F456828

General Info

Members Datasets Scaffolds Average Seq Length
508 195 1016 128

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10116752|Ga0316576_101167522
Length 146
Sequence MIRMNDQQIDQLVAAAEAVRENAYAPYSGFAVGAAVMADDGRVFAGCNVENASYGLGVCAERHAVAAAVAAGCRTIVGLAVVTASNPPAAPCGACRQVLAEFGDYPVVLANPDGVRETTTVRRLLPSAFDRDTLERARQEVRRGAS

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
115 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
116 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
117 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
118 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
119 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
120 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
127 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
130 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
133 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
136 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
162 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
163 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
164 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
165 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
166 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
167 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
168 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
169 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
175 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
176 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
177 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
178 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
179 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.38
Rhizosphere 98.43
Stem 0
Stem Tuber 0
Unclassified 10.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10116752 3300031727 Bacteria 2002
2 rootL2_10082236 3300003322 Bacteria 2297
3 Ga0065715_10109182 3300005293 Bacteria 2680
4 Ga0070683_100083025 3300005329 Bacteria 3001
5 Ga0070670_101040993 3300005331 Bacteria 745
6 Ga0070680_100057733 3300005336 Bacteria 3173
7 Ga0070680_100073829 3300005336 Bacteria 2806
8 Ga0070680_100567169 3300005336 Bacteria 973
9 Ga0070682_100258230 3300005337 Bacteria 1260
10 Ga0068868_101784428 3300005338 Bacteria 581
11 Ga0070691_10603403 3300005341 Bacteria 648
12 Ga0070687_100654447 3300005343 Bacteria 728
13 Ga0070661_100510588 3300005344 Bacteria 963
14 Ga0070661_100542559 3300005344 Bacteria 935
15 Ga0070669_100602923 3300005353 Bacteria 920
16 Ga0070675_101001690 3300005354 Bacteria 767
17 Ga0070659_100073652 3300005366 Bacteria 2719
18 Ga0070703_10005100 3300005406 Bacteria 3670
19 Ga0070703_10033196 3300005406 Bacteria 1570
20 Ga0070703_10073139 3300005406 Bacteria 1150
21 Ga0070703_10127452 3300005406 Bacteria 931
22 Ga0070709_10040125 3300005434 Bacteria 2876
23 Ga0070714_100537509 3300005435 Bacteria 1118
24 Ga0070713_100296429 3300005436 Bacteria 1488
25 Ga0070713_100522653 3300005436 Bacteria 1121
26 Ga0070710_10463263 3300005437 Bacteria 861
27 Ga0070711_100000212 3300005439 Bacteria 30680
28 Ga0070705_100024218 3300005440 Bacteria 3273
29 Ga0070705_100202740 3300005440 Bacteria 1361
30 Ga0070705_101091195 3300005440 Bacteria 652
31 Ga0070700_100447006 3300005441 Bacteria 983
32 Ga0070700_100747595 3300005441 Bacteria 782
33 Ga0070694_100011508 3300005444 Bacteria 5478
34 Ga0070694_100018990 3300005444 Bacteria 4368
35 Ga0070694_100052741 3300005444 Bacteria 2750
36 Ga0070694_100055276 3300005444 Bacteria 2692
37 Ga0070694_100079662 3300005444 Bacteria 2274
38 Ga0070694_100313601 3300005444 Bacteria 1205
39 Ga0070694_100816833 3300005444 Bacteria 765
40 Ga0070708_100009867 3300005445 Bacteria 7713
41 Ga0070708_100020461 3300005445 Bacteria 5579
42 Ga0070708_100044858 3300005445 Bacteria 3891
43 Ga0070708_100059947 3300005445 Bacteria 3395
44 Ga0070708_100069813 3300005445 Unclassified 3159
45 Ga0070708_100139032 3300005445 Bacteria 2251
46 Ga0070708_100154588 3300005445 Bacteria 2135
47 Ga0070708_100494224 3300005445 Bacteria 1154
48 Ga0070663_100696867 3300005455 Bacteria 863
49 Ga0070662_101029966 3300005457 Bacteria 705
50 Ga0070662_101815338 3300005457 Bacteria 527
51 Ga0070681_10032514 3300005458 Bacteria 5236
52 Ga0070681_10504990 3300005458 Bacteria 1122
53 Ga0070706_100020787 3300005467 Bacteria 6044
54 Ga0070706_100032905 3300005467 Bacteria 4783
55 Ga0070706_100035615 3300005467 Bacteria 4595
56 Ga0070706_100040057 3300005467 Bacteria 4325
57 Ga0070706_100145755 3300005467 Bacteria 2211
58 Ga0070706_100191982 3300005467 Bacteria 1908
59 Ga0070706_100215428 3300005467 Bacteria 1793
60 Ga0070706_100471714 3300005467 Bacteria 1168
61 Ga0070707_100041918 3300005468 Bacteria 4382
62 Ga0070707_100049729 3300005468 Unclassified 4018
63 Ga0070707_100058876 3300005468 Bacteria 3685
64 Ga0070707_100083089 3300005468 Bacteria 3094
65 Ga0070707_100198306 3300005468 Bacteria 1957
66 Ga0070698_100007150 3300005471 Bacteria 12091
67 Ga0070698_100039591 3300005471 Bacteria 4850
68 Ga0070698_100373674 3300005471 Bacteria 1358
69 Ga0070698_100969081 3300005471 Bacteria 797
70 Ga0070698_101156444 3300005471 Bacteria 723
71 Ga0070699_100008485 3300005518 Bacteria 8902
72 Ga0070699_100023165 3300005518 Bacteria 5350
73 Ga0070699_100030438 3300005518 Bacteria 4659
74 Ga0070699_100075795 3300005518 Bacteria 2928
75 Ga0070699_100122573 3300005518 Bacteria 2287
76 Ga0070699_100152140 3300005518 Bacteria 2047
77 Ga0070699_100199445 3300005518 Bacteria 1779
78 Ga0070699_100271841 3300005518 Bacteria 1517
79 Ga0070699_100413127 3300005518 Bacteria 1221
80 Ga0070699_100691808 3300005518 Bacteria 931
81 Ga0070679_100124104 3300005530 Bacteria 2565
82 Ga0070679_100719943 3300005530 Bacteria 941
83 Ga0070697_100006385 3300005536 Bacteria 9128
84 Ga0070697_100035295 3300005536 Unclassified 4033
85 Ga0070697_100035915 3300005536 Bacteria 4000
86 Ga0070697_100039409 3300005536 Bacteria 3820
87 Ga0070697_100049818 3300005536 Bacteria 3399
88 Ga0070697_100065893 3300005536 Bacteria 2961
89 Ga0070697_100240556 3300005536 Unclassified 1545
90 Ga0070697_100323475 3300005536 Bacteria 1328
91 Ga0070697_100361191 3300005536 Bacteria 1255
92 Ga0070697_100903879 3300005536 Unclassified 783
93 Ga0070697_101434190 3300005536 Bacteria 617
94 Ga0070695_100002580 3300005545 Bacteria 10459
95 Ga0070695_100007118 3300005545 Bacteria 6630
96 Ga0070695_100217967 3300005545 Bacteria 1373
97 Ga0070695_100390327 3300005545 Bacteria 1053
98 Ga0070695_101123319 3300005545 Bacteria 644
99 Ga0070696_100027246 3300005546 Bacteria 3892
100 Ga0070696_100167565 3300005546 Bacteria 1622
101 Ga0070696_100213935 3300005546 Bacteria 1444
102 Ga0070696_100370122 3300005546 Bacteria 1114
103 Ga0070696_100399125 3300005546 Bacteria 1075
104 Ga0070696_100632045 3300005546 Bacteria 866
105 Ga0070696_102007364 3300005546 Bacteria 502
106 Ga0070693_100086560 3300005547 Unclassified 1880
107 Ga0070693_100212163 3300005547 Bacteria 1264
108 Ga0070704_100005974 3300005549 Bacteria 7135
109 Ga0070704_100026807 3300005549 Bacteria 3813
110 Ga0070704_100168938 3300005549 Bacteria 1737
111 Ga0070704_100213150 3300005549 Bacteria 1566
112 Ga0070704_100332188 3300005549 Bacteria 1277
113 Ga0070704_100360865 3300005549 Bacteria 1229
114 Ga0070664_100076550 3300005564 Bacteria 2876
115 Ga0070664_100084053 3300005564 Bacteria 2747
116 Ga0070664_100412076 3300005564 Bacteria 1237
117 Ga0070664_101444053 3300005564 Bacteria 651
118 Ga0068854_100551130 3300005578 Bacteria 978
119 Ga0070702_100170315 3300005615 Bacteria 1416
120 Ga0068852_100322073 3300005616 Bacteria 1502
121 Ga0068864_101068065 3300005618 Bacteria 803
122 Ga0068864_102061055 3300005618 Bacteria 577
123 Ga0068861_100586620 3300005719 Bacteria 1021
124 Ga0068870_10572682 3300005840 Bacteria 763
125 Ga0081538_10047581 3300005981 Bacteria 2628
126 Ga0070716_100094117 3300006173 Bacteria 1821
127 Ga0070712_100216323 3300006175 Bacteria 1514
128 Ga0075428_100034705 3300006844 Bacteria 5563
129 Ga0075428_100194499 3300006844 Unclassified 2194
130 Ga0075428_100282341 3300006844 Bacteria 1786
131 Ga0075428_100665807 3300006844 Bacteria 1110
132 Ga0075428_100780825 3300006844 Bacteria 1016
133 Ga0075428_101649040 3300006844 Bacteria 670
134 Ga0075430_100417813 3300006846 Bacteria 1107
135 Ga0075431_100120917 3300006847 Unclassified 2702
136 Ga0075431_100262384 3300006847 Bacteria 1753
137 Ga0075431_100744719 3300006847 Unclassified 956
138 Ga0075433_10011590 3300006852 Bacteria 7101
139 Ga0075433_10040143 3300006852 Bacteria 4050
140 Ga0075433_10043563 3300006852 Bacteria 3896
141 Ga0075433_10104662 3300006852 Unclassified 2507
142 Ga0075433_11067567 3300006852 Unclassified 702
143 Ga0075434_100004541 3300006871 Bacteria 12533
144 Ga0075434_100020126 3300006871 Bacteria 6468
145 Ga0075434_100026651 3300006871 Bacteria 5665
146 Ga0075434_100047488 3300006871 Unclassified 4261
147 Ga0075434_100062915 3300006871 Bacteria 3694
148 Ga0075434_100846357 3300006871 Bacteria 930
149 Ga0075434_101530361 3300006871 Bacteria 676
150 Ga0075436_100011518 3300006914 Bacteria 6065
151 Ga0075436_100012935 3300006914 Bacteria 5720
152 Ga0075436_100041072 3300006914 Unclassified 3192
153 Ga0075436_100042304 3300006914 Bacteria 3142
154 Ga0075436_100045245 3300006914 Bacteria 3035
155 Ga0075436_100059100 3300006914 Bacteria 2648
156 Ga0075436_100059359 3300006914 Bacteria 2642
157 Ga0075436_101238270 3300006914 Bacteria 564
158 Ga0075435_100004458 3300007076 Bacteria 9618
159 Ga0075435_100055870 3300007076 Bacteria 3190
160 Ga0075435_100556579 3300007076 Bacteria 993
161 Ga0075435_101164039 3300007076 Bacteria 674
162 Ga0075435_101630398 3300007076 Bacteria 566
163 Ga0099794_10000059 3300007265 Bacteria 42270
164 Ga0099794_10006791 3300007265 Bacteria 4659
165 Ga0099794_10135784 3300007265 Unclassified 1244
166 Ga0099794_10557097 3300007265 Bacteria 605
167 Ga0111539_10225287 3300009094 Bacteria 2184
168 Ga0111539_10375914 3300009094 Bacteria 1654
169 Ga0105245_10398892 3300009098 Bacteria 1374
170 Ga0114129_10016986 3300009147 Bacteria 10360
171 Ga0114129_10612560 3300009147 Bacteria 1409
172 Ga0114129_10658754 3300009147 Bacteria 1350
173 Ga0114129_10743754 3300009147 Bacteria 1256
174 Ga0114129_13135189 3300009147 Bacteria 539
175 Ga0114129_13400159 3300009147 Bacteria 512
176 Ga0105243_10276776 3300009148 Bacteria 1510
177 Ga0105241_11231214 3300009174 Bacteria 710
178 Ga0099796_10360666 3300010159 Unclassified 629
179 Ga0157371_10373952 3300013102 Bacteria 1040
180 Ga0163162_10478704 3300013306 Bacteria 1376
181 Ga0163163_11103806 3300014325 Bacteria 856
182 Ga0207653_10000067 3300025885 Bacteria 79276
183 Ga0207653_10001214 3300025885 Bacteria 8423
184 Ga0207653_10009877 3300025885 Bacteria 2977
185 Ga0207653_10148536 3300025885 Bacteria 861
186 Ga0207692_10734816 3300025898 Unclassified 642
187 Ga0207688_10424370 3300025901 Bacteria 827
188 Ga0207699_10059057 3300025906 Bacteria 2297
189 Ga0207699_10544129 3300025906 Bacteria 842
190 Ga0207643_10262519 3300025908 Bacteria 1067
191 Ga0207684_10008579 3300025910 Bacteria 9087
192 Ga0207684_10012790 3300025910 Bacteria 7278
193 Ga0207684_10014073 3300025910 Bacteria 6908
194 Ga0207684_10022002 3300025910 Bacteria 5445
195 Ga0207684_10022925 3300025910 Bacteria 5331
196 Ga0207684_10118146 3300025910 Bacteria 2272
197 Ga0207684_10270112 3300025910 Bacteria 1467
198 Ga0207684_10456761 3300025910 Unclassified 1096
199 Ga0207684_10701297 3300025910 Bacteria 860
200 Ga0207684_10914393 3300025910 Bacteria 737
201 Ga0207707_10016686 3300025912 Bacteria 6402
202 Ga0207707_10426663 3300025912 Bacteria 1136
203 Ga0207707_10457491 3300025912 Bacteria 1092
204 Ga0207663_10000153 3300025916 Bacteria 31913
205 Ga0207660_10013082 3300025917 Bacteria 5433
206 Ga0207660_10080402 3300025917 Bacteria 2393
207 Ga0207660_10125439 3300025917 Bacteria 1949
208 Ga0207660_10522966 3300025917 Bacteria 964
209 Ga0207649_10271808 3300025920 Bacteria 1229
210 Ga0207652_10213881 3300025921 Bacteria 1736
211 Ga0207646_10003133 3300025922 Bacteria 18961
212 Ga0207646_10003920 3300025922 Bacteria 16523
213 Ga0207646_10036583 3300025922 Bacteria 4430
214 Ga0207646_10044267 3300025922 Bacteria 3995
215 Ga0207646_10062670 3300025922 Bacteria 3320
216 Ga0207646_10065362 3300025922 Bacteria 3247
217 Ga0207646_10138560 3300025922 Bacteria 2191
218 Ga0207646_10162057 3300025922 Bacteria 2018
219 Ga0207646_10362031 3300025922 Bacteria 1310
220 Ga0207646_11392021 3300025922 Bacteria 610
221 Ga0207681_10527128 3300025923 Bacteria 970
222 Ga0207687_10209569 3300025927 Bacteria 1528
223 Ga0207700_10460561 3300025928 Bacteria 1122
224 Ga0207700_10727546 3300025928 Bacteria 886
225 Ga0207664_10448439 3300025929 Bacteria 1151
226 Ga0207690_10440679 3300025932 Bacteria 1045
227 Ga0207706_10204162 3300025933 Bacteria 1733
228 Ga0207669_10044236 3300025937 Bacteria 2615
229 Ga0207665_10006457 3300025939 Bacteria 7780
230 Ga0207661_12098721 3300025944 Bacteria 511
231 Ga0207679_10063693 3300025945 Bacteria 2753
232 Ga0207679_11089019 3300025945 Bacteria 733
233 Ga0207668_11288686 3300025972 Bacteria 658
234 Ga0207677_10828065 3300026023 Bacteria 830
235 Ga0207703_10326687 3300026035 Bacteria 1406
236 Ga0207639_10766155 3300026041 Unclassified 898
237 Ga0207678_10165595 3300026067 Bacteria 1888
238 Ga0207678_10288680 3300026067 Bacteria 1409
239 Ga0207708_10334758 3300026075 Bacteria 1238
240 Ga0207648_10241596 3300026089 Unclassified 1608
241 Ga0207676_11090472 3300026095 Bacteria 789
242 Ga0207675_100358898 3300026118 Bacteria 1429
243 Ga0210002_1086481 3300027617 Bacteria 561
244 Ga0209588_1000106 3300027671 Bacteria 25489
245 Ga0209588_1000235 3300027671 Bacteria 14777
246 Ga0207428_10212911 3300027907 Bacteria 1451
247 Ga0268266_11247201 3300028379 Bacteria 719
248 Ga0307408_100012722 3300031548 Bacteria 5580
249 Ga0307408_100019684 3300031548 Bacteria 4547
250 Ga0307408_100065260 3300031548 Bacteria 2669
251 Ga0307408_100099691 3300031548 Bacteria 2211
252 Ga0307408_101631467 3300031548 Bacteria 613
253 Ga0316576_10000112 3300031727 Bacteria 30377
254 Ga0316576_10003287 3300031727 Bacteria 9440
255 Ga0316576_10039786 3300031727 Bacteria 3376
256 Ga0316576_10166008 3300031727 Bacteria 1666
257 Ga0316578_10007403 3300031728 Bacteria 5503
258 Ga0316578_10008402 3300031728 Bacteria 5252
259 Ga0316578_10474948 3300031728 Bacteria 738
260 Ga0307405_10029774 3300031731 Bacteria 3194
261 Ga0307405_10155960 3300031731 Bacteria 1611
262 Ga0307405_10621639 3300031731 Bacteria 884
263 Ga0307405_11699745 3300031731 Bacteria 559
264 Ga0316577_10118882 3300031733 Bacteria 1485
265 Ga0316577_10315011 3300031733 Bacteria 887
266 Ga0307413_10021069 3300031824 Bacteria 3482
267 Ga0307413_10036216 3300031824 Bacteria 2839
268 Ga0307413_10147671 3300031824 Bacteria 1634
269 Ga0307413_10222528 3300031824 Unclassified 1380
270 Ga0307410_10003218 3300031852 Bacteria 8144
271 Ga0307410_10008577 3300031852 Bacteria 5677
272 Ga0307410_10008834 3300031852 Bacteria 5616
273 Ga0307410_10049429 3300031852 Bacteria 2823
274 Ga0307410_10283712 3300031852 Bacteria 1300
275 Ga0307406_10013829 3300031901 Bacteria 4632
276 Ga0307406_10035408 3300031901 Bacteria 3070
277 Ga0307406_10062274 3300031901 Bacteria 2413
278 Ga0307406_10239727 3300031901 Unclassified 1359
279 Ga0307406_11357707 3300031901 Bacteria 622
280 Ga0307406_11445782 3300031901 Bacteria 604
281 Ga0307407_10129101 3300031903 Bacteria 1614
282 Ga0307407_10835984 3300031903 Bacteria 703
283 Ga0307412_10016836 3300031911 Bacteria 4366
284 Ga0307412_10113581 3300031911 Bacteria 1938
285 Ga0307412_10173040 3300031911 Bacteria 1616
286 Ga0307409_100000984 3300031995 Bacteria 13323
287 Ga0307409_100003727 3300031995 Bacteria 8371
288 Ga0307409_100128400 3300031995 Bacteria 2161
289 Ga0307409_100136509 3300031995 Bacteria 2106
290 Ga0307409_100195551 3300031995 Bacteria 1804
291 Ga0307409_100209784 3300031995 Bacteria 1749
292 Ga0307409_100396133 3300031995 Bacteria 1317
293 Ga0307416_100000890 3300032002 Bacteria 15771
294 Ga0307416_100001972 3300032002 Bacteria 11504
295 Ga0307416_100013744 3300032002 Bacteria 5514
296 Ga0307416_100101217 3300032002 Bacteria 2509
297 Ga0307416_100111884 3300032002 Bacteria 2408
298 Ga0307416_100808202 3300032002 Bacteria 1034
299 Ga0307416_101639119 3300032002 Bacteria 748
300 Ga0307414_10088761 3300032004 Unclassified 2289
301 Ga0307414_10099942 3300032004 Bacteria 2181
302 Ga0307414_10131421 3300032004 Bacteria 1944
303 Ga0307414_10401005 3300032004 Bacteria 1191
304 Ga0307411_10007876 3300032005 Bacteria 5471
305 Ga0307411_10016546 3300032005 Bacteria 4176
306 Ga0307411_10021337 3300032005 Bacteria 3787
307 Ga0307411_10022515 3300032005 Bacteria 3711
308 Ga0307411_10054617 3300032005 Bacteria 2624
309 Ga0307411_10371366 3300032005 Bacteria 1173
310 Ga0307415_100000703 3300032126 Bacteria 14900
311 Ga0307415_100004149 3300032126 Bacteria 7473
312 Ga0307415_100006810 3300032126 Bacteria 6200
313 Ga0307415_101262627 3300032126 Unclassified 698
314 Ga0307415_101970048 3300032126 Bacteria 568
315 Ga0316585_10006405 3300032137 Archaea 3365
316 Ga0373940_0035377 3300035088 Bacteria 1352
317 Ga0373940_0380222 3300035088 Bacteria 501
318 Ga0373949_0066546 3300035090 Bacteria 937
319 Ga0373932_0151726 3300035112 Bacteria 795
320 Ga0373961_0104808 3300035241 Bacteria 920
321 Ga0373961_0262504 3300035241 Bacteria 628
322 Ga0373962_0171475 3300035242 Bacteria 721
323 Ga0316574_0039765 3300035398 Bacteria 2894
324 Ga0316574_0156282 3300035398 Bacteria 1469
325 Ga0373931_0094155 3300035691 Bacteria 1674
326 Ga0316584_0102488 3300036712 Bacteria 2143
327 Ga0395905_0762683 3300037471 Bacteria 870
328 Ga0316581_0278579 3300037588 Unclassified 514
329 Ga0395901_1826811 3300038443 Bacteria 556
330 Ga0439463_111750 3300042016 Bacteria 705
331 Ga0439460_0251640 3300042461 Bacteria 611
332 Ga0451577_1884743 3300042876 Bacteria 524
333 Ga0439440_0165287 3300042993 Bacteria 641
334 Ga0453683_0268816 3300044673 Bacteria 1088
335 Ga0451576_0124264 3300045051 Bacteria 2688
336 Ga0451576_0246097 3300045051 Bacteria 1868
337 Ga0451576_0851745 3300045051 Unclassified 957
338 Ga0495609_0112871 3300046538 Bacteria 1172
339 Ga0495659_0040001 3300046664 Bacteria 1669
340 Ga0495604_0746479 3300047317 Bacteria 619
341 Ga0495636_0473651 3300047318 Archaea 603
342 Ga0495677_0251917 3300047445 Bacteria 690
343 Ga0496101_0022860 3300048904 Bacteria 4311
344 Ga0496101_0938295 3300048904 Bacteria 681
345 Ga0496101_1155437 3300048904 Bacteria 607
346 Ga0496102_1435357 3300048905 Bacteria 609
347 Ga0496104_1336363 3300048907 Bacteria 620
348 Ga0496114_0073889 3300048917 Bacteria 2870
349 Ga0496114_0510013 3300048917 Bacteria 1064
350 Ga0501292_014721 3300049515 Unclassified 1217
351 Ga0501031_0110110 3300049568 Bacteria 1798
352 Ga0501032_0322532 3300049569 Bacteria 997
353 Ga0501034_0000797 3300049571 Bacteria 46917
354 Ga0501034_0009873 3300049571 Bacteria 9979
355 Ga0501034_0119417 3300049571 Bacteria 2623
356 Ga0501036_0078539 3300049572 Bacteria 2792
357 Ga0501036_0274835 3300049572 Bacteria 1410
358 Ga0501036_0554830 3300049572 Bacteria 954
359 Ga0501036_1307543 3300049572 Bacteria 589
360 Ga0501041_0081259 3300049577 Bacteria 1996
361 Ga0501041_0110577 3300049577 Bacteria 1705
362 Ga0501043_0200557 3300049579 Bacteria 1549
363 Ga0501046_0292370 3300049580 Bacteria 1191
364 Ga0501047_0207986 3300049581 Bacteria 1816
365 Ga0501047_0225463 3300049581 Bacteria 1729
366 Ga0501048_0029715 3300049582 Bacteria 3961
367 Ga0501048_0096022 3300049582 Bacteria 2091
368 Ga0501048_0473796 3300049582 Bacteria 897
369 Ga0501067_0000557 3300049583 Bacteria 20188
370 Ga0501067_0002921 3300049583 Bacteria 9419
371 Ga0501067_0003818 3300049583 Bacteria 8312
372 Ga0501067_0007457 3300049583 Bacteria 6078
373 Ga0501068_0000566 3300049584 Bacteria 18837
374 Ga0501068_0002674 3300049584 Bacteria 9440
375 Ga0501068_0121864 3300049584 Bacteria 1626
376 Ga0501069_0000189 3300049585 Bacteria 27235
377 Ga0501069_0006333 3300049585 Bacteria 6188
378 Ga0501069_0063549 3300049585 Bacteria 2062
379 Ga0501069_0108814 3300049585 Bacteria 1577
380 Ga0501069_0503862 3300049585 Bacteria 722
381 Ga0501070_0000897 3300049586 Bacteria 27107
382 Ga0501070_0004027 3300049586 Bacteria 12618
383 Ga0501070_0086871 3300049586 Unclassified 2589
384 Ga0501070_0394761 3300049586 Unclassified 1119
385 Ga0501071_0000072 3300049587 Bacteria 35900
386 Ga0501071_0001951 3300049587 Bacteria 12296
387 Ga0501071_0339506 3300049587 Bacteria 1142
388 Ga0501072_0000727 3300049588 Bacteria 23987
389 Ga0501072_0058854 3300049588 Bacteria 3029
390 Ga0501072_0126948 3300049588 Bacteria 2032
391 Ga0501072_0873567 3300049588 Bacteria 703
392 Ga0501073_0004561 3300049589 Bacteria 10415
393 Ga0501073_0016466 3300049589 Bacteria 5357
394 Ga0501073_0484534 3300049589 Bacteria 855
395 Ga0501074_0000155 3300049590 Bacteria 35855
396 Ga0501074_0001153 3300049590 Bacteria 17283
397 Ga0501074_0079675 3300049590 Bacteria 2350
398 Ga0501074_1292074 3300049590 Bacteria 511
399 Ga0501076_0053271 3300049592 Bacteria 3206
400 Ga0501076_0078520 3300049592 Bacteria 2649
401 Ga0501076_0093046 3300049592 Bacteria 2426
402 Ga0501076_0188638 3300049592 Bacteria 1682
403 Ga0501076_0252552 3300049592 Bacteria 1443
404 Ga0501077_0028777 3300049593 Unclassified 3532
405 Ga0501077_0037530 3300049593 Bacteria 3085
406 Ga0501077_0541920 3300049593 Bacteria 747
407 Ga0501077_0672828 3300049593 Bacteria 665
408 Ga0501209_082357 3300049656 Bacteria 929
409 Ga0501217_010459 3300049661 Bacteria 2033
410 Ga0501235_010270 3300049669 Bacteria 2047
411 Ga0501239_003821 3300049672 Unclassified 1452
412 Ga0501239_056595 3300049672 Unclassified 580
413 Ga0501249_039059 3300049679 Bacteria 1073
414 Ga0501249_080173 3300049679 Bacteria 767
415 Ga0501251_002400 3300049681 Unclassified 1816
416 Ga0501259_154058 3300049688 Unclassified 570
417 Ga0501221_007567 3300049704 Bacteria 1867
418 Ga0501234_025007 3300049707 Unclassified 958
419 Ga0501079_0122871 3300049741 Bacteria 2019
420 Ga0501079_0460530 3300049741 Unclassified 999
421 Ga0501079_0475262 3300049741 Bacteria 982
422 Ga0501079_0591470 3300049741 Bacteria 873
423 Ga0501079_0728488 3300049741 Unclassified 780
424 Ga0501079_1576471 3300049741 Bacteria 516
425 Ga0501080_0000657 3300049742 Bacteria 27465
426 Ga0501080_0009158 3300049742 Bacteria 9015
427 Ga0501080_1132524 3300049742 Bacteria 675
428 Ga0501081_0015964 3300049743 Bacteria 4959
429 Ga0501081_0019318 3300049743 Bacteria 4538
430 Ga0501081_0202265 3300049743 Unclassified 1441
431 Ga0501081_0303988 3300049743 Bacteria 1170
432 Ga0501081_1009074 3300049743 Unclassified 629
433 Ga0501083_0004023 3300049744 Bacteria 10332
434 Ga0501083_0101797 3300049744 Bacteria 1893
435 Ga0501083_0228889 3300049744 Bacteria 1211
436 Ga0501083_0358375 3300049744 Bacteria 948
437 Ga0501241_074286 3300049758 Bacteria 699
438 Ga0501267_003392 3300049764 Unclassified 1450
439 Ga0501268_000504 3300049765 Bacteria 4268
440 Ga0501271_002032 3300049768 Unclassified 1778
441 Ga0501272_000669 3300049769 Unclassified 3069
442 Ga0501273_059230 3300049770 Unclassified 600
443 Ga0501045_0046866 3300049824 Bacteria 3147
444 Ga0501045_0223123 3300049824 Bacteria 1403
445 Ga0501045_0650503 3300049824 Bacteria 779
446 Ga0501045_1039402 3300049824 Unclassified 600
447 nmdc:mga05p37_1193706_c1 3300050507 Bacteria 787
448 nmdc:mga05p37_151615_c1 3300050507 Bacteria 2835
449 nmdc:mga05p37_733152_c1 3300050507 Bacteria 1092
450 nmdc:mga05p37_900112_c1 3300050507 Unclassified 954
451 nmdc:mga05p37_9228_c1 3300050507 Bacteria 11657
452 nmdc:mga09592_38658_c1 3300050508 Bacteria 4006
453 nmdc:mga0qj67_1086608_c1 3300050509 Bacteria 625
454 nmdc:mga0qj67_71532_c1 3300050509 Bacteria 2768
455 nmdc:mga0qj67_766766_c1 3300050509 Unclassified 765
456 nmdc:mga06r32_256011_c1 3300050510 Bacteria 1738
457 nmdc:mga06r32_316969_c1 3300050510 Unclassified 1545
458 nmdc:mga06r32_634915_c1 3300050510 Unclassified 1037
459 nmdc:mga08y16_1854472_c1 3300050511 Bacteria 555
460 nmdc:mga08y16_342241_c1 3300050511 Bacteria 1537
461 nmdc:mga08y16_638102_c1 3300050511 Bacteria 1070
462 nmdc:mga08y16_987961_c1 3300050511 Bacteria 822
463 nmdc:mga0n895_123830_c1 3300050512 Bacteria 2608
464 nmdc:mga0n895_1469830_c1 3300050512 Bacteria 648
465 nmdc:mga0n895_524183_c1 3300050512 Bacteria 1192
466 nmdc:mga0n895_58715_c1 3300050512 Unclassified 3794
467 nmdc:mga0n895_61506_c1 3300050512 Bacteria 3708
468 nmdc:mga0n895_6776_c1 3300050512 Bacteria 9774
469 nmdc:mga0rr50_1508354_c1 3300050513 Bacteria 568
470 nmdc:mga0rr50_1539200_c1 3300050513 Bacteria 562
471 nmdc:mga0rr50_23847_c1 3300050513 Bacteria 4230
472 nmdc:mga0rr50_266100_c1 3300050513 Unclassified 1428
473 nmdc:mga0rr50_569894_c1 3300050513 Bacteria 964
474 nmdc:mga0rr50_601309_c1 3300050513 Bacteria 938
475 nmdc:mga0rr50_65490_c1 3300050513 Bacteria 2753
476 nmdc:mga08x19_1027155_c1 3300050514 Bacteria 585
477 nmdc:mga08x19_115824_c1 3300050514 Bacteria 1792
478 nmdc:mga08x19_1316931_c1 3300050514 Bacteria 511
479 nmdc:mga08x19_133166_c1 3300050514 Unclassified 1674
480 nmdc:mga08x19_152075_c1 3300050514 Unclassified 1568
481 nmdc:mga08x19_16362_c1 3300050514 Bacteria 4523
482 nmdc:mga08x19_2724_c1 3300050514 Bacteria 10681
483 nmdc:mga08x19_37449_c1 3300050514 Bacteria 3078
484 nmdc:mga0a205_25921_c1 3300050515 Bacteria 5585
485 nmdc:mga0a205_274673_c1 3300050515 Unclassified 1562
486 nmdc:mga0a205_5068_c1 3300050515 Bacteria 11847
487 nmdc:mga0a205_691506_c1 3300050515 Bacteria 870
488 nmdc:mga0a205_86548_c1 3300050515 Bacteria 3027
489 nmdc:mga0a205_977184_c1 3300050515 Bacteria 694
490 Ga0501084_0000543 3300054114 Bacteria 28737
491 Ga0501084_0000816 3300054114 Bacteria 23914
492 Ga0501084_0045049 3300054114 Bacteria 3694
493 Ga0501084_0353157 3300054114 Bacteria 1242
494 Ga0501084_0374013 3300054114 Bacteria 1204
495 Ga0590071_000089 3300059421 Bacteria 25178
496 Ga0590075_001925 3300059424 Bacteria 5032
497 Ga0590077_001447 3300059426 Bacteria 5555
498 Ga0501082_0003693 3300060353 Bacteria 13366
499 Ga0501082_0015117 3300060353 Bacteria 6650
500 Ga0501082_0016776 3300060353 Bacteria 6306
501 Ga0501082_0067557 3300060353 Bacteria 3079
502 Ga0501082_0225997 3300060353 Bacteria 1629
503 Ga0501082_1681854 3300060353 Unclassified 554
504 Ga0530510_0100852 3300061734 Bacteria 2111
505 Ga0530510_0213708 3300061734 Bacteria 1433
506 Ga0530510_0600565 3300061734 Bacteria 837
507 Ga0530510_0659883 3300061734 Bacteria 796
508 Ga0530510_0843101 3300061734 Unclassified 700
509 Ga0316576_10116752
510 rootL2_10082236
511 Ga0065715_10109182
512 Ga0070683_100083025
513 Ga0070670_101040993
514 Ga0070680_100057733
515 Ga0070680_100073829
516 Ga0070680_100567169
517 Ga0070682_100258230
518 Ga0068868_101784428
519 Ga0070691_10603403
520 Ga0070687_100654447
521 Ga0070661_100510588
522 Ga0070661_100542559
523 Ga0070669_100602923
524 Ga0070675_101001690
525 Ga0070659_100073652
526 Ga0070703_10005100
527 Ga0070703_10033196
528 Ga0070703_10073139
529 Ga0070703_10127452
530 Ga0070709_10040125
531 Ga0070714_100537509
532 Ga0070713_100296429
533 Ga0070713_100522653
534 Ga0070710_10463263
535 Ga0070711_100000212
536 Ga0070705_100024218
537 Ga0070705_100202740
538 Ga0070705_101091195
539 Ga0070700_100447006
540 Ga0070700_100747595
541 Ga0070694_100011508
542 Ga0070694_100018990
543 Ga0070694_100052741
544 Ga0070694_100055276
545 Ga0070694_100079662
546 Ga0070694_100313601
547 Ga0070694_100816833
548 Ga0070708_100009867
549 Ga0070708_100020461
550 Ga0070708_100044858
551 Ga0070708_100059947
552 Ga0070708_100069813
553 Ga0070708_100139032
554 Ga0070708_100154588
555 Ga0070708_100494224
556 Ga0070663_100696867
557 Ga0070662_101029966
558 Ga0070662_101815338
559 Ga0070681_10032514
560 Ga0070681_10504990
561 Ga0070706_100020787
562 Ga0070706_100032905
563 Ga0070706_100035615
564 Ga0070706_100040057
565 Ga0070706_100145755
566 Ga0070706_100191982
567 Ga0070706_100215428
568 Ga0070706_100471714
569 Ga0070707_100041918
570 Ga0070707_100049729
571 Ga0070707_100058876
572 Ga0070707_100083089
573 Ga0070707_100198306
574 Ga0070698_100007150
575 Ga0070698_100039591
576 Ga0070698_100373674
577 Ga0070698_100969081
578 Ga0070698_101156444
579 Ga0070699_100008485
580 Ga0070699_100023165
581 Ga0070699_100030438
582 Ga0070699_100075795
583 Ga0070699_100122573
584 Ga0070699_100152140
585 Ga0070699_100199445
586 Ga0070699_100271841
587 Ga0070699_100413127
588 Ga0070699_100691808
589 Ga0070679_100124104
590 Ga0070679_100719943
591 Ga0070697_100006385
592 Ga0070697_100035295
593 Ga0070697_100035915
594 Ga0070697_100039409
595 Ga0070697_100049818
596 Ga0070697_100065893
597 Ga0070697_100240556
598 Ga0070697_100323475
599 Ga0070697_100361191
600 Ga0070697_100903879
601 Ga0070697_101434190
602 Ga0070695_100002580
603 Ga0070695_100007118
604 Ga0070695_100217967
605 Ga0070695_100390327
606 Ga0070695_101123319
607 Ga0070696_100027246
608 Ga0070696_100167565
609 Ga0070696_100213935
610 Ga0070696_100370122
611 Ga0070696_100399125
612 Ga0070696_100632045
613 Ga0070696_102007364
614 Ga0070693_100086560
615 Ga0070693_100212163
616 Ga0070704_100005974
617 Ga0070704_100026807
618 Ga0070704_100168938
619 Ga0070704_100213150
620 Ga0070704_100332188
621 Ga0070704_100360865
622 Ga0070664_100076550
623 Ga0070664_100084053
624 Ga0070664_100412076
625 Ga0070664_101444053
626 Ga0068854_100551130
627 Ga0070702_100170315
628 Ga0068852_100322073
629 Ga0068864_101068065
630 Ga0068864_102061055
631 Ga0068861_100586620
632 Ga0068870_10572682
633 Ga0081538_10047581
634 Ga0070716_100094117
635 Ga0070712_100216323
636 Ga0075428_100034705
637 Ga0075428_100194499
638 Ga0075428_100282341
639 Ga0075428_100665807
640 Ga0075428_100780825
641 Ga0075428_101649040
642 Ga0075430_100417813
643 Ga0075431_100120917
644 Ga0075431_100262384
645 Ga0075431_100744719
646 Ga0075433_10011590
647 Ga0075433_10040143
648 Ga0075433_10043563
649 Ga0075433_10104662
650 Ga0075433_11067567
651 Ga0075434_100004541
652 Ga0075434_100020126
653 Ga0075434_100026651
654 Ga0075434_100047488
655 Ga0075434_100062915
656 Ga0075434_100846357
657 Ga0075434_101530361
658 Ga0075436_100011518
659 Ga0075436_100012935
660 Ga0075436_100041072
661 Ga0075436_100042304
662 Ga0075436_100045245
663 Ga0075436_100059100
664 Ga0075436_100059359
665 Ga0075436_101238270
666 Ga0075435_100004458
667 Ga0075435_100055870
668 Ga0075435_100556579
669 Ga0075435_101164039
670 Ga0075435_101630398
671 Ga0099794_10000059
672 Ga0099794_10006791
673 Ga0099794_10135784
674 Ga0099794_10557097
675 Ga0111539_10225287
676 Ga0111539_10375914
677 Ga0105245_10398892
678 Ga0114129_10016986
679 Ga0114129_10612560
680 Ga0114129_10658754
681 Ga0114129_10743754
682 Ga0114129_13135189
683 Ga0114129_13400159
684 Ga0105243_10276776
685 Ga0105241_11231214
686 Ga0099796_10360666
687 Ga0157371_10373952
688 Ga0163162_10478704
689 Ga0163163_11103806
690 Ga0207653_10000067
691 Ga0207653_10001214
692 Ga0207653_10009877
693 Ga0207653_10148536
694 Ga0207692_10734816
695 Ga0207688_10424370
696 Ga0207699_10059057
697 Ga0207699_10544129
698 Ga0207643_10262519
699 Ga0207684_10008579
700 Ga0207684_10012790
701 Ga0207684_10014073
702 Ga0207684_10022002
703 Ga0207684_10022925
704 Ga0207684_10118146
705 Ga0207684_10270112
706 Ga0207684_10456761
707 Ga0207684_10701297
708 Ga0207684_10914393
709 Ga0207707_10016686
710 Ga0207707_10426663
711 Ga0207707_10457491
712 Ga0207663_10000153
713 Ga0207660_10013082
714 Ga0207660_10080402
715 Ga0207660_10125439
716 Ga0207660_10522966
717 Ga0207649_10271808
718 Ga0207652_10213881
719 Ga0207646_10003133
720 Ga0207646_10003920
721 Ga0207646_10036583
722 Ga0207646_10044267
723 Ga0207646_10062670
724 Ga0207646_10065362
725 Ga0207646_10138560
726 Ga0207646_10162057
727 Ga0207646_10362031
728 Ga0207646_11392021
729 Ga0207681_10527128
730 Ga0207687_10209569
731 Ga0207700_10460561
732 Ga0207700_10727546
733 Ga0207664_10448439
734 Ga0207690_10440679
735 Ga0207706_10204162
736 Ga0207669_10044236
737 Ga0207665_10006457
738 Ga0207661_12098721
739 Ga0207679_10063693
740 Ga0207679_11089019
741 Ga0207668_11288686
742 Ga0207677_10828065
743 Ga0207703_10326687
744 Ga0207639_10766155
745 Ga0207678_10165595
746 Ga0207678_10288680
747 Ga0207708_10334758
748 Ga0207648_10241596
749 Ga0207676_11090472
750 Ga0207675_100358898
751 Ga0210002_1086481
752 Ga0209588_1000106
753 Ga0209588_1000235
754 Ga0207428_10212911
755 Ga0268266_11247201
756 Ga0307408_100012722
757 Ga0307408_100019684
758 Ga0307408_100065260
759 Ga0307408_100099691
760 Ga0307408_101631467
761 Ga0316576_10000112
762 Ga0316576_10003287
763 Ga0316576_10039786
764 Ga0316576_10166008
765 Ga0316578_10007403
766 Ga0316578_10008402
767 Ga0316578_10474948
768 Ga0307405_10029774
769 Ga0307405_10155960
770 Ga0307405_10621639
771 Ga0307405_11699745
772 Ga0316577_10118882
773 Ga0316577_10315011
774 Ga0307413_10021069
775 Ga0307413_10036216
776 Ga0307413_10147671
777 Ga0307413_10222528
778 Ga0307410_10003218
779 Ga0307410_10008577
780 Ga0307410_10008834
781 Ga0307410_10049429
782 Ga0307410_10283712
783 Ga0307406_10013829
784 Ga0307406_10035408
785 Ga0307406_10062274
786 Ga0307406_10239727
787 Ga0307406_11357707
788 Ga0307406_11445782
789 Ga0307407_10129101
790 Ga0307407_10835984
791 Ga0307412_10016836
792 Ga0307412_10113581
793 Ga0307412_10173040
794 Ga0307409_100000984
795 Ga0307409_100003727
796 Ga0307409_100128400
797 Ga0307409_100136509
798 Ga0307409_100195551
799 Ga0307409_100209784
800 Ga0307409_100396133
801 Ga0307416_100000890
802 Ga0307416_100001972
803 Ga0307416_100013744
804 Ga0307416_100101217
805 Ga0307416_100111884
806 Ga0307416_100808202
807 Ga0307416_101639119
808 Ga0307414_10088761
809 Ga0307414_10099942
810 Ga0307414_10131421
811 Ga0307414_10401005
812 Ga0307411_10007876
813 Ga0307411_10016546
814 Ga0307411_10021337
815 Ga0307411_10022515
816 Ga0307411_10054617
817 Ga0307411_10371366
818 Ga0307415_100000703
819 Ga0307415_100004149
820 Ga0307415_100006810
821 Ga0307415_101262627
822 Ga0307415_101970048
823 Ga0316585_10006405
824 Ga0373940_0035377
825 Ga0373940_0380222
826 Ga0373949_0066546
827 Ga0373932_0151726
828 Ga0373961_0104808
829 Ga0373961_0262504
830 Ga0373962_0171475
831 Ga0316574_0039765
832 Ga0316574_0156282
833 Ga0373931_0094155
834 Ga0316584_0102488
835 Ga0395905_0762683
836 Ga0316581_0278579
837 Ga0395901_1826811
838 Ga0439463_111750
839 Ga0439460_0251640
840 Ga0451577_1884743
841 Ga0439440_0165287
842 Ga0453683_0268816
843 Ga0451576_0124264
844 Ga0451576_0246097
845 Ga0451576_0851745
846 Ga0495609_0112871
847 Ga0495659_0040001
848 Ga0495604_0746479
849 Ga0495636_0473651
850 Ga0495677_0251917
851 Ga0496101_0022860
852 Ga0496101_0938295
853 Ga0496101_1155437
854 Ga0496102_1435357
855 Ga0496104_1336363
856 Ga0496114_0073889
857 Ga0496114_0510013
858 Ga0501292_014721
859 Ga0501031_0110110
860 Ga0501032_0322532
861 Ga0501034_0000797
862 Ga0501034_0009873
863 Ga0501034_0119417
864 Ga0501036_0078539
865 Ga0501036_0274835
866 Ga0501036_0554830
867 Ga0501036_1307543
868 Ga0501041_0081259
869 Ga0501041_0110577
870 Ga0501043_0200557
871 Ga0501046_0292370
872 Ga0501047_0207986
873 Ga0501047_0225463
874 Ga0501048_0029715
875 Ga0501048_0096022
876 Ga0501048_0473796
877 Ga0501067_0000557
878 Ga0501067_0002921
879 Ga0501067_0003818
880 Ga0501067_0007457
881 Ga0501068_0000566
882 Ga0501068_0002674
883 Ga0501068_0121864
884 Ga0501069_0000189
885 Ga0501069_0006333
886 Ga0501069_0063549
887 Ga0501069_0108814
888 Ga0501069_0503862
889 Ga0501070_0000897
890 Ga0501070_0004027
891 Ga0501070_0086871
892 Ga0501070_0394761
893 Ga0501071_0000072
894 Ga0501071_0001951
895 Ga0501071_0339506
896 Ga0501072_0000727
897 Ga0501072_0058854
898 Ga0501072_0126948
899 Ga0501072_0873567
900 Ga0501073_0004561
901 Ga0501073_0016466
902 Ga0501073_0484534
903 Ga0501074_0000155
904 Ga0501074_0001153
905 Ga0501074_0079675
906 Ga0501074_1292074
907 Ga0501076_0053271
908 Ga0501076_0078520
909 Ga0501076_0093046
910 Ga0501076_0188638
911 Ga0501076_0252552
912 Ga0501077_0028777
913 Ga0501077_0037530
914 Ga0501077_0541920
915 Ga0501077_0672828
916 Ga0501209_082357
917 Ga0501217_010459
918 Ga0501235_010270
919 Ga0501239_003821
920 Ga0501239_056595
921 Ga0501249_039059
922 Ga0501249_080173
923 Ga0501251_002400
924 Ga0501259_154058
925 Ga0501221_007567
926 Ga0501234_025007
927 Ga0501079_0122871
928 Ga0501079_0460530
929 Ga0501079_0475262
930 Ga0501079_0591470
931 Ga0501079_0728488
932 Ga0501079_1576471
933 Ga0501080_0000657
934 Ga0501080_0009158
935 Ga0501080_1132524
936 Ga0501081_0015964
937 Ga0501081_0019318
938 Ga0501081_0202265
939 Ga0501081_0303988
940 Ga0501081_1009074
941 Ga0501083_0004023
942 Ga0501083_0101797
943 Ga0501083_0228889
944 Ga0501083_0358375
945 Ga0501241_074286
946 Ga0501267_003392
947 Ga0501268_000504
948 Ga0501271_002032
949 Ga0501272_000669
950 Ga0501273_059230
951 Ga0501045_0046866
952 Ga0501045_0223123
953 Ga0501045_0650503
954 Ga0501045_1039402
955 nmdc:mga05p37_1193706_c1
956 nmdc:mga05p37_151615_c1
957 nmdc:mga05p37_733152_c1
958 nmdc:mga05p37_900112_c1
959 nmdc:mga05p37_9228_c1
960 nmdc:mga09592_38658_c1
961 nmdc:mga0qj67_1086608_c1
962 nmdc:mga0qj67_71532_c1
963 nmdc:mga0qj67_766766_c1
964 nmdc:mga06r32_256011_c1
965 nmdc:mga06r32_316969_c1
966 nmdc:mga06r32_634915_c1
967 nmdc:mga08y16_1854472_c1
968 nmdc:mga08y16_342241_c1
969 nmdc:mga08y16_638102_c1
970 nmdc:mga08y16_987961_c1
971 nmdc:mga0n895_123830_c1
972 nmdc:mga0n895_1469830_c1
973 nmdc:mga0n895_524183_c1
974 nmdc:mga0n895_58715_c1
975 nmdc:mga0n895_61506_c1
976 nmdc:mga0n895_6776_c1
977 nmdc:mga0rr50_1508354_c1
978 nmdc:mga0rr50_1539200_c1
979 nmdc:mga0rr50_23847_c1
980 nmdc:mga0rr50_266100_c1
981 nmdc:mga0rr50_569894_c1
982 nmdc:mga0rr50_601309_c1
983 nmdc:mga0rr50_65490_c1
984 nmdc:mga08x19_1027155_c1
985 nmdc:mga08x19_115824_c1
986 nmdc:mga08x19_1316931_c1
987 nmdc:mga08x19_133166_c1
988 nmdc:mga08x19_152075_c1
989 nmdc:mga08x19_16362_c1
990 nmdc:mga08x19_2724_c1
991 nmdc:mga08x19_37449_c1
992 nmdc:mga0a205_25921_c1
993 nmdc:mga0a205_274673_c1
994 nmdc:mga0a205_5068_c1
995 nmdc:mga0a205_691506_c1
996 nmdc:mga0a205_86548_c1
997 nmdc:mga0a205_977184_c1
998 Ga0501084_0000543
999 Ga0501084_0000816
1000 Ga0501084_0045049
1001 Ga0501084_0353157
1002 Ga0501084_0374013
1003 Ga0590071_000089
1004 Ga0590075_001925
1005 Ga0590077_001447
1006 Ga0501082_0003693
1007 Ga0501082_0015117
1008 Ga0501082_0016776
1009 Ga0501082_0067557
1010 Ga0501082_0225997
1011 Ga0501082_1681854
1012 Ga0530510_0100852
1013 Ga0530510_0213708
1014 Ga0530510_0600565
1015 Ga0530510_0659883
1016 Ga0530510_0843101

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

6

111

0.92

PF08211

dCMP_cyt_deam_2

Cytidine and deoxycytidylate deaminase zinc-binding region

2

88

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d30-assembly1.cif.gz_A crystal structure of cytidine deaminase cdd-2 (ba4525) from bacillus anthracis at 2.40a resolution 0.9621 5 121
1mq0-assembly1.cif.gz_A crystal structure of human cytidine deaminase 0.9486 5 126
2fr6-assembly1.cif.gz_A crystal structure of mouse cytidine deaminase complexed with cytidine 0.942 5 128
1ux0-assembly1.cif.gz_B-2 bacillus subtilis cytidine deaminase with an arg56 - gln substitution 0.9419 5 126
1ux1-assembly1.cif.gz_D bacillus subtilis cytidine deaminase with a cys53his and an arg56gln substitution 0.9372 5 128
ID Description Score Start End Superfamily
af_F1QSJ0_1_133_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9507 5 128 3.40.140.10
af_A0A1D8PMQ1_5_145_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9463 5 127 3.40.140.10
1r5tD00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9352 5 122 3.40.140.10
af_Q2FY04_3_129_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9321 3 122 3.40.140.10
af_Q09190_1_133_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9287 5 128 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A536SX56-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase) 0.9764 5 127 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802
AF-A0A1Q7MZL5-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase) 0.9742 12 127 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802
AF-A0A7C4C8V5-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase) 0.9699 1 125 GO:0004126
GO:0005829
GO:0008270
GO:0009972
AF-A0A257SMP7-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase) 0.9685 5 127 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802
AF-A0A0F2PPI3-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase) 0.9669 12 122 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802

Map