_100016044
513 Ga0070683_100129483
514 Ga0070680_100009997
515 Ga0070680_100087432
516 Ga0070682_100012354
517 Ga0068868_100075873
518 Ga0068868_100195206
519 Ga0070660_100032787
520 Ga0070660_100085952
521 Ga0070660_100091992
522 Ga0070660_100181702
523 Ga0070689_100040491
524 Ga0070687_100033469
525 Ga0070692_10012128
526 Ga0070692_10066959
527 Ga0070668_100190915
528 Ga0070674_100000613
529 Ga0070674_100004127
530 Ga0070674_100034577
531 Ga0070673_100017119
532 Ga0070688_100067026
533 Ga0070659_100003356
534 Ga0070659_100008259
535 Ga0070659_100194552
536 Ga0070709_10143273
537 Ga0070714_100059930
538 Ga0070714_100082903
539 Ga0070714_100217900
540 Ga0070713_100343069
541 Ga0070701_10005686
542 Ga0070701_10090627
543 Ga0070711_100036654
544 Ga0070711_100452834
545 Ga0070705_100027102
546 Ga0070705_100027349
547 Ga0070708_100070585
548 Ga0070663_100011406
549 Ga0070678_100033133
550 Ga0070681_10007692
551 Ga0070681_10029861
552 Ga0070681_10281671
553 Ga0068867_100001632
554 Ga0068867_100104877
555 Ga0070685_10009708
556 Ga0070707_100018574
557 Ga0070707_100040652
558 Ga0070698_100073539
559 Ga0070679_100040055
560 Ga0070679_100360223
561 Ga0070684_100000113
562 Ga0070672_100008236
563 Ga0070672_100040554
564 Ga0070686_100013293
565 Ga0070695_100000001
566 Ga0070696_100008994
567 Ga0070693_100001560
568 Ga0070665_100007749
569 Ga0070665_100082857
570 Ga0070664_100040196
571 Ga0068857_100034956
572 Ga0068856_100043367
573 Ga0068856_100199045
574 Ga0068856_100212122
575 Ga0068856_100317061
576 Ga0068859_100324005
577 Ga0068866_10000367
578 Ga0068866_10151067
579 Ga0068861_100236203
580 Ga0068858_100362074
581 Ga0081539_10009136
582 Ga0081539_10012688
583 Ga0070717_10085774
584 Ga0070717_10280010
585 Ga0075365_10046232
586 Ga0075432_10008476
587 Ga0075432_10031878
588 Ga0097621_100029538
589 Ga0068871_100011123
590 Ga0075428_100040500
591 Ga0075430_100000333
592 Ga0075433_10028543
593 Ga0075434_100002180
594 Ga0075429_100004085
595 Ga0068865_100001537
596 Ga0068865_100013970
597 Ga0068865_100075756
598 Ga0075436_100001649
599 Ga0097620_100323993
600 Ga0075435_100016493
601 Ga0111539_10015848
602 Ga0111539_10035900
603 Ga0105245_10000687
604 Ga0105245_10003789
605 Ga0105245_10056061
606 Ga0105245_10069924
607 Ga0105245_10085607
608 Ga0105245_10453047
609 Ga0105247_10031834
610 Ga0114129_10003155
611 Ga0114129_10024795
612 Ga0114129_10109144
613 Ga0114129_10233178
614 Ga0105243_10041774
615 Ga0105243_10048614
616 Ga0105243_10225171
617 Ga0105237_10038940
618 Ga0105238_10012724
619 Ga0105249_10000455
620 Ga0105239_10022968
621 Ga0105239_10677606
622 Ga0157370_10005194
623 Ga0157370_10512175
624 Ga0157369_10004681
625 Ga0157369_10005518
626 Ga0157374_10020336
627 Ga0157378_10008722
628 Ga0157378_10374348
629 Ga0157372_10124134
630 Ga0157372_10181944
631 Ga0157372_10213700
632 Ga0157375_10033746
633 Ga0157375_10086894
634 Ga0163163_10158147
635 Ga0157380_10060276
636 Ga0157377_10018355
637 Ga0157377_10233167
638 Ga0157376_10032161
639 Ga0206354_10262150
640 Ga0206354_11180606
641 Ga0206353_11041139
642 Ga0206353_11173263
643 Ga0206353_11566952
644 Ga0207680_10058564
645 Ga0207705_10035380
646 Ga0207707_10006808
647 Ga0207707_10205112
648 Ga0207707_10351542
649 Ga0207695_10371686
650 Ga0207693_10001503
651 Ga0207693_10143749
652 Ga0207693_10357246
653 Ga0207663_10004073
654 Ga0207663_10180215
655 Ga0207663_10368789
656 Ga0207660_10003663
657 Ga0207657_10000325
658 Ga0207657_10069094
659 Ga0207657_10143348
660 Ga0207657_10189609
661 Ga0207652_10044380
662 Ga0207652_10194111
663 Ga0207646_10001907
664 Ga0207646_10014733
665 Ga0207646_10231070
666 Ga0207694_10069792
667 Ga0207687_10002131
668 Ga0207687_10044336
669 Ga0207687_10119682
670 Ga0207687_10171812
671 Ga0207687_10335978
672 Ga0207687_10497738
673 Ga0207700_10041412
674 Ga0207664_10044688
675 Ga0207664_10425629
676 Ga0207644_10125449
677 Ga0207690_10076956
678 Ga0207690_10313206
679 Ga0207686_10017325
680 Ga0207686_10050565
681 Ga0207709_10004193
682 Ga0207709_10048624
683 Ga0207709_10117115
684 Ga0207670_10183334
685 Ga0207669_10002233
686 Ga0207669_10036630
687 Ga0207704_10000598
688 Ga0207704_10015669
689 Ga0207665_10032804
690 Ga0207691_10068307
691 Ga0207711_10246202
692 Ga0207661_10002290
693 Ga0207661_10053674
694 Ga0207679_10011164
695 Ga0207667_10096057
696 Ga0207667_10274776
697 Ga0207640_10143211
698 Ga0207677_10036860
699 Ga0207677_10176431
700 Ga0207678_10016802
701 Ga0207708_10010898
702 Ga0207702_10069334
703 Ga0207702_10185583
704 Ga0207648_10000545
705 Ga0207648_10033046
706 Ga0207648_10128303
707 Ga0207674_10013813
708 Ga0207675_100413837
709 Ga0207683_10026434
710 Ga0207683_10124048
711 Ga0207698_10242818
712 Ga0207428_10011971
713 Ga0207428_10093274
714 Ga0268266_10187484
715 Ga0265337_1055214
716 Ga0265319_1012106
717 Ga0265322_10020553
718 Ga0265338_10003780
719 Ga0265338_10041576
720 Ga0265338_10085952
721 Ga0265338_10202884
722 Ga0265330_10028020
723 Ga0265332_10101857
724 Ga0265339_10008681
725 Ga0265327_10015996
726 Ga0265327_10046488
727 Ga0265327_10046743
728 Ga0265316_10016477
729 Ga0265316_10029736
730 Ga0265316_10273698
731 Ga0307408_100062932
732 Ga0265314_10009407
733 Ga0265314_10034318
734 Ga0307405_10128449
735 Ga0307409_100054699
736 Ga0307409_100135898
737 Ga0307416_100230192
738 Ga0307416_100286773
739 Ga0307415_100031741
740 Ga0373925_0147656
741 Ga0395899_0008953
742 Ga0395899_0021652
743 Ga0395899_0023447
744 Ga0395899_0182847
745 Ga0395900_0012907
746 Ga0395900_0019303
747 Ga0395900_0027190
748 Ga0395900_0034313
749 Ga0395900_0046389
750 Ga0395900_0063857
751 Ga0395900_0108270
752 Ga0395900_0458916
753 Ga0395898_0005318
754 Ga0395898_0010636
755 Ga0395898_0018457
756 Ga0395898_0030646
757 Ga0395898_0032242
758 Ga0395898_0049077
759 Ga0395898_0077466
760 Ga0395898_0093043
761 Ga0395898_0120094
762 Ga0395898_0217493
763 Ga0395905_0003978
764 Ga0395905_0006326
765 Ga0395905_0038046
766 Ga0395905_0072078
767 Ga0395905_0118327
768 Ga0395905_0249152
769 Ga0395905_0331616
770 Ga0395901_0003419
771 Ga0395901_0005854
772 Ga0395901_0006911
773 Ga0395901_0008395
774 Ga0395901_0008716
775 Ga0395901_0008732
776 Ga0395901_0030808
777 Ga0395901_0037401
778 Ga0395901_0042479
779 Ga0395901_0068432
780 Ga0395901_0070688
781 Ga0395901_0079664
782 Ga0395901_0172991
783 Ga0395901_0202332
784 Ga0395901_0349074
785 Ga0395901_0351543
786 Ga0395901_0405093
787 Ga0439439_0016793
788 Ga0439446_0014470
789 Ga0439434_0004869
790 Ga0466965_0021684
791 Ga0466965_0075396
792 Ga0466961_0007230
793 Ga0466961_0028299
794 Ga0466961_0154527
795 Ga0466963_0001763
796 Ga0466963_0001801
797 Ga0466963_0002004
798 Ga0466963_0005176
799 Ga0466963_0009132
800 Ga0466963_0009585
801 Ga0466963_0028037
802 Ga0466963_0041816
803 Ga0466963_0218263
804 Ga0466963_0317880
805 Ga0466964_0004954
806 Ga0466964_0084735
807 Ga0466971_0000286
808 Ga0466970_0030767
809 Ga0466957_0000016
810 Ga0466957_0004068
811 Ga0466960_0019453
812 Ga0466960_0137260
813 Ga0466959_0008299
814 Ga0466959_0074624
815 Ga0466959_0201272
816 Ga0466958_0002245
817 Ga0466958_0002729
818 Ga0466958_0005096
819 Ga0466967_0024299
820 Ga0466967_0179696
821 Ga0466967_0222038
822 Ga0466967_0356984
823 Ga0466967_0495380
824 Ga0495592_0116837
825 Ga0495603_0005016
826 Ga0495629_0109698
827 Ga0495629_0136865
828 Ga0495629_0256379
829 Ga0495641_0055606
830 Ga0495651_0114328
831 Ga0495653_0073727
832 Ga0495653_0125870
833 Ga0495653_0136706
834 Ga0495582_0041302
835 Ga0495664_0061543
836 Ga0495594_0003934
837 Ga0495620_0058821
838 Ga0495628_0085963
839 Ga0495630_0012132
840 Ga0495630_0172798
841 Ga0495666_0106521
842 Ga0495652_0140290
843 Ga0495640_0022230
844 Ga0495586_0094879
845 Ga0495609_0093043
846 Ga0495667_0007013
847 Ga0495667_0013180
848 Ga0495667_0076753
849 Ga0495634_0022800
850 Ga0495635_0298012
851 Ga0495659_0003833
852 Ga0495588_0070060
853 Ga0495657_0082430
854 Ga0495646_0063739
855 Ga0495658_0031554
856 Ga0495658_0104954
857 Ga0495581_0001973
858 Ga0495604_0059232
859 Ga0495604_0066644
860 Ga0495674_0001348
861 Ga0495676_0004108
862 Ga0495680_0002490
863 Ga0495680_0018679
864 Ga0495680_0029516
865 Ga0495680_0036590
866 Ga0495684_0025711
867 Ga0495684_0106971
868 Ga0495684_0127934
869 Ga0495602_0109913
870 Ga0495602_0208867
871 Ga0496100_0041592
872 Ga0496100_0162185
873 Ga0496101_0007207
874 Ga0496101_0041681
875 Ga0496101_0053287
876 Ga0496101_0080962
877 Ga0496101_0161115
878 Ga0496101_0181647
879 Ga0496102_0001468
880 Ga0496102_0010549
881 Ga0496103_0007049
882 Ga0496103_0009701
883 Ga0496103_0033475
884 Ga0496103_0044968
885 Ga0496103_0129916
886 Ga0496104_0024005
887 Ga0496104_0029043
888 Ga0496104_0034449
889 Ga0496104_0045817
890 Ga0496104_0341615
891 Ga0496105_0001435
892 Ga0496105_0058589
893 Ga0496105_0357614
894 Ga0496106_0001101
895 Ga0496106_0076856
896 Ga0496107_0023496
897 Ga0496107_0114074
898 Ga0496107_0262102
899 Ga0496107_0276138
900 Ga0496108_0013368
901 Ga0496108_0042557
902 Ga0496108_0220203
903 Ga0496108_0226133
904 Ga0496108_0391804
905 Ga0496109_0003818
906 Ga0496109_0006655
907 Ga0496109_0029448
908 Ga0496109_0030244
909 Ga0496109_0041485
910 Ga0496109_0305265
911 Ga0496110_0015946
912 Ga0496110_0079397
913 Ga0496110_0079997
914 Ga0496110_0142259
915 Ga0496110_0322099
916 Ga0496111_0048385
917 Ga0496111_0086881
918 Ga0496111_0178675
919 Ga0496111_0178807
920 Ga0496112_0000503
921 Ga0496112_0008408
922 Ga0496112_0013331
923 Ga0496112_0022455
924 Ga0496112_0047373
925 Ga0496112_0052723
926 Ga0496112_0215348
927 Ga0496113_0001382
928 Ga0496113_0030951
929 Ga0496113_0337051
930 Ga0496114_0000252
931 Ga0496114_0010739
932 Ga0496114_0011095
933 Ga0496114_0083706
934 Ga0496114_0097182
935 Ga0496114_0130870
936 Ga0496115_0000516
937 Ga0496115_0005736
938 Ga0496115_0039695
939 Ga0496115_0070096
940 Ga0501031_0003266
941 Ga0501032_0028637
942 Ga0501033_0044861
943 Ga0501036_0052484
944 Ga0501036_0073133
945 Ga0501038_0124136
946 Ga0501040_0108180
947 Ga0501041_0005270
948 Ga0501041_0042930
949 Ga0501042_0022577
950 Ga0501042_0190090
951 Ga0501042_0205470
952 Ga0501043_0049901
953 Ga0501046_0019157
954 Ga0501047_0193654
955 Ga0501048_0005524
956 Ga0501067_0033655
957 Ga0501067_0045190
958 Ga0501067_0053574
959 Ga0501068_0014759
960 Ga0501068_0093098
961 Ga0501069_0016720
962 Ga0501069_0058861
963 Ga0501069_0148019
964 Ga0501070_0008644
965 Ga0501070_0031565
966 Ga0501070_0138614
967 Ga0501071_0002039
968 Ga0501071_0008845
969 Ga0501071_0008999
970 Ga0501072_0005526
971 Ga0501072_0014066
972 Ga0501074_0029889
973 Ga0501074_0095234
974 Ga0501075_0042775
975 Ga0501075_0137115
976 Ga0501076_0003885
977 Ga0501076_0009847
978 Ga0501077_0001254
979 Ga0501077_0014698
980 Ga0501079_0010609
981 Ga0501080_0003511
982 Ga0501080_0046425
983 Ga0501080_0085486
984 Ga0501081_0005562
985 Ga0501081_0087421
986 Ga0501081_0104752
987 Ga0501083_0057599
988 Ga0501044_0293762
989 Ga0501045_0000260
990 Ga0501045_0009174
991 nmdc:mga0yw44_37492_c1
992 nmdc:mga05p37_175181_c1
993 nmdc:mga05p37_217374_c1
994 nmdc:mga05p37_48650_c1
995 nmdc:mga09592_68985_c1
996 nmdc:mga0qj67_45334_c1
997 nmdc:mga06r32_109255_c1
998 nmdc:mga08y16_24650_c1
999 nmdc:mga08y16_27196_c1
1000 nmdc:mga0n895_186796_c1
1001 nmdc:mga0rr50_20848_c1
1002 nmdc:mga08x19_24749_c1
1003 nmdc:mga0a205_176694_c1
1004 nmdc:mga0a205_179966_c1
1005 Ga0495595_0166814
1006 Ga0495619_0035345
1007 Ga0501084_0016613
1008 Ga0501084_0204441
1009 Ga0501084_0313693
1010 Ga0590077_020278
1011 Ga0501082_0006823
1012 Ga0501082_0165081
1013 Ga0466962_0000594
1014 Ga0466962_0008194
1015 Ga0530510_0024468
1016 Ga0530510_0131518

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

4

231

0.95

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

34

294

0.79

PF04321

RmlD_sub_bind

RmlD substrate binding domain

2

299

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ewu-assembly1.cif.gz_A x-ray structure of the gdp-6-deoxy-4-keto-d-lyxo-heptose-4-reductase from campylobacter jejuni hs:15 0.8794 4 297
4bl5-assembly6.cif.gz_C crystal structure of human gdp-l-fucose synthase with bound nadp and product gdp-l-fucose 0.8762 2 299
1e6u-assembly1.cif.gz_A-2 gdp 4-keto-6-deoxy-d-mannose epimerase reductase 0.8709 4 300
1e7q-assembly1.cif.gz_A-2 gdp 4-keto-6-deoxy-d-mannose epimerase reductase s107a 0.8696 4 300
1e7r-assembly1.cif.gz_A-2 gdp 4-keto-6-deoxy-d-mannose epimerase reductase y136e 0.8691 4 300
ID Description Score Start End Superfamily
6aqyC02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.8853 165 300 3.90.25.10
6aqyC02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.8679 165 300 3.90.25.10
1e6uA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.8599 165 300 3.90.25.10
4ef7B02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.8479 177 299 3.90.25.10
6dntA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.8448 165 299 3.90.25.10
ID Description Score Start End GO Terms
AF-A0A2N1UYU1-F1-model_v4 GDP-fucose synthetase 0.9691 191 299 GO:0050577
AF-A0A7C2Y559-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9619 133 299 GO:0050577
AF-Q8YBP7-F1-model_v4 Gdp-fucose synthetase (EC 5.1.3.-) 0.9619 194 299 GO:0016853
GO:0050577
AF-X1L6D6-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9614 190 302 GO:0050577
AF-X1NIM8-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9481 156 300 GO:0050577

Map