F456800

General Info

Members Datasets Scaffolds Average Seq Length
508 242 1016 178

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10037582|Ga0105247_100375821
Length 206
Sequence VPFRGTFVGDTTRSQRSTDMTSTMNRNGVDVPTLFATIDAVKGDPELAKFQFRASNTWLRGTHNQSTIHGFYGAKQQMQHKQATTLDADHPAVLVGEDNAPTPVEYLLHGIAACLTAGVANIAAARGVNLTEVTSTVEGDINLLGILGLSNGSVRNGYEQIKVSFHIDGDADQDTLRGLVEQSRRRSAVYDVLANPTPVVIDVTTG

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
169 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
170 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
171 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
172 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
173 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
174 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
175 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
176 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
177 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
178 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
202 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 2643221641 Nocardioides sp. Root122 Isolate Unclassified
241 2808606372 Agromyces sp. 23-23 Isolate Unclassified
242 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.25
Rhizosphere 89.96
Stem 0
Stem Tuber 0
Unclassified 15.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10037582 3300009101 Bacteria 2954
2 JGI24743J22301_10026892 3300001991 Bacteria 1121
3 JGI25404J52841_10036079 3300003659 Bacteria 1052
4 Ga0070690_100306514 3300005330 Unclassified 1140
5 Ga0070690_100325332 3300005330 Bacteria 1109
6 Ga0068869_100017446 3300005334 Bacteria 4865
7 Ga0068869_100165748 3300005334 Bacteria 1723
8 Ga0070666_10096352 3300005335 Bacteria 2036
9 Ga0070680_100506285 3300005336 Bacteria 1033
10 Ga0070682_100094513 3300005337 Unclassified 1961
11 Ga0070682_100193190 3300005337 Bacteria 1430
12 Ga0068868_100012855 3300005338 Bacteria 6124
13 Ga0068868_100088431 3300005338 Bacteria 2493
14 Ga0070660_100011652 3300005339 Bacteria 6258
15 Ga0070660_100013214 3300005339 Bacteria 5916
16 Ga0070660_100210120 3300005339 Bacteria 1580
17 Ga0070689_100039050 3300005340 Bacteria 3633
18 Ga0070691_10074404 3300005341 Unclassified 1653
19 Ga0070661_100965148 3300005344 Bacteria 706
20 Ga0070692_10019284 3300005345 Bacteria 3289
21 Ga0070692_10047477 3300005345 Bacteria 2222
22 Ga0070692_10294783 3300005345 Bacteria 988
23 Ga0070668_100008325 3300005347 Bacteria 7699
24 Ga0070668_100025504 3300005347 Bacteria 4482
25 Ga0070668_100077226 3300005347 Bacteria 2603
26 Ga0070668_100095315 3300005347 Bacteria 2350
27 Ga0070668_100497425 3300005347 Unclassified 1055
28 Ga0070669_100073559 3300005353 Bacteria 2532
29 Ga0070669_100080948 3300005353 Bacteria 2418
30 Ga0070675_101148596 3300005354 Bacteria 715
31 Ga0070671_100200994 3300005355 Unclassified 1690
32 Ga0070671_100265421 3300005355 Bacteria 1459
33 Ga0070674_100038742 3300005356 Unclassified 3214
34 Ga0070674_100882171 3300005356 Bacteria 778
35 Ga0070674_100914073 3300005356 Bacteria 765
36 Ga0070659_100002973 3300005366 Bacteria 12077
37 Ga0070659_100358493 3300005366 Unclassified 1225
38 Ga0070659_100928453 3300005366 Bacteria 762
39 Ga0070709_10022969 3300005434 Bacteria 3656
40 Ga0070709_10130247 3300005434 Unclassified 1717
41 Ga0070714_100035725 3300005435 Bacteria 4165
42 Ga0070714_100172504 3300005435 Bacteria 1964
43 Ga0070713_100032979 3300005436 Bacteria 4143
44 Ga0070713_100048875 3300005436 Unclassified 3486
45 Ga0070713_100080646 3300005436 Bacteria 2775
46 Ga0070710_10118465 3300005437 Bacteria 1599
47 Ga0070710_10170495 3300005437 Bacteria 1356
48 Ga0070701_10325921 3300005438 Bacteria 952
49 Ga0070711_100271916 3300005439 Bacteria 1337
50 Ga0070705_100714379 3300005440 Unclassified 789
51 Ga0070700_100026627 3300005441 Bacteria 3418
52 Ga0070700_100058057 3300005441 Bacteria 2430
53 Ga0070694_100057035 3300005444 Unclassified 2654
54 Ga0070694_100098660 3300005444 Bacteria 2063
55 Ga0070708_100486656 3300005445 Bacteria 1164
56 Ga0070678_100783024 3300005456 Bacteria 865
57 Ga0070678_101045381 3300005456 Bacteria 752
58 Ga0070662_100016999 3300005457 Bacteria 4893
59 Ga0070662_100040885 3300005457 Bacteria 3304
60 Ga0070662_100253893 3300005457 Unclassified 1414
61 Ga0070662_100686209 3300005457 Bacteria 866
62 Ga0068867_100319561 3300005459 Bacteria 1286
63 Ga0068867_100667543 3300005459 Bacteria 914
64 Ga0068867_100953681 3300005459 Bacteria 775
65 Ga0070685_10226563 3300005466 Unclassified 1227
66 Ga0070685_10235111 3300005466 Bacteria 1207
67 Ga0070706_100234570 3300005467 Bacteria 1713
68 Ga0070699_100279276 3300005518 Bacteria 1496
69 Ga0070684_100195641 3300005535 Unclassified 1841
70 Ga0068853_100098391 3300005539 Bacteria 2583
71 Ga0068853_100173364 3300005539 Bacteria 1953
72 Ga0068853_100468157 3300005539 Bacteria 1187
73 Ga0068853_100480090 3300005539 Unclassified 1172
74 Ga0068853_100908646 3300005539 Bacteria 846
75 Ga0070686_100251447 3300005544 Bacteria 1291
76 Ga0070686_100651353 3300005544 Bacteria 835
77 Ga0070696_100055205 3300005546 Bacteria 2770
78 Ga0070696_100076836 3300005546 Bacteria 2358
79 Ga0070665_100324137 3300005548 Bacteria 1545
80 Ga0070665_100400806 3300005548 Unclassified 1380
81 Ga0070665_100931997 3300005548 Bacteria 881
82 Ga0070665_101583722 3300005548 Bacteria 663
83 Ga0070704_100016737 3300005549 Bacteria 4642
84 Ga0070704_100026925 3300005549 Bacteria 3806
85 Ga0070704_100139686 3300005549 Unclassified 1889
86 Ga0068855_100028971 3300005563 Bacteria 6623
87 Ga0068855_100066384 3300005563 Bacteria 4206
88 Ga0068855_100097899 3300005563 Bacteria 3379
89 Ga0068855_100251156 3300005563 Bacteria 1973
90 Ga0070664_100051641 3300005564 Bacteria 3481
91 Ga0070664_101270928 3300005564 Bacteria 695
92 Ga0068857_100215424 3300005577 Bacteria 1753
93 Ga0068854_100040456 3300005578 Bacteria 3289
94 Ga0068856_100061335 3300005614 Bacteria 3714
95 Ga0068856_100285365 3300005614 Unclassified 1668
96 Ga0070702_100009631 3300005615 Bacteria 4738
97 Ga0070702_100174012 3300005615 Bacteria 1403
98 Ga0070702_100189196 3300005615 Unclassified 1353
99 Ga0070702_100484615 3300005615 Bacteria 905
100 Ga0068852_100042214 3300005616 Bacteria 3860
101 Ga0068852_100378870 3300005616 Bacteria 1387
102 Ga0068859_100034342 3300005617 Bacteria 5090
103 Ga0068859_100082852 3300005617 Unclassified 3250
104 Ga0068864_100012025 3300005618 Bacteria 7148
105 Ga0068864_100088789 3300005618 Bacteria 2723
106 Ga0068866_10025636 3300005718 Bacteria 2774
107 Ga0068866_10101488 3300005718 Bacteria 1588
108 Ga0068861_100014250 3300005719 Bacteria 5576
109 Ga0068861_100020808 3300005719 Bacteria 4705
110 Ga0068861_100055279 3300005719 Bacteria 3026
111 Ga0068861_100721010 3300005719 Bacteria 929
112 Ga0068851_10141608 3300005834 Bacteria 1308
113 Ga0068851_10267342 3300005834 Bacteria 974
114 Ga0068863_100335642 3300005841 Unclassified 1470
115 Ga0068863_100630869 3300005841 Bacteria 1062
116 Ga0068858_100051532 3300005842 Bacteria 3808
117 Ga0068858_101374042 3300005842 Unclassified 695
118 Ga0068860_100055415 3300005843 Bacteria 3769
119 Ga0068860_100060533 3300005843 Bacteria 3598
120 Ga0081455_10000377 3300005937 Bacteria 59204
121 Ga0081455_10022919 3300005937 Bacteria 5822
122 Ga0081455_10055942 3300005937 Bacteria 3352
123 Ga0081455_10074883 3300005937 Bacteria 2794
124 Ga0081455_10128969 3300005937 Bacteria 1980
125 Ga0081455_10393351 3300005937 Bacteria 964
126 Ga0081538_10026178 3300005981 Unclassified 4087
127 Ga0081540_1000574 3300005983 Bacteria 35551
128 Ga0081540_1000905 3300005983 Bacteria 26763
129 Ga0081540_1007849 3300005983 Bacteria 7543
130 Ga0081540_1155056 3300005983 Bacteria 897
131 Ga0070717_10031494 3300006028 Bacteria 4267
132 Ga0070717_10059380 3300006028 Bacteria 3164
133 Ga0070717_10215758 3300006028 Bacteria 1685
134 Ga0075432_10001414 3300006058 Bacteria 7806
135 Ga0070715_10021619 3300006163 Bacteria 2497
136 Ga0070715_10055901 3300006163 Bacteria 1715
137 Ga0070716_100039829 3300006173 Bacteria 2610
138 Ga0070716_100065422 3300006173 Unclassified 2117
139 Ga0070712_100730277 3300006175 Bacteria 846
140 Ga0097621_100044566 3300006237 Bacteria 3579
141 Ga0068871_100417387 3300006358 Bacteria 1198
142 Ga0075428_100029987 3300006844 Bacteria 6017
143 Ga0075428_100062791 3300006844 Bacteria 4066
144 Ga0075431_100004941 3300006847 Bacteria 13127
145 Ga0075433_10020344 3300006852 Bacteria 5546
146 Ga0075433_10089570 3300006852 Bacteria 2719
147 Ga0075433_10180162 3300006852 Bacteria 1880
148 Ga0075434_100032443 3300006871 Bacteria 5150
149 Ga0075434_100033981 3300006871 Bacteria 5034
150 Ga0075434_100107628 3300006871 Bacteria 2798
151 Ga0075434_100116860 3300006871 Unclassified 2680
152 Ga0075429_100045384 3300006880 Bacteria 3823
153 Ga0068865_100137194 3300006881 Bacteria 1840
154 Ga0068865_100141959 3300006881 Unclassified 1812
155 Ga0075436_100101924 3300006914 Bacteria 1999
156 Ga0075436_100459716 3300006914 Bacteria 928
157 Ga0097620_100034341 3300006931 Bacteria 5090
158 Ga0097620_100082854 3300006931 Unclassified 3250
159 Ga0075435_100001912 3300007076 Bacteria 13560
160 Ga0075435_100025507 3300007076 Bacteria 4602
161 Ga0075435_100050555 3300007076 Bacteria 3346
162 Ga0105240_10167096 3300009093 Bacteria 2608
163 Ga0105240_10278156 3300009093 Unclassified 1924
164 Ga0111539_10034942 3300009094 Bacteria 6088
165 Ga0111539_10089956 3300009094 Bacteria 3608
166 Ga0105245_10011934 3300009098 Bacteria 7554
167 Ga0105245_10022991 3300009098 Bacteria 5469
168 Ga0105245_10049527 3300009098 Bacteria 3763
169 Ga0105245_10170303 3300009098 Unclassified 2073
170 Ga0105247_10018527 3300009101 Bacteria 4176
171 Ga0105247_10293777 3300009101 Bacteria 1125
172 Ga0114129_10025933 3300009147 Bacteria 8301
173 Ga0105243_10018825 3300009148 Bacteria 5233
174 Ga0105243_10027736 3300009148 Bacteria 4341
175 Ga0105243_10053761 3300009148 Bacteria 3195
176 Ga0105243_10505142 3300009148 Bacteria 1146
177 Ga0105241_10047052 3300009174 Bacteria 3279
178 Ga0105241_10199016 3300009174 Bacteria 1672
179 Ga0105241_10273836 3300009174 Unclassified 1439
180 Ga0105242_10010067 3300009176 Bacteria 7240
181 Ga0105242_10031052 3300009176 Bacteria 4265
182 Ga0105242_10156114 3300009176 Bacteria 1993
183 Ga0105242_10276848 3300009176 Unclassified 1522
184 Ga0105248_10306944 3300009177 Bacteria 1787
185 Ga0105248_10385524 3300009177 Bacteria 1578
186 Ga0105237_10082649 3300009545 Bacteria 3202
187 Ga0105238_10026466 3300009551 Bacteria 5915
188 Ga0105238_10294920 3300009551 Bacteria 1604
189 Ga0105238_10370906 3300009551 Unclassified 1422
190 Ga0105238_10537884 3300009551 Bacteria 1172
191 Ga0105249_10002751 3300009553 Bacteria 15205
192 Ga0105249_10007651 3300009553 Bacteria 9418
193 Ga0105249_10113157 3300009553 Unclassified 2567
194 Ga0105249_10189043 3300009553 Bacteria 2009
195 Ga0105239_10036083 3300010375 Bacteria 5429
196 Ga0105239_10051172 3300010375 Bacteria 4528
197 Ga0105239_10124432 3300010375 Bacteria 2865
198 Ga0105239_10202534 3300010375 Unclassified 2224
199 Ga0105246_10007329 3300011119 Bacteria 6757
200 Ga0105246_10019872 3300011119 Bacteria 4302
201 Ga0105246_10163008 3300011119 Bacteria 1700
202 Ga0157371_10197000 3300013102 Bacteria 1443
203 Ga0157371_10429710 3300013102 Bacteria 969
204 Ga0157370_10022246 3300013104 Bacteria 6309
205 Ga0157370_10045518 3300013104 Bacteria 4209
206 Ga0157370_10054525 3300013104 Bacteria 3811
207 Ga0157369_10043949 3300013105 Bacteria 4866
208 Ga0157369_10242322 3300013105 Unclassified 1883
209 Ga0157369_10346710 3300013105 Bacteria 1543
210 Ga0157374_10088704 3300013296 Bacteria 2946
211 Ga0157374_10315350 3300013296 Bacteria 1549
212 Ga0157374_10668378 3300013296 Unclassified 1051
213 Ga0157378_10054587 3300013297 Bacteria 3558
214 Ga0157378_10093575 3300013297 Bacteria 2736
215 Ga0157378_10514620 3300013297 Bacteria 1197
216 Ga0163162_10018545 3300013306 Bacteria 6819
217 Ga0163162_10055468 3300013306 Bacteria 3989
218 Ga0163162_10090329 3300013306 Bacteria 3144
219 Ga0163162_10762114 3300013306 Unclassified 1087
220 Ga0157372_10049209 3300013307 Bacteria 4687
221 Ga0157372_10055082 3300013307 Bacteria 4440
222 Ga0157372_10409560 3300013307 Unclassified 1580
223 Ga0157375_10044694 3300013308 Bacteria 4306
224 Ga0157375_10205450 3300013308 Bacteria 2126
225 Ga0157375_10301381 3300013308 Bacteria 1766
226 Ga0157375_10360789 3300013308 Bacteria 1619
227 Ga0163163_10012694 3300014325 Bacteria 7685
228 Ga0163163_10443641 3300014325 Bacteria 1358
229 Ga0163163_11366075 3300014325 Unclassified 770
230 Ga0157380_10027641 3300014326 Bacteria 4315
231 Ga0157380_10312796 3300014326 Bacteria 1452
232 Ga0157377_10096428 3300014745 Bacteria 1754
233 Ga0157377_10135957 3300014745 Unclassified 1506
234 Ga0157379_10026521 3300014968 Bacteria 5159
235 Ga0157379_10345290 3300014968 Unclassified 1362
236 Ga0157379_10997274 3300014968 Bacteria 798
237 Ga0157376_10011357 3300014969 Bacteria 6562
238 Ga0157376_11671152 3300014969 Bacteria 672
239 Ga0163161_10004408 3300017792 Bacteria 9818
240 Ga0163161_10029013 3300017792 Unclassified 3932
241 Ga0163161_10029744 3300017792 Bacteria 3884
242 Ga0163161_10030643 3300017792 Unclassified 3830
243 Ga0163161_10397582 3300017792 Bacteria 1104
244 Ga0207656_10189561 3300025321 Bacteria 990
245 Ga0207653_10055422 3300025885 Bacteria 1327
246 Ga0207642_10018733 3300025899 Unclassified 2664
247 Ga0207642_10344640 3300025899 Bacteria 877
248 Ga0207710_10054288 3300025900 Unclassified 1804
249 Ga0207710_10114195 3300025900 Bacteria 1285
250 Ga0207710_10164746 3300025900 Bacteria 1081
251 Ga0207688_10005368 3300025901 Bacteria 6961
252 Ga0207688_10005906 3300025901 Bacteria 6665
253 Ga0207688_10020361 3300025901 Bacteria 3622
254 Ga0207688_10087530 3300025901 Bacteria 1786
255 Ga0207647_10116436 3300025904 Bacteria 1578
256 Ga0207699_10018252 3300025906 Bacteria 3714
257 Ga0207699_10032357 3300025906 Unclassified 2946
258 Ga0207645_10400702 3300025907 Unclassified 923
259 Ga0207643_10142750 3300025908 Bacteria 1431
260 Ga0207654_10025888 3300025911 Bacteria 3171
261 Ga0207654_10180874 3300025911 Bacteria 1376
262 Ga0207654_10277444 3300025911 Bacteria 1133
263 Ga0207695_10074194 3300025913 Bacteria 3464
264 Ga0207695_10248937 3300025913 Unclassified 1677
265 Ga0207671_10085370 3300025914 Unclassified 2372
266 Ga0207671_10278459 3300025914 Bacteria 1319
267 Ga0207693_10001373 3300025915 Bacteria 21572
268 Ga0207693_10002990 3300025915 Bacteria 14628
269 Ga0207693_10473649 3300025915 Bacteria 978
270 Ga0207663_10605323 3300025916 Bacteria 861
271 Ga0207660_10162893 3300025917 Bacteria 1722
272 Ga0207662_10007468 3300025918 Bacteria 5953
273 Ga0207657_10004597 3300025919 Bacteria 14586
274 Ga0207657_10025167 3300025919 Bacteria 5493
275 Ga0207681_10059430 3300025923 Bacteria 2621
276 Ga0207681_10448718 3300025923 Unclassified 1049
277 Ga0207694_10074944 3300025924 Unclassified 2648
278 Ga0207694_10211880 3300025924 Bacteria 1578
279 Ga0207659_10058059 3300025926 Bacteria 2777
280 Ga0207687_10019489 3300025927 Bacteria 4495
281 Ga0207700_10111296 3300025928 Bacteria 2204
282 Ga0207700_10135756 3300025928 Unclassified 2015
283 Ga0207700_10170216 3300025928 Bacteria 1817
284 Ga0207664_10049439 3300025929 Bacteria 3310
285 Ga0207664_10149118 3300025929 Unclassified 1985
286 Ga0207664_10238534 3300025929 Unclassified 1583
287 Ga0207644_10188607 3300025931 Bacteria 1620
288 Ga0207690_10066881 3300025932 Bacteria 2463
289 Ga0207690_10067904 3300025932 Unclassified 2447
290 Ga0207690_10219939 3300025932 Bacteria 1453
291 Ga0207706_10015740 3300025933 Bacteria 6837
292 Ga0207706_10073965 3300025933 Bacteria 2996
293 Ga0207706_10453168 3300025933 Bacteria 1109
294 Ga0207706_10704951 3300025933 Bacteria 862
295 Ga0207686_10016301 3300025934 Bacteria 4170
296 Ga0207686_10301961 3300025934 Bacteria 1189
297 Ga0207709_10425545 3300025935 Bacteria 1021
298 Ga0207709_11082223 3300025935 Bacteria 658
299 Ga0207670_10146186 3300025936 Bacteria 1748
300 Ga0207670_10266040 3300025936 Bacteria 1331
301 Ga0207669_10097056 3300025937 Bacteria 1937
302 Ga0207669_10836315 3300025937 Bacteria 765
303 Ga0207669_11161053 3300025937 Bacteria 653
304 Ga0207665_10000395 3300025939 Bacteria 29961
305 Ga0207665_10025393 3300025939 Bacteria 3909
306 Ga0207665_10045910 3300025939 Bacteria 2926
307 Ga0207711_10219301 3300025941 Bacteria 1739
308 Ga0207711_10297534 3300025941 Bacteria 1488
309 Ga0207711_11290865 3300025941 Bacteria 672
310 Ga0207689_10048726 3300025942 Bacteria 3495
311 Ga0207689_10121799 3300025942 Bacteria 2145
312 Ga0207689_10125854 3300025942 Bacteria 2108
313 Ga0207679_10171086 3300025945 Bacteria 1789
314 Ga0207679_10306889 3300025945 Bacteria 1370
315 Ga0207679_10428595 3300025945 Unclassified 1169
316 Ga0207667_10045734 3300025949 Bacteria 4635
317 Ga0207667_10083786 3300025949 Bacteria 3301
318 Ga0207667_10490054 3300025949 Bacteria 1247
319 Ga0207667_10516916 3300025949 Bacteria 1210
320 Ga0207712_10017754 3300025961 Bacteria 4626
321 Ga0207712_10130465 3300025961 Unclassified 1915
322 Ga0207712_10977350 3300025961 Bacteria 751
323 Ga0207668_10038005 3300025972 Bacteria 3227
324 Ga0207668_10054712 3300025972 Bacteria 2771
325 Ga0207668_10564732 3300025972 Bacteria 987
326 Ga0207668_10776580 3300025972 Bacteria 847
327 Ga0207640_10164423 3300025981 Bacteria 1646
328 Ga0207640_10366137 3300025981 Bacteria 1163
329 Ga0207658_10248038 3300025986 Bacteria 1512
330 Ga0207677_10011321 3300026023 Bacteria 5081
331 Ga0207677_10169759 3300026023 Bacteria 1704
332 Ga0207677_10193453 3300026023 Bacteria 1611
333 Ga0207677_10554270 3300026023 Unclassified 1002
334 Ga0207703_10090639 3300026035 Unclassified 2570
335 Ga0207639_10234922 3300026041 Bacteria 1591
336 Ga0207639_10285050 3300026041 Unclassified 1454
337 Ga0207678_10003067 3300026067 Bacteria 15101
338 Ga0207678_10011709 3300026067 Bacteria 7697
339 Ga0207678_10688036 3300026067 Unclassified 900
340 Ga0207708_10023868 3300026075 Bacteria 4624
341 Ga0207702_10299221 3300026078 Bacteria 1526
342 Ga0207702_10312640 3300026078 Bacteria 1494
343 Ga0207702_10401916 3300026078 Bacteria 1321
344 Ga0207641_10402877 3300026088 Bacteria 1314
345 Ga0207641_11149225 3300026088 Bacteria 775
346 Ga0207648_10135363 3300026089 Unclassified 2170
347 Ga0207648_10355838 3300026089 Bacteria 1320
348 Ga0207648_11157876 3300026089 Bacteria 726
349 Ga0207676_10194193 3300026095 Bacteria 1789
350 Ga0207674_10060296 3300026116 Bacteria 3838
351 Ga0207675_100005899 3300026118 Bacteria 11691
352 Ga0207675_100047901 3300026118 Bacteria 3990
353 Ga0207675_100178139 3300026118 Unclassified 2035
354 Ga0207675_100185501 3300026118 Bacteria 1993
355 Ga0207675_101022486 3300026118 Bacteria 845
356 Ga0207675_101891555 3300026118 Bacteria 615
357 Ga0207683_10003241 3300026121 Bacteria 14199
358 Ga0207683_10005783 3300026121 Bacteria 10600
359 Ga0207698_10068319 3300026142 Bacteria 2806
360 Ga0207428_10006215 3300027907 Bacteria 11036
361 Ga0268266_10395485 3300028379 Unclassified 1306
362 Ga0268266_10616673 3300028379 Bacteria 1043
363 Ga0268265_10136109 3300028380 Bacteria 2050
364 Ga0268265_10147768 3300028380 Bacteria 1978
365 Ga0268265_10341970 3300028380 Bacteria 1363
366 Ga0268264_10145819 3300028381 Bacteria 2116
367 Ga0268264_10338136 3300028381 Bacteria 1429
368 Ga0268264_11293437 3300028381 Bacteria 739
369 Ga0316182_1060232 3300030745 Bacteria 970
370 Ga0307405_10484871 3300031731 Bacteria 988
371 Ga0307413_10123933 3300031824 Bacteria 1756
372 Ga0307413_10239400 3300031824 Unclassified 1339
373 Ga0307407_10962011 3300031903 Bacteria 658
374 Ga0307409_100125425 3300031995 Bacteria 2183
375 Ga0307409_100136824 3300031995 Bacteria 2104
376 Ga0307414_10092906 3300032004 Bacteria 2248
377 Ga0307411_10153870 3300032005 Bacteria 1713
378 Ga0307411_10358309 3300032005 Bacteria 1192
379 Ga0307415_100862348 3300032126 Bacteria 832
380 Ga0373930_0044336 3300034816 Bacteria 956
381 Ga0373930_0085300 3300034816 Bacteria 735
382 Ga0373958_0046200 3300034819 Bacteria 907
383 Ga0373938_0011501 3300034957 Unclassified 1647
384 Ga0373926_0207076 3300035083 Bacteria 755
385 Ga0373928_0016790 3300035084 Bacteria 1500
386 Ga0373928_0027492 3300035084 Bacteria 1239
387 Ga0373929_0029414 3300035085 Bacteria 1166
388 Ga0373951_0032570 3300035091 Bacteria 1233
389 Ga0373952_0013921 3300035092 Bacteria 1603
390 Ga0373952_0076797 3300035092 Bacteria 845
391 Ga0373932_0154545 3300035112 Unclassified 789
392 Ga0373939_0142144 3300035114 Bacteria 866
393 Ga0373960_0044026 3300035121 Bacteria 1302
394 Ga0373960_0070177 3300035121 Unclassified 1082
395 Ga0373955_0575081 3300035172 Bacteria 690
396 Ga0373942_0004663 3300035207 Bacteria 3175
397 Ga0373961_0065392 3300035241 Bacteria 1113
398 Ga0373962_0014291 3300035242 Unclassified 2022
399 Ga0373962_0064357 3300035242 Bacteria 1083
400 Ga0373931_0012341 3300035691 Bacteria 4138
401 Ga0373931_0047356 3300035691 Unclassified 2275
402 Ga0373931_0243215 3300035691 Bacteria 1092
403 Ga0373931_0262345 3300035691 Bacteria 1054
404 Ga0373937_0113372 3300036401 Bacteria 2523
405 Ga0395898_0703243 3300037466 Bacteria 952
406 Ga0395901_0275638 3300038443 Bacteria 1749
407 Ga0436365_1425590 3300039437 Bacteria 5061
408 Ga0466963_0039536 3300044694 Bacteria 3089
409 Ga0466963_0160053 3300044694 Bacteria 1567
410 Ga0466957_0119304 3300044842 Bacteria 1680
411 Ga0466960_0221646 3300044901 Bacteria 1041
412 Ga0466967_0003063 3300045976 Bacteria 10731
413 Ga0466967_0086106 3300045976 Bacteria 2846
414 Ga0466967_0321352 3300045976 Bacteria 1493
415 Ga0495629_0245940 3300046459 Bacteria 1231
416 Ga0495653_0184026 3300046463 Bacteria 1431
417 Ga0495582_0352556 3300046473 Unclassified 847
418 Ga0495594_0197141 3300046499 Bacteria 1148
419 Ga0495608_0052317 3300046511 Bacteria 2704
420 Ga0495618_0621595 3300046514 Bacteria 641
421 Ga0495652_0774741 3300046529 Bacteria 640
422 Ga0495645_0075971 3300046543 Bacteria 2418
423 Ga0495667_0135851 3300046559 Bacteria 1585
424 Ga0495656_0108728 3300046615 Bacteria 1293
425 Ga0495611_0239268 3300046648 Bacteria 843
426 Ga0495635_0396208 3300046663 Unclassified 917
427 Ga0495599_0523500 3300046678 Unclassified 696
428 Ga0495658_0684878 3300046683 Bacteria 657
429 Ga0495613_0106350 3300046689 Bacteria 2025
430 Ga0496100_0051321 3300048903 Bacteria 2677
431 Ga0496100_0296448 3300048903 Bacteria 1209
432 Ga0496101_0227758 3300048904 Bacteria 1448
433 Ga0496101_0251084 3300048904 Bacteria 1378
434 Ga0496101_0312396 3300048904 Bacteria 1232
435 Ga0496102_0020035 3300048905 Bacteria 5903
436 Ga0496102_0698425 3300048905 Bacteria 937
437 Ga0496103_0152831 3300048906 Bacteria 1479
438 Ga0496103_0257717 3300048906 Bacteria 1122
439 Ga0496104_0006154 3300048907 Bacteria 10532
440 Ga0496104_0061737 3300048907 Unclassified 3553
441 Ga0496104_0127307 3300048907 Bacteria 2446
442 Ga0496104_0177310 3300048907 Bacteria 2041
443 Ga0496104_0840231 3300048907 Bacteria 824
444 Ga0496105_0004066 3300048908 Bacteria 10948
445 Ga0496105_0009056 3300048908 Bacteria 7766
446 Ga0496105_0026664 3300048908 Bacteria 4716
447 Ga0496106_0033860 3300048909 Bacteria 3814
448 Ga0496106_0040573 3300048909 Bacteria 3486
449 Ga0496106_0239293 3300048909 Unclassified 1450
450 Ga0496107_0015879 3300048910 Bacteria 5282
451 Ga0496107_0095042 3300048910 Bacteria 2180
452 Ga0496107_0095950 3300048910 Unclassified 2170
453 Ga0496107_0924640 3300048910 Bacteria 635
454 Ga0496108_0007478 3300048911 Bacteria 8853
455 Ga0496108_0025507 3300048911 Bacteria 4871
456 Ga0496108_0036754 3300048911 Bacteria 4076
457 Ga0496108_0154440 3300048911 Bacteria 1981
458 Ga0496109_0011885 3300048912 Bacteria 7494
459 Ga0496109_0164668 3300048912 Bacteria 2078
460 Ga0496109_0393535 3300048912 Bacteria 1309
461 Ga0496110_0010216 3300048913 Bacteria 7628
462 Ga0496110_0075550 3300048913 Bacteria 2994
463 Ga0496110_0185911 3300048913 Bacteria 1887
464 Ga0496110_0217648 3300048913 Bacteria 1737
465 Ga0496111_0016268 3300048914 Bacteria 5124
466 Ga0496111_0092277 3300048914 Unclassified 2219
467 Ga0496111_0162407 3300048914 Bacteria 1659
468 Ga0496112_0086924 3300048915 Bacteria 3093
469 Ga0496112_0152347 3300048915 Bacteria 2279
470 Ga0496112_1067381 3300048915 Bacteria 726
471 Ga0496113_0011792 3300048916 Bacteria 5854
472 Ga0496114_0005046 3300048917 Bacteria 10294
473 Ga0496114_0011020 3300048917 Bacteria 7210
474 Ga0496114_0142722 3300048917 Unclassified 2074
475 Ga0496115_0001118 3300048918 Bacteria 19349
476 Ga0496115_0199166 3300048918 Bacteria 1654
477 Ga0496121_0527458 3300048924 Bacteria 744
478 Ga0501031_0252138 3300049568 Bacteria 1147
479 Ga0501039_0005872 3300049575 Bacteria 9303
480 Ga0501039_0583105 3300049575 Bacteria 877
481 Ga0501039_0585458 3300049575 Bacteria 875
482 Ga0501040_0324301 3300049576 Bacteria 1102
483 Ga0501040_0558107 3300049576 Bacteria 827
484 Ga0501042_0387183 3300049578 Bacteria 1013
485 Ga0501076_0288499 3300049592 Bacteria 1345
486 Ga0501045_0145248 3300049824 Bacteria 1764
487 nmdc:mga05p37_48360_c1 3300050507 Bacteria 5232
488 nmdc:mga09592_311009_c1 3300050508 Bacteria 1365
489 nmdc:mga06r32_22298_c1 3300050510 Bacteria 5853
490 nmdc:mga08y16_273387_c1 3300050511 Bacteria 1744
491 nmdc:mga08y16_655457_c1 3300050511 Bacteria 1053
492 nmdc:mga08y16_936439_c1 3300050511 Bacteria 850
493 nmdc:mga0n895_33465_c1 3300050512 Bacteria 4941
494 nmdc:mga0n895_3458_c1 3300050512 Bacteria 12746
495 nmdc:mga0n895_51331_c1 3300050512 Bacteria 4046
496 nmdc:mga0rr50_136094_c1 3300050513 Bacteria 1972
497 nmdc:mga0rr50_157867_c1 3300050513 Unclassified 1839
498 nmdc:mga0rr50_24445_c1 3300050513 Bacteria 4184
499 nmdc:mga08x19_350370_c1 3300050514 Unclassified 1031
500 nmdc:mga0a205_6497_c1 3300050515 Bacteria 10573
501 nmdc:mga0a205_91266_c1 3300050515 Bacteria 2943
502 nmdc:mga0a205_93435_c1 3300050515 Bacteria 2906
503 Ga0495619_0001961 3300053085 Bacteria 13732
504 Ga0495619_0146430 3300053085 Bacteria 1628
505 Ga0501084_0158938 3300054114 Bacteria 1907
506 2644230901 2643221641 Bacteria 4490190
507 2808903116 2808606372 Bacteria 4649509
508 2816423900 2816332119 Bacteria 8120218
509 Ga0105247_10037582
510 JGI24743J22301_10026892
511 JGI25404J52841_10036079
512 Ga0070690_100306514
513 Ga0070690_100325332
514 Ga0068869_100017446
515 Ga0068869_100165748
516 Ga0070666_10096352
517 Ga0070680_100506285
518 Ga0070682_100094513
519 Ga0070682_100193190
520 Ga0068868_100012855
521 Ga0068868_100088431
522 Ga0070660_100011652
523 Ga0070660_100013214
524 Ga0070660_100210120
525 Ga0070689_100039050
526 Ga0070691_10074404
527 Ga0070661_100965148
528 Ga0070692_10019284
529 Ga0070692_10047477
530 Ga0070692_10294783
531 Ga0070668_100008325
532 Ga0070668_100025504
533 Ga0070668_100077226
534 Ga0070668_100095315
535 Ga0070668_100497425
536 Ga0070669_100073559
537 Ga0070669_100080948
538 Ga0070675_101148596
539 Ga0070671_100200994
540 Ga0070671_100265421
541 Ga0070674_100038742
542 Ga0070674_100882171
543 Ga0070674_100914073
544 Ga0070659_100002973
545 Ga0070659_100358493
546 Ga0070659_100928453
547 Ga0070709_10022969
548 Ga0070709_10130247
549 Ga0070714_100035725
550 Ga0070714_100172504
551 Ga0070713_100032979
552 Ga0070713_100048875
553 Ga0070713_100080646
554 Ga0070710_10118465
555 Ga0070710_10170495
556 Ga0070701_10325921
557 Ga0070711_100271916
558 Ga0070705_100714379
559 Ga0070700_100026627
560 Ga0070700_100058057
561 Ga0070694_100057035
562 Ga0070694_100098660
563 Ga0070708_100486656
564 Ga0070678_100783024
565 Ga0070678_101045381
566 Ga0070662_100016999
567 Ga0070662_100040885
568 Ga0070662_100253893
569 Ga0070662_100686209
570 Ga0068867_100319561
571 Ga0068867_100667543
572 Ga0068867_100953681
573 Ga0070685_10226563
574 Ga0070685_10235111
575 Ga0070706_100234570
576 Ga0070699_100279276
577 Ga0070684_100195641
578 Ga0068853_100098391
579 Ga0068853_100173364
580 Ga0068853_100468157
581 Ga0068853_100480090
582 Ga0068853_100908646
583 Ga0070686_100251447
584 Ga0070686_100651353
585 Ga0070696_100055205
586 Ga0070696_100076836
587 Ga0070665_100324137
588 Ga0070665_100400806
589 Ga0070665_100931997
590 Ga0070665_101583722
591 Ga0070704_100016737
592 Ga0070704_100026925
593 Ga0070704_100139686
594 Ga0068855_100028971
595 Ga0068855_100066384
596 Ga0068855_100097899
597 Ga0068855_100251156
598 Ga0070664_100051641
599 Ga0070664_101270928
600 Ga0068857_100215424
601 Ga0068854_100040456
602 Ga0068856_100061335
603 Ga0068856_100285365
604 Ga0070702_100009631
605 Ga0070702_100174012
606 Ga0070702_100189196
607 Ga0070702_100484615
608 Ga0068852_100042214
609 Ga0068852_100378870
610 Ga0068859_100034342
611 Ga0068859_100082852
612 Ga0068864_100012025
613 Ga0068864_100088789
614 Ga0068866_10025636
615 Ga0068866_10101488
616 Ga0068861_100014250
617 Ga0068861_100020808
618 Ga0068861_100055279
619 Ga0068861_100721010
620 Ga0068851_10141608
621 Ga0068851_10267342
622 Ga0068863_100335642
623 Ga0068863_100630869
624 Ga0068858_100051532
625 Ga0068858_101374042
626 Ga0068860_100055415
627 Ga0068860_100060533
628 Ga0081455_10000377
629 Ga0081455_10022919
630 Ga0081455_10055942
631 Ga0081455_10074883
632 Ga0081455_10128969
633 Ga0081455_10393351
634 Ga0081538_10026178
635 Ga0081540_1000574
636 Ga0081540_1000905
637 Ga0081540_1007849
638 Ga0081540_1155056
639 Ga0070717_10031494
640 Ga0070717_10059380
641 Ga0070717_10215758
642 Ga0075432_10001414
643 Ga0070715_10021619
644 Ga0070715_10055901
645 Ga0070716_100039829
646 Ga0070716_100065422
647 Ga0070712_100730277
648 Ga0097621_100044566
649 Ga0068871_100417387
650 Ga0075428_100029987
651 Ga0075428_100062791
652 Ga0075431_100004941
653 Ga0075433_10020344
654 Ga0075433_10089570
655 Ga0075433_10180162
656 Ga0075434_100032443
657 Ga0075434_100033981
658 Ga0075434_100107628
659 Ga0075434_100116860
660 Ga0075429_100045384
661 Ga0068865_100137194
662 Ga0068865_100141959
663 Ga0075436_100101924
664 Ga0075436_100459716
665 Ga0097620_100034341
666 Ga0097620_100082854
667 Ga0075435_100001912
668 Ga0075435_100025507
669 Ga0075435_100050555
670 Ga0105240_10167096
671 Ga0105240_10278156
672 Ga0111539_10034942
673 Ga0111539_10089956
674 Ga0105245_10011934
675 Ga0105245_10022991
676 Ga0105245_10049527
677 Ga0105245_10170303
678 Ga0105247_10018527
679 Ga0105247_10293777
680 Ga0114129_10025933
681 Ga0105243_10018825
682 Ga0105243_10027736
683 Ga0105243_10053761
684 Ga0105243_10505142
685 Ga0105241_10047052
686 Ga0105241_10199016
687 Ga0105241_10273836
688 Ga0105242_10010067
689 Ga0105242_10031052
690 Ga0105242_10156114
691 Ga0105242_10276848
692 Ga0105248_10306944
693 Ga0105248_10385524
694 Ga0105237_10082649
695 Ga0105238_10026466
696 Ga0105238_10294920
697 Ga0105238_10370906
698 Ga0105238_10537884
699 Ga0105249_10002751
700 Ga0105249_10007651
701 Ga0105249_10113157
702 Ga0105249_10189043
703 Ga0105239_10036083
704 Ga0105239_10051172
705 Ga0105239_10124432
706 Ga0105239_10202534
707 Ga0105246_10007329
708 Ga0105246_10019872
709 Ga0105246_10163008
710 Ga0157371_10197000
711 Ga0157371_10429710
712 Ga0157370_10022246
713 Ga0157370_10045518
714 Ga0157370_10054525
715 Ga0157369_10043949
716 Ga0157369_10242322
717 Ga0157369_10346710
718 Ga0157374_10088704
719 Ga0157374_10315350
720 Ga0157374_10668378
721 Ga0157378_10054587
722 Ga0157378_10093575
723 Ga0157378_10514620
724 Ga0163162_10018545
725 Ga0163162_10055468
726 Ga0163162_10090329
727 Ga0163162_10762114
728 Ga0157372_10049209
729 Ga0157372_10055082
730 Ga0157372_10409560
731 Ga0157375_10044694
732 Ga0157375_10205450
733 Ga0157375_10301381
734 Ga0157375_10360789
735 Ga0163163_10012694
736 Ga0163163_10443641
737 Ga0163163_11366075
738 Ga0157380_10027641
739 Ga0157380_10312796
740 Ga0157377_10096428
741 Ga0157377_10135957
742 Ga0157379_10026521
743 Ga0157379_10345290
744 Ga0157379_10997274
745 Ga0157376_10011357
746 Ga0157376_11671152
747 Ga0163161_10004408
748 Ga0163161_10029013
749 Ga0163161_10029744
750 Ga0163161_10030643
751 Ga0163161_10397582
752 Ga0207656_10189561
753 Ga0207653_10055422
754 Ga0207642_10018733
755 Ga0207642_10344640
756 Ga0207710_10054288
757 Ga0207710_10114195
758 Ga0207710_10164746
759 Ga0207688_10005368
760 Ga0207688_10005906
761 Ga0207688_10020361
762 Ga0207688_10087530
763 Ga0207647_10116436
764 Ga0207699_10018252
765 Ga0207699_10032357
766 Ga0207645_10400702
767 Ga0207643_10142750
768 Ga0207654_10025888
769 Ga0207654_10180874
770 Ga0207654_10277444
771 Ga0207695_10074194
772 Ga0207695_10248937
773 Ga0207671_10085370
774 Ga0207671_10278459
775 Ga0207693_10001373
776 Ga0207693_10002990
777 Ga0207693_10473649
778 Ga0207663_10605323
779 Ga0207660_10162893
780 Ga0207662_10007468
781 Ga0207657_10004597
782 Ga0207657_10025167
783 Ga0207681_10059430
784 Ga0207681_10448718
785 Ga0207694_10074944
786 Ga0207694_10211880
787 Ga0207659_10058059
788 Ga0207687_10019489
789 Ga0207700_10111296
790 Ga0207700_10135756
791 Ga0207700_10170216
792 Ga0207664_10049439
793 Ga0207664_10149118
794 Ga0207664_10238534
795 Ga0207644_10188607
796 Ga0207690_10066881
797 Ga0207690_10067904
798 Ga0207690_10219939
799 Ga0207706_10015740
800 Ga0207706_10073965
801 Ga0207706_10453168
802 Ga0207706_10704951
803 Ga0207686_10016301
804 Ga0207686_10301961
805 Ga0207709_10425545
806 Ga0207709_11082223
807 Ga0207670_10146186
808 Ga0207670_10266040
809 Ga0207669_10097056
810 Ga0207669_10836315
811 Ga0207669_11161053
812 Ga0207665_10000395
813 Ga0207665_10025393
814 Ga0207665_10045910
815 Ga0207711_10219301
816 Ga0207711_10297534
817 Ga0207711_11290865
818 Ga0207689_10048726
819 Ga0207689_10121799
820 Ga0207689_10125854
821 Ga0207679_10171086
822 Ga0207679_10306889
823 Ga0207679_10428595
824 Ga0207667_10045734
825 Ga0207667_10083786
826 Ga0207667_10490054
827 Ga0207667_10516916
828 Ga0207712_10017754
829 Ga0207712_10130465
830 Ga0207712_10977350
831 Ga0207668_10038005
832 Ga0207668_10054712
833 Ga0207668_10564732
834 Ga0207668_10776580
835 Ga0207640_10164423
836 Ga0207640_10366137
837 Ga0207658_10248038
838 Ga0207677_10011321
839 Ga0207677_10169759
840 Ga0207677_10193453
841 Ga0207677_10554270
842 Ga0207703_10090639
843 Ga0207639_10234922
844 Ga0207639_10285050
845 Ga0207678_10003067
846 Ga0207678_10011709
847 Ga0207678_10688036
848 Ga0207708_10023868
849 Ga0207702_10299221
850 Ga0207702_10312640
851 Ga0207702_10401916
852 Ga0207641_10402877
853 Ga0207641_11149225
854 Ga0207648_10135363
855 Ga0207648_10355838
856 Ga0207648_11157876
857 Ga0207676_10194193
858 Ga0207674_10060296
859 Ga0207675_100005899
860 Ga0207675_100047901
861 Ga0207675_100178139
862 Ga0207675_100185501
863 Ga0207675_101022486
864 Ga0207675_101891555
865 Ga0207683_10003241
866 Ga0207683_10005783
867 Ga0207698_10068319
868 Ga0207428_10006215
869 Ga0268266_10395485
870 Ga0268266_10616673
871 Ga0268265_10136109
872 Ga0268265_10147768
873 Ga0268265_10341970
874 Ga0268264_10145819
875 Ga0268264_10338136
876 Ga0268264_11293437
877 Ga0316182_1060232
878 Ga0307405_10484871
879 Ga0307413_10123933
880 Ga0307413_10239400
881 Ga0307407_10962011
882 Ga0307409_100125425
883 Ga0307409_100136824
884 Ga0307414_10092906
885 Ga0307411_10153870
886 Ga0307411_10358309
887 Ga0307415_100862348
888 Ga0373930_0044336
889 Ga0373930_0085300
890 Ga0373958_0046200
891 Ga0373938_0011501
892 Ga0373926_0207076
893 Ga0373928_0016790
894 Ga0373928_0027492
895 Ga0373929_0029414
896 Ga0373951_0032570
897 Ga0373952_0013921
898 Ga0373952_0076797
899 Ga0373932_0154545
900 Ga0373939_0142144
901 Ga0373960_0044026
902 Ga0373960_0070177
903 Ga0373955_0575081
904 Ga0373942_0004663
905 Ga0373961_0065392
906 Ga0373962_0014291
907 Ga0373962_0064357
908 Ga0373931_0012341
909 Ga0373931_0047356
910 Ga0373931_0243215
911 Ga0373931_0262345
912 Ga0373937_0113372
913 Ga0395898_0703243
914 Ga0395901_0275638
915 Ga0436365_1425590
916 Ga0466963_0039536
917 Ga0466963_0160053
918 Ga0466957_0119304
919 Ga0466960_0221646
920 Ga0466967_0003063
921 Ga0466967_0086106
922 Ga0466967_0321352
923 Ga0495629_0245940
924 Ga0495653_0184026
925 Ga0495582_0352556
926 Ga0495594_0197141
927 Ga0495608_0052317
928 Ga0495618_0621595
929 Ga0495652_0774741
930 Ga0495645_0075971
931 Ga0495667_0135851
932 Ga0495656_0108728
933 Ga0495611_0239268
934 Ga0495635_0396208
935 Ga0495599_0523500
936 Ga0495658_0684878
937 Ga0495613_0106350
938 Ga0496100_0051321
939 Ga0496100_0296448
940 Ga0496101_0227758
941 Ga0496101_0251084
942 Ga0496101_0312396
943 Ga0496102_0020035
944 Ga0496102_0698425
945 Ga0496103_0152831
946 Ga0496103_0257717
947 Ga0496104_0006154
948 Ga0496104_0061737
949 Ga0496104_0127307
950 Ga0496104_0177310
951 Ga0496104_0840231
952 Ga0496105_0004066
953 Ga0496105_0009056
954 Ga0496105_0026664
955 Ga0496106_0033860
956 Ga0496106_0040573
957 Ga0496106_0239293
958 Ga0496107_0015879
959 Ga0496107_0095042
960 Ga0496107_0095950
961 Ga0496107_0924640
962 Ga0496108_0007478
963 Ga0496108_0025507
964 Ga0496108_0036754
965 Ga0496108_0154440
966 Ga0496109_0011885
967 Ga0496109_0164668
968 Ga0496109_0393535
969 Ga0496110_0010216
970 Ga0496110_0075550
971 Ga0496110_0185911
972 Ga0496110_0217648
973 Ga0496111_0016268
974 Ga0496111_0092277
975 Ga0496111_0162407
976 Ga0496112_0086924
977 Ga0496112_0152347
978 Ga0496112_1067381
979 Ga0496113_0011792
980 Ga0496114_0005046
981 Ga0496114_0011020
982 Ga0496114_0142722
983 Ga0496115_0001118
984 Ga0496115_0199166
985 Ga0496121_0527458
986 Ga0501031_0252138
987 Ga0501039_0005872
988 Ga0501039_0583105
989 Ga0501039_0585458
990 Ga0501040_0324301
991 Ga0501040_0558107
992 Ga0501042_0387183
993 Ga0501076_0288499
994 Ga0501045_0145248
995 nmdc:mga05p37_48360_c1
996 nmdc:mga09592_311009_c1
997 nmdc:mga06r32_22298_c1
998 nmdc:mga08y16_273387_c1
999 nmdc:mga08y16_655457_c1
1000 nmdc:mga08y16_936439_c1
1001 nmdc:mga0n895_33465_c1
1002 nmdc:mga0n895_3458_c1
1003 nmdc:mga0n895_51331_c1
1004 nmdc:mga0rr50_136094_c1
1005 nmdc:mga0rr50_157867_c1
1006 nmdc:mga0rr50_24445_c1
1007 nmdc:mga08x19_350370_c1
1008 nmdc:mga0a205_6497_c1
1009 nmdc:mga0a205_91266_c1
1010 nmdc:mga0a205_93435_c1
1011 Ga0495619_0001961
1012 Ga0495619_0146430
1013 Ga0501084_0158938
1014 2644230901
1015 2808903116
1016 2816423900

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

96

202

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vla-assembly1.cif.gz_A crystal structure of hydroperoxide resistance protein osmc (tm0919) from thermotoga maritima at 1.80 a resolution 0.754 38 125
2opl-assembly1.cif.gz_A crystal structure of an osmc-like protein (gsu2788) from geobacter sulfurreducens at 1.50 a resolution 0.7128 11 167
2qkd-assembly1.cif.gz_A crystal structure of tandem zpr1 domains 0.688 35 74
6mjn-assembly2.cif.gz_C crystal structure of an organic hydroperoxide resistance protein osmc, predicted redox protein, regulator of sulfide bond formation from legionella pneumophila 0.6553 37 125
2opl-assembly1.cif.gz_A crystal structure of an osmc-like protein (gsu2788) from geobacter sulfurreducens at 1.50 a resolution 0.6421 11 167
ID Description Score Start End Superfamily
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7296 36 125 3.30.300.20
af_Q9FYE6_150_240_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7188 36 54 3.30.70.260
2oplB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7066 11 163 3.30.300.20
2oplB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.6526 11 163 3.30.300.20
af_Q653Z3_11_182_3.30.2170.10 Alpha Beta;2-Layer Sandwich;archaeoglobus fulgidus dsm 4304 fold;archaeoglobus fulgidus dsm 4304 superfamily 0.6387 34 74 3.30.2170.10
ID Description Score Start End GO Terms
AF-A0A530QGW8-F1-model_v4 OsmC family peroxiredoxin 0.9059 6 73
AF-A0A6N6WSC8-F1-model_v4 OsmC family peroxiredoxin 0.891 16 113
AF-A0A3C1Z5S8-F1-model_v4 Osmotically inducible protein C 0.8893 12 109
AF-A0A810LS96-F1-model_v4 deleted 0.8732 11 121
AF-A0A530QGW8-F1-model_v4 OsmC family peroxiredoxin 0.8702 6 73

Map