F456744

General Info

Members Datasets Scaffolds Average Seq Length
507 253 1014 166

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0253723|Ga0496117_0253723_336_896
Length 186
Sequence LSKFRITLALALAAPLLLAGCGLQPMYAGGGSGAVARAVASVDVAPIAGKSGWLVRHALSDRLGSGSAGAGGQPGYRLDVRLDEKLQGLGQLSDDTITRERRTMRARYQLVDLSNGAIVVDATASVDGGLDVVSSEYSVIAAEQTVQENLARGIADQIVSRVATHLRAQAVGTAPVAVPAAPAAGQ

Samples

Sample ID Description Type Environment
1 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
136 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
149 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
150 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
151 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
152 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
153 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
172 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
173 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
174 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
175 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
184 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
185 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
216 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
217 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
218 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
222 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
227 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
228 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
229 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
230 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
231 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
232 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
233 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
234 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
235 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
236 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
239 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
240 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
241 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
243 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
244 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
245 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
246 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
247 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
248 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
249 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
250 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
251 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
252 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
253 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 0
Isolates 2.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.93
Nodule 0
Rhizoplane 3.94
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 2.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496117_0253723 3300048920 Unclassified 957
2 SwRhRL2b_contig_3239060 2162886007 Bacteria 10171
3 JGI24741J21665_1000799 3300001915 Bacteria 9453
4 JGI24740J21852_10002998 3300001979 Bacteria 7474
5 JGI24739J22299_10042330 3300001989 Bacteria 1511
6 JGI24737J22298_10002738 3300001990 Bacteria 6235
7 JGI24737J22298_10103665 3300001990 Bacteria 843
8 JGI24735J21928_10136348 3300002067 Bacteria 708
9 JGI24738J21930_10009404 3300002075 Bacteria 2199
10 Ga0065704_10000367 3300005289 Bacteria 42610
11 Ga0070658_10000177 3300005327 Bacteria 56043
12 Ga0070658_10003990 3300005327 Bacteria 12100
13 Ga0070658_10005880 3300005327 Bacteria 9948
14 Ga0070658_10009904 3300005327 Bacteria 7659
15 Ga0070658_10022364 3300005327 Bacteria 5073
16 Ga0070658_10638193 3300005327 Bacteria 924
17 Ga0070676_10047718 3300005328 Bacteria 2502
18 Ga0070683_100000686 3300005329 Bacteria 24502
19 Ga0070683_100963824 3300005329 Bacteria 819
20 Ga0070683_101446503 3300005329 Bacteria 661
21 Ga0070670_100020422 3300005331 Bacteria 5694
22 Ga0070670_100083578 3300005331 Bacteria 2743
23 Ga0070670_100721760 3300005331 Bacteria 897
24 Ga0070677_10020768 3300005333 Bacteria 2398
25 Ga0070677_10157579 3300005333 Bacteria 1062
26 Ga0068869_100730599 3300005334 Bacteria 846
27 Ga0070666_10002604 3300005335 Bacteria 10888
28 Ga0070680_100003215 3300005336 Bacteria 12157
29 Ga0070680_100235583 3300005336 Bacteria 1546
30 Ga0070682_100015188 3300005337 Bacteria 4457
31 Ga0070682_100501176 3300005337 Bacteria 941
32 Ga0070660_100000065 3300005339 Bacteria 61999
33 Ga0070691_10028607 3300005341 Bacteria 2605
34 Ga0070691_10224608 3300005341 Bacteria 997
35 Ga0070661_100001118 3300005344 Bacteria 18830
36 Ga0070661_100021755 3300005344 Bacteria 4586
37 Ga0070661_100051770 3300005344 Bacteria 3006
38 Ga0070661_100286785 3300005344 Bacteria 1278
39 Ga0070692_10054816 3300005345 Bacteria 2083
40 Ga0070669_100000068 3300005353 Bacteria 103282
41 Ga0070675_100007371 3300005354 Bacteria 8496
42 Ga0070675_100055309 3300005354 Bacteria 3267
43 Ga0070675_101473231 3300005354 Bacteria 628
44 Ga0070671_100000777 3300005355 Bacteria 22924
45 Ga0070671_100007774 3300005355 Bacteria 8564
46 Ga0070671_100014181 3300005355 Bacteria 6435
47 Ga0070671_100365212 3300005355 Bacteria 1232
48 Ga0070673_100072466 3300005364 Bacteria 2770
49 Ga0070673_100093442 3300005364 Bacteria 2463
50 Ga0070673_100566521 3300005364 Bacteria 1033
51 Ga0070673_100871525 3300005364 Bacteria 834
52 Ga0070659_100016120 3300005366 Bacteria 5608
53 Ga0070659_100020874 3300005366 Bacteria 4981
54 Ga0070659_100277780 3300005366 Bacteria 1393
55 Ga0070667_100000885 3300005367 Bacteria 27676
56 Ga0070714_100007587 3300005435 Bacteria 8449
57 Ga0070713_100751624 3300005436 Bacteria 933
58 Ga0070663_100000701 3300005455 Bacteria 18072
59 Ga0070663_100004345 3300005455 Bacteria 8314
60 Ga0070663_100008551 3300005455 Bacteria 6305
61 Ga0070663_100117975 3300005455 Bacteria 2001
62 Ga0070662_100000017 3300005457 Bacteria 105478
63 Ga0070662_100010180 3300005457 Bacteria 6165
64 Ga0070662_100170254 3300005457 Bacteria 1710
65 Ga0070662_100244916 3300005457 Bacteria 1439
66 Ga0070662_100271601 3300005457 Bacteria 1369
67 Ga0070662_100396021 3300005457 Bacteria 1139
68 Ga0070681_10476319 3300005458 Bacteria 1161
69 Ga0070681_10526871 3300005458 Bacteria 1095
70 Ga0068867_100155145 3300005459 Bacteria 1801
71 Ga0070685_10220451 3300005466 Bacteria 1242
72 Ga0068853_100000703 3300005539 Bacteria 23188
73 Ga0068853_100019262 3300005539 Bacteria 5657
74 Ga0068853_100070963 3300005539 Bacteria 3033
75 Ga0070672_100092224 3300005543 Bacteria 2445
76 Ga0070672_100133204 3300005543 Bacteria 2045
77 Ga0070672_100470426 3300005543 Bacteria 1084
78 Ga0070665_100007146 3300005548 Bacteria 11354
79 Ga0070665_100120909 3300005548 Bacteria 2620
80 Ga0070665_101080274 3300005548 Bacteria 814
81 Ga0068855_100000194 3300005563 Bacteria 78505
82 Ga0068855_100090047 3300005563 Bacteria 3541
83 Ga0070664_100000098 3300005564 Bacteria 55907
84 Ga0070664_100000564 3300005564 Bacteria 28338
85 Ga0070664_100657004 3300005564 Bacteria 975
86 Ga0070664_100883094 3300005564 Bacteria 838
87 Ga0068857_100255223 3300005577 Bacteria 1608
88 Ga0068857_100498129 3300005577 Bacteria 1143
89 Ga0068854_100000190 3300005578 Bacteria 41376
90 Ga0068854_100027986 3300005578 Bacteria 3890
91 Ga0068854_100075703 3300005578 Bacteria 2472
92 Ga0068854_100213390 3300005578 Bacteria 1524
93 Ga0068856_100000098 3300005614 Bacteria 83221
94 Ga0068856_100042444 3300005614 Bacteria 4474
95 Ga0068856_100045376 3300005614 Bacteria 4327
96 Ga0068856_100227044 3300005614 Bacteria 1883
97 Ga0068852_100000953 3300005616 Bacteria 19048
98 Ga0068852_100004187 3300005616 Bacteria 10167
99 Ga0068852_100035170 3300005616 Bacteria 4175
100 Ga0068852_100068922 3300005616 Bacteria 3098
101 Ga0068852_100084846 3300005616 Bacteria 2820
102 Ga0068852_100128343 3300005616 Bacteria 2332
103 Ga0068852_100212960 3300005616 Bacteria 1834
104 Ga0068852_101259990 3300005616 Bacteria 761
105 Ga0068864_100013726 3300005618 Bacteria 6720
106 Ga0068864_100037676 3300005618 Bacteria 4128
107 Ga0068866_10156662 3300005718 Bacteria 1324
108 Ga0068851_10034183 3300005834 Bacteria 2537
109 Ga0068851_10081667 3300005834 Bacteria 1689
110 Ga0068858_100468946 3300005842 Bacteria 1214
111 Ga0068860_100014304 3300005843 Bacteria 7781
112 Ga0068862_100391989 3300005844 Bacteria 1297
113 Ga0081539_10026719 3300005985 Bacteria 3673
114 Ga0075366_10239886 3300006195 Bacteria 1105
115 Ga0097621_100016498 3300006237 Bacteria 5585
116 Ga0097621_100053734 3300006237 Bacteria 3283
117 Ga0097621_100067283 3300006237 Bacteria 2953
118 Ga0097621_100443156 3300006237 Bacteria 1169
119 Ga0097621_101002778 3300006237 Bacteria 781
120 Ga0075370_10113172 3300006353 Bacteria 1577
121 Ga0068871_101168377 3300006358 Bacteria 721
122 Ga0068865_100063127 3300006881 Bacteria 2602
123 Ga0105251_10035303 3300009011 Bacteria 2468
124 Ga0105250_10006666 3300009092 Bacteria 5026
125 Ga0105240_10705337 3300009093 Bacteria 1101
126 Ga0105247_10051474 3300009101 Bacteria 2536
127 Ga0105248_10000206 3300009177 Bacteria 67932
128 Ga0105248_10664022 3300009177 Bacteria 1176
129 Ga0105248_10681986 3300009177 Bacteria 1159
130 Ga0105248_12035884 3300009177 Bacteria 652
131 Ga0105237_10021979 3300009545 Bacteria 6549
132 Ga0105238_10474089 3300009551 Bacteria 1250
133 Ga0105249_10172359 3300009553 Bacteria 2099
134 Ga0105239_10013516 3300010375 Bacteria 9063
135 Ga0157373_10060058 3300013100 Bacteria 2694
136 Ga0157373_10061686 3300013100 Bacteria 2655
137 Ga0157373_10475597 3300013100 Bacteria 901
138 Ga0157371_10002003 3300013102 Bacteria 20140
139 Ga0157371_10031652 3300013102 Bacteria 3811
140 Ga0157370_10001780 3300013104 Bacteria 26574
141 Ga0157370_10264129 3300013104 Bacteria 1590
142 Ga0157369_10111072 3300013105 Bacteria 2913
143 Ga0157369_11846512 3300013105 Bacteria 614
144 Ga0157374_10121085 3300013296 Bacteria 2525
145 Ga0157374_10138233 3300013296 Bacteria 2363
146 Ga0157378_10628507 3300013297 Bacteria 1088
147 Ga0163162_10214574 3300013306 Bacteria 2055
148 Ga0163162_10738687 3300013306 Bacteria 1104
149 Ga0157372_10000935 3300013307 Bacteria 31869
150 Ga0157372_10046088 3300013307 Bacteria 4839
151 Ga0157372_11044040 3300013307 Bacteria 946
152 Ga0163163_10000169 3300014325 Bacteria 68481
153 Ga0157379_10032532 3300014968 Bacteria 4650
154 Ga0163161_10028666 3300017792 Bacteria 3954
155 Ga0163161_10234846 3300017792 Bacteria 1424
156 Ga0213876_10051622 3300021384 Bacteria 2173
157 Ga0209257_1025099 3300025304 Bacteria 2045
158 Ga0207656_10118793 3300025321 Bacteria 1229
159 Ga0207656_10125973 3300025321 Bacteria 1196
160 Ga0207656_10162427 3300025321 Bacteria 1064
161 Ga0207696_1007258 3300025711 Bacteria 4356
162 Ga0207682_10022538 3300025893 Bacteria 2482
163 Ga0207688_10012631 3300025901 Bacteria 4596
164 Ga0207680_10001493 3300025903 Bacteria 11049
165 Ga0207647_10014428 3300025904 Bacteria 5448
166 Ga0207705_10000137 3300025909 Bacteria 79174
167 Ga0207705_10018022 3300025909 Bacteria 5050
168 Ga0207705_10038325 3300025909 Bacteria 3431
169 Ga0207705_10244471 3300025909 Bacteria 1367
170 Ga0207705_10940576 3300025909 Bacteria 669
171 Ga0207707_11146186 3300025912 Bacteria 632
172 Ga0207695_10145156 3300025913 Bacteria 2318
173 Ga0207695_10338012 3300025913 Bacteria 1394
174 Ga0207671_10048484 3300025914 Bacteria 3144
175 Ga0207660_10000099 3300025917 Bacteria 48138
176 Ga0207660_10003983 3300025917 Bacteria 9628
177 Ga0207660_10349022 3300025917 Bacteria 1186
178 Ga0207657_10000508 3300025919 Bacteria 41139
179 Ga0207657_10010922 3300025919 Bacteria 9036
180 Ga0207649_10000186 3300025920 Bacteria 50868
181 Ga0207649_10012773 3300025920 Bacteria 4672
182 Ga0207649_10373334 3300025920 Bacteria 1061
183 Ga0207649_10845655 3300025920 Bacteria 716
184 Ga0207681_10000105 3300025923 Bacteria 71882
185 Ga0207694_10219664 3300025924 Bacteria 1550
186 Ga0207650_10060313 3300025925 Bacteria 2831
187 Ga0207659_10259237 3300025926 Bacteria 1414
188 Ga0207664_10255221 3300025929 Bacteria 1532
189 Ga0207644_10001155 3300025931 Bacteria 16926
190 Ga0207644_10011415 3300025931 Bacteria 5877
191 Ga0207644_10080322 3300025931 Bacteria 2408
192 Ga0207644_10136290 3300025931 Bacteria 1885
193 Ga0207690_10000108 3300025932 Bacteria 67599
194 Ga0207690_10275884 3300025932 Bacteria 1308
195 Ga0207690_11009933 3300025932 Bacteria 692
196 Ga0207706_10000514 3300025933 Bacteria 41167
197 Ga0207706_10003931 3300025933 Bacteria 14095
198 Ga0207706_10004258 3300025933 Bacteria 13468
199 Ga0207706_10360462 3300025933 Bacteria 1263
200 Ga0207669_10093102 3300025937 Bacteria 1968
201 Ga0207704_10057788 3300025938 Bacteria 2385
202 Ga0207691_10020614 3300025940 Bacteria 6233
203 Ga0207691_10064621 3300025940 Bacteria 3315
204 Ga0207711_10011712 3300025941 Bacteria 7284
205 Ga0207711_10028465 3300025941 Bacteria 4702
206 Ga0207711_10637182 3300025941 Bacteria 994
207 Ga0207711_10779572 3300025941 Bacteria 891
208 Ga0207661_10002683 3300025944 Bacteria 12245
209 Ga0207679_10000114 3300025945 Bacteria 64628
210 Ga0207679_10003265 3300025945 Bacteria 10017
211 Ga0207679_10672321 3300025945 Bacteria 938
212 Ga0207667_10003951 3300025949 Bacteria 18243
213 Ga0207667_10065642 3300025949 Bacteria 3784
214 Ga0207667_10074230 3300025949 Bacteria 3533
215 Ga0207667_10079013 3300025949 Bacteria 3409
216 Ga0207667_10898051 3300025949 Bacteria 878
217 Ga0207651_10581177 3300025960 Bacteria 977
218 Ga0207712_10184639 3300025961 Bacteria 1641
219 Ga0207640_10002181 3300025981 Bacteria 10529
220 Ga0207640_10021792 3300025981 Bacteria 3824
221 Ga0207640_10039996 3300025981 Bacteria 2972
222 Ga0207640_10058379 3300025981 Bacteria 2542
223 Ga0207658_10000205 3300025986 Bacteria 61647
224 Ga0207703_10753751 3300026035 Bacteria 928
225 Ga0207639_10000139 3300026041 Bacteria 54240
226 Ga0207639_10021224 3300026041 Bacteria 4662
227 Ga0207639_10121945 3300026041 Bacteria 2143
228 Ga0207678_10001471 3300026067 Bacteria 21592
229 Ga0207678_10002094 3300026067 Bacteria 18070
230 Ga0207678_10065000 3300026067 Bacteria 3134
231 Ga0207702_10011773 3300026078 Bacteria 7285
232 Ga0207702_10040515 3300026078 Bacteria 3905
233 Ga0207702_10063787 3300026078 Bacteria 3151
234 Ga0207702_10537563 3300026078 Bacteria 1142
235 Ga0207702_10610768 3300026078 Bacteria 1071
236 Ga0207648_10190078 3300026089 Bacteria 1819
237 Ga0207648_10194245 3300026089 Bacteria 1799
238 Ga0207676_10057191 3300026095 Bacteria 3070
239 Ga0207676_10140616 3300026095 Bacteria 2066
240 Ga0207674_10066210 3300026116 Bacteria 3639
241 Ga0207674_10616691 3300026116 Bacteria 1048
242 Ga0207683_10042881 3300026121 Bacteria 3952
243 Ga0207698_10006324 3300026142 Bacteria 7375
244 Ga0207698_10062491 3300026142 Bacteria 2908
245 Ga0207698_10082694 3300026142 Bacteria 2596
246 Ga0268266_10004774 3300028379 Bacteria 12886
247 Ga0268266_10018643 3300028379 Bacteria 5913
248 Ga0268266_11188141 3300028379 Unclassified 738
249 Ga0268264_10029692 3300028381 Bacteria 4481
250 Ga0268264_11500845 3300028381 Bacteria 685
251 Ga0307408_100076800 3300031548 Bacteria 2485
252 Ga0307405_10009000 3300031731 Bacteria 5098
253 Ga0307405_10190237 3300031731 Bacteria 1482
254 Ga0307405_10359902 3300031731 Bacteria 1125
255 Ga0307413_10005140 3300031824 Bacteria 5798
256 Ga0307413_10238740 3300031824 Bacteria 1340
257 Ga0307413_10445824 3300031824 Unclassified 1026
258 Ga0307410_10026479 3300031852 Bacteria 3651
259 Ga0307410_10517207 3300031852 Bacteria 984
260 Ga0307410_11186296 3300031852 Bacteria 664
261 Ga0307406_10123626 3300031901 Bacteria 1803
262 Ga0307406_10305203 3300031901 Bacteria 1225
263 Ga0307407_10005479 3300031903 Bacteria 5512
264 Ga0307407_10249488 3300031903 Bacteria 1215
265 Ga0307407_10598821 3300031903 Bacteria 820
266 Ga0307412_10021469 3300031911 Bacteria 3944
267 Ga0307412_10145279 3300031911 Bacteria 1742
268 Ga0307412_10992844 3300031911 Bacteria 741
269 Ga0307409_100064594 3300031995 Bacteria 2876
270 Ga0307409_100090287 3300031995 Bacteria 2507
271 Ga0307409_100096348 3300031995 Bacteria 2440
272 Ga0307409_100130558 3300031995 Bacteria 2146
273 Ga0307409_100531845 3300031995 Bacteria 1150
274 Ga0307409_100608991 3300031995 Bacteria 1080
275 Ga0307416_100037316 3300032002 Bacteria 3737
276 Ga0307416_100986148 3300032002 Bacteria 945
277 Ga0307414_10000613 3300032004 Bacteria 18271
278 Ga0307414_10021847 3300032004 Bacteria 4026
279 Ga0307414_10046577 3300032004 Bacteria 2977
280 Ga0307414_10194977 3300032004 Bacteria 1642
281 Ga0307414_10409793 3300032004 Bacteria 1179
282 Ga0307414_10431946 3300032004 Bacteria 1151
283 Ga0307411_10047831 3300032005 Bacteria 2767
284 Ga0307411_10385048 3300032005 Bacteria 1154
285 Ga0307411_10477641 3300032005 Bacteria 1049
286 Ga0307411_10636737 3300032005 Bacteria 921
287 Ga0307415_100184021 3300032126 Bacteria 1642
288 Ga0307415_100288871 3300032126 Bacteria 1353
289 Ga0373930_0093232 3300034816 Bacteria 708
290 Ga0373941_0059462 3300035115 Bacteria 1239
291 Ga0373962_0237021 3300035242 Bacteria 629
292 Ga0395899_0000157 3300037312 Bacteria 103574
293 Ga0395899_0004063 3300037312 Bacteria 11532
294 Ga0395899_0181137 3300037312 Bacteria 1479
295 Ga0395899_0453244 3300037312 Bacteria 839
296 Ga0395900_0000296 3300037418 Bacteria 74995
297 Ga0395900_0023558 3300037418 Bacteria 6299
298 Ga0395900_0058723 3300037418 Bacteria 3960
299 Ga0395900_0140894 3300037418 Bacteria 2469
300 Ga0395900_0165781 3300037418 Bacteria 2251
301 Ga0395900_0260025 3300037418 Bacteria 1734
302 Ga0395900_0474234 3300037418 Unclassified 1204
303 Ga0395900_0791145 3300037418 Bacteria 877
304 Ga0395900_0950819 3300037418 Unclassified 781
305 Ga0395900_0989111 3300037418 Bacteria 761
306 Ga0395898_0000054 3300037466 Bacteria 279561
307 Ga0395898_0002796 3300037466 Bacteria 20008
308 Ga0395898_0287321 3300037466 Bacteria 1569
309 Ga0395898_0495479 3300037466 Bacteria 1162
310 Ga0395898_0918043 3300037466 Bacteria 813
311 Ga0395905_0000046 3300037471 Bacteria 240463
312 Ga0395905_0000464 3300037471 Bacteria 56406
313 Ga0395905_0020644 3300037471 Bacteria 6237
314 Ga0395905_0023995 3300037471 Bacteria 5758
315 Ga0395905_0043210 3300037471 Bacteria 4228
316 Ga0395905_0047032 3300037471 Bacteria 4045
317 Ga0395905_0094343 3300037471 Bacteria 2807
318 Ga0395905_0103829 3300037471 Bacteria 2668
319 Ga0395905_0115056 3300037471 Bacteria 2527
320 Ga0395905_0443521 3300037471 Bacteria 1195
321 Ga0395905_0744919 3300037471 Bacteria 882
322 Ga0395905_0929174 3300037471 Bacteria 773
323 Ga0395901_0000102 3300038443 Bacteria 115611
324 Ga0395901_0007681 3300038443 Bacteria 10878
325 Ga0395901_0025487 3300038443 Bacteria 6071
326 Ga0395901_0104869 3300038443 Bacteria 2967
327 Ga0395901_0280245 3300038443 Bacteria 1732
328 Ga0436365_0297974 3300039437 Bacteria 4310
329 Ga0436365_0499291 3300039437 Bacteria 964
330 Ga0436365_1539210 3300039437 Bacteria 929
331 Ga0436363_0764936 3300039450 Bacteria 2592
332 Ga0451845_0624705 3300041501 Bacteria 700
333 Ga0451853_1808560 3300041512 Bacteria 2612
334 Ga0451853_3131387 3300041512 Bacteria 566
335 Ga0439448_0003219 3300042005 Bacteria 4507
336 Ga0439449_0045523 3300042007 Bacteria 1626
337 Ga0439455_0050263 3300042012 Bacteria 1088
338 Ga0439462_0000601 3300042015 Bacteria 7171
339 Ga0450912_001923 3300042116 Bacteria 1338
340 Ga0450898_061447 3300042134 Bacteria 740
341 Ga0450905_039281 3300042142 Bacteria 749
342 Ga0439458_0000054 3300042157 Bacteria 19456
343 Ga0439458_0000602 3300042157 Bacteria 9267
344 Ga0439458_0009452 3300042157 Bacteria 2170
345 Ga0466969_0023726 3300044656 Bacteria 3160
346 Ga0466969_0054687 3300044656 Bacteria 1955
347 Ga0466969_0337972 3300044656 Bacteria 682
348 Ga0466972_0016071 3300044658 Bacteria 3742
349 Ga0466972_0046433 3300044658 Bacteria 2102
350 Ga0466972_0520713 3300044658 Bacteria 560
351 Ga0466965_0092760 3300044683 Bacteria 1538
352 Ga0466966_0011562 3300044684 Bacteria 5853
353 Ga0466966_0026192 3300044684 Bacteria 3808
354 Ga0466966_0234118 3300044684 Bacteria 1108
355 Ga0466966_0599128 3300044684 Bacteria 663
356 Ga0466961_0005952 3300044693 Bacteria 7728
357 Ga0466961_0026283 3300044693 Bacteria 3743
358 Ga0466961_0054856 3300044693 Bacteria 2542
359 Ga0466961_0113844 3300044693 Bacteria 1701
360 Ga0466961_0211893 3300044693 Bacteria 1196
361 Ga0466961_0279647 3300044693 Bacteria 1021
362 Ga0466961_0321434 3300044693 Bacteria 944
363 Ga0466963_0015290 3300044694 Bacteria 4748
364 Ga0466963_0170558 3300044694 Bacteria 1517
365 Ga0466963_0380223 3300044694 Unclassified 995
366 Ga0466963_0414988 3300044694 Bacteria 949
367 Ga0466964_0338727 3300044706 Bacteria 769
368 Ga0466964_0398034 3300044706 Bacteria 719
369 Ga0466971_0024541 3300044719 Bacteria 2690
370 Ga0466971_0073042 3300044719 Bacteria 1559
371 Ga0466971_0196789 3300044719 Bacteria 951
372 Ga0466970_0015064 3300044765 Bacteria 3977
373 Ga0466970_0042876 3300044765 Bacteria 2407
374 Ga0466970_0055675 3300044765 Bacteria 2112
375 Ga0466970_0182124 3300044765 Bacteria 1166
376 Ga0466970_0561800 3300044765 Bacteria 660
377 Ga0466970_0704495 3300044765 Bacteria 589
378 Ga0466957_0009362 3300044842 Bacteria 5592
379 Ga0466957_0029871 3300044842 Bacteria 3252
380 Ga0466960_0045062 3300044901 Bacteria 2105
381 Ga0466960_0422895 3300044901 Bacteria 770
382 Ga0466959_0001462 3300045049 Bacteria 14472
383 Ga0466959_0017659 3300045049 Bacteria 5231
384 Ga0466958_0002649 3300045836 Bacteria 9045
385 Ga0466958_0274429 3300045836 Bacteria 1080
386 Ga0466958_0380492 3300045836 Bacteria 910
387 Ga0466958_0612882 3300045836 Bacteria 708
388 Ga0466958_0707434 3300045836 Bacteria 656
389 Ga0466967_0093782 3300045976 Bacteria 2732
390 Ga0466967_0163859 3300045976 Bacteria 2088
391 Ga0466967_0206180 3300045976 Bacteria 1863
392 Ga0466967_0504763 3300045976 Unclassified 1187
393 Ga0466967_0551803 3300045976 Bacteria 1134
394 Ga0466967_0555246 3300045976 Unclassified 1130
395 Ga0466967_0785120 3300045976 Bacteria 945
396 Ga0466967_1180881 3300045976 Unclassified 762
397 Ga0495638_0005534 3300046460 Bacteria 9367
398 Ga0495638_0021653 3300046460 Bacteria 4231
399 Ga0495583_0000212 3300046506 Bacteria 97784
400 Ga0495583_0224141 3300046506 Bacteria 759
401 Ga0495610_0084617 3300046512 Bacteria 1449
402 Ga0495637_0086879 3300046520 Bacteria 1239
403 Ga0495642_0163146 3300046528 Bacteria 967
404 Ga0495654_0051632 3300046530 Bacteria 2006
405 Ga0495621_0035471 3300046539 Bacteria 1728
406 Ga0495597_0149384 3300046542 Bacteria 959
407 Ga0495633_0436037 3300046558 Bacteria 592
408 Ga0495611_0574198 3300046648 Bacteria 510
409 Ga0495661_0021234 3300046665 Bacteria 4235
410 Ga0495669_0000394 3300046684 Bacteria 21743
411 Ga0495670_0000016 3300046691 Bacteria 128045
412 Ga0495670_0042237 3300046691 Bacteria 2275
413 Ga0495670_0421313 3300046691 Bacteria 722
414 Ga0495649_0376954 3300046694 Bacteria 714
415 Ga0495687_140035 3300047443 Bacteria 843
416 Ga0495687_186441 3300047443 Bacteria 672
417 Ga0495677_0020557 3300047445 Bacteria 2393
418 Ga0495685_246857 3300047447 Bacteria 567
419 Ga0495673_0008688 3300047469 Bacteria 5679
420 Ga0495686_0000139 3300047472 Bacteria 145796
421 Ga0495686_0000483 3300047472 Bacteria 59235
422 Ga0495686_0131736 3300047472 Bacteria 1482
423 Ga0496101_0338977 3300048904 Bacteria 1181
424 Ga0496102_0002820 3300048905 Bacteria 14794
425 Ga0496103_0000289 3300048906 Bacteria 47033
426 Ga0496104_0000161 3300048907 Bacteria 60841
427 Ga0496105_0019273 3300048908 Bacteria 5502
428 Ga0496107_0662319 3300048910 Bacteria 769
429 Ga0496108_0123190 3300048911 Bacteria 2224
430 Ga0496108_0380286 3300048911 Bacteria 1233
431 Ga0496108_1033166 3300048911 Unclassified 701
432 Ga0496109_0201913 3300048912 Bacteria 1869
433 Ga0496110_0545215 3300048913 Bacteria 1054
434 Ga0496111_0041519 3300048914 Bacteria 3301
435 Ga0496111_0097966 3300048914 Bacteria 2153
436 Ga0496112_0004470 3300048915 Bacteria 11856
437 Ga0496112_0387739 3300048915 Bacteria 1337
438 Ga0496112_0695020 3300048915 Unclassified 945
439 Ga0496112_0798287 3300048915 Bacteria 869
440 Ga0496113_0103026 3300048916 Bacteria 2213
441 Ga0496114_0115491 3300048917 Bacteria 2303
442 Ga0496115_0348303 3300048918 Bacteria 1208
443 Ga0496117_0019670 3300048920 Bacteria 5534
444 Ga0496117_0185973 3300048920 Bacteria 1188
445 Ga0496118_0367232 3300048921 Bacteria 760
446 Ga0496119_0000734 3300048922 Bacteria 44175
447 Ga0496120_0030902 3300048923 Bacteria 3249
448 Ga0496121_0016344 3300048924 Bacteria 7668
449 Ga0496122_0006228 3300048925 Bacteria 13806
450 Ga0496122_0104512 3300048925 Bacteria 1881
451 Ga0496123_0002539 3300048926 Bacteria 22352
452 Ga0496123_0006076 3300048926 Bacteria 11848
453 Ga0496124_0006526 3300048927 Bacteria 12690
454 Ga0496124_0040051 3300048927 Bacteria 4055
455 Ga0496125_0001514 3300048928 Bacteria 33291
456 Ga0496126_0000661 3300048929 Bacteria 63847
457 Ga0496126_0239650 3300048929 Bacteria 1516
458 Ga0495682_0010782 3300049460 Bacteria 3527
459 Ga0501047_0130274 3300049581 Bacteria 2396
460 Ga0501067_0042006 3300049583 Bacteria 2539
461 Ga0501070_0274763 3300049586 Bacteria 1375
462 Ga0501073_0122050 3300049589 Bacteria 1806
463 Ga0501209_117367 3300049656 Bacteria 788
464 Ga0501217_100953 3300049661 Bacteria 820
465 Ga0501233_114364 3300049668 Bacteria 724
466 Ga0501235_099420 3300049669 Bacteria 709
467 Ga0501249_010966 3300049679 Bacteria 1899
468 Ga0501080_0011614 3300049742 Bacteria 8065
469 Ga0501268_001930 3300049765 Bacteria 2655
470 Ga0501274_013435 3300049771 Bacteria 786
471 Ga0501044_0532342 3300049823 Bacteria 1074
472 nmdc:mga0k408_168131_c1 3300050493 Bacteria 1307
473 nmdc:mga0k408_202140_c1 3300050493 Bacteria 1186
474 nmdc:mga07m45_218141_c1 3300050496 Bacteria 1110
475 nmdc:mga07m45_461852_c1 3300050496 Bacteria 736
476 Ga0500643_002137 3300053087 Bacteria 10477
477 Ga0500643_010063 3300053087 Bacteria 3555
478 Ga0500646_0165386 3300053090 Bacteria 741
479 Ga0500647_0020537 3300053091 Bacteria 3075
480 Ga0500555_000195 3300053103 Bacteria 27996
481 Ga0500594_0045629 3300053118 Bacteria 1216
482 Ga0500607_166759 3300053121 Bacteria 998
483 Ga0500608_001602 3300053122 Bacteria 8122
484 Ga0500614_121625 3300053123 Bacteria 769
485 Ga0500618_022940 3300053125 Bacteria 1514
486 Ga0500564_104486 3300053138 Bacteria 1248
487 Ga0500564_199800 3300053138 Bacteria 822
488 Ga0500573_0109239 3300053140 Bacteria 1549
489 Ga0500616_0034578 3300053153 Bacteria 2752
490 Ga0500567_000596 3300053723 Bacteria 12885
491 Ga0500625_000004 3300053729 Bacteria 245905
492 Ga0500645_122099 3300053730 Bacteria 726
493 Ga0500661_042198 3300055283 Bacteria 809
494 Ga0466962_0021860 3300061719 Bacteria 3071
495 Ga0466962_0061979 3300061719 Bacteria 1785
496 Ga0466962_0105353 3300061719 Bacteria 1356
497 2738711218 2738541275 Bacteria 4830863
498 2738849643 2738541301 Bacteria 4834102
499 2738865372 2738541304 Bacteria 4833665
500 2739297890 2738543022 Bacteria 4835059
501 2739359568 2738543033 Bacteria 4833336
502 2739650692 2739367664 Bacteria 4114334
503 2740029165 2739367865 Bacteria 4114482
504 2830076129 2830075706 Bacteria 3855215
505 2848300452 2848297114 Bacteria 3608511
506 2928103962 2928100450 Bacteria 4837635
507 2928961494 2928959182 Bacteria 4725774
508 Ga0496117_0253723
509 SwRhRL2b_contig_3239060
510 JGI24741J21665_1000799
511 JGI24740J21852_10002998
512 JGI24739J22299_10042330
513 JGI24737J22298_10002738
514 JGI24737J22298_10103665
515 JGI24735J21928_10136348
516 JGI24738J21930_10009404
517 Ga0065704_10000367
518 Ga0070658_10000177
519 Ga0070658_10003990
520 Ga0070658_10005880
521 Ga0070658_10009904
522 Ga0070658_10022364
523 Ga0070658_10638193
524 Ga0070676_10047718
525 Ga0070683_100000686
526 Ga0070683_100963824
527 Ga0070683_101446503
528 Ga0070670_100020422
529 Ga0070670_100083578
530 Ga0070670_100721760
531 Ga0070677_10020768
532 Ga0070677_10157579
533 Ga0068869_100730599
534 Ga0070666_10002604
535 Ga0070680_100003215
536 Ga0070680_100235583
537 Ga0070682_100015188
538 Ga0070682_100501176
539 Ga0070660_100000065
540 Ga0070691_10028607
541 Ga0070691_10224608
542 Ga0070661_100001118
543 Ga0070661_100021755
544 Ga0070661_100051770
545 Ga0070661_100286785
546 Ga0070692_10054816
547 Ga0070669_100000068
548 Ga0070675_100007371
549 Ga0070675_100055309
550 Ga0070675_101473231
551 Ga0070671_100000777
552 Ga0070671_100007774
553 Ga0070671_100014181
554 Ga0070671_100365212
555 Ga0070673_100072466
556 Ga0070673_100093442
557 Ga0070673_100566521
558 Ga0070673_100871525
559 Ga0070659_100016120
560 Ga0070659_100020874
561 Ga0070659_100277780
562 Ga0070667_100000885
563 Ga0070714_100007587
564 Ga0070713_100751624
565 Ga0070663_100000701
566 Ga0070663_100004345
567 Ga0070663_100008551
568 Ga0070663_100117975
569 Ga0070662_100000017
570 Ga0070662_100010180
571 Ga0070662_100170254
572 Ga0070662_100244916
573 Ga0070662_100271601
574 Ga0070662_100396021
575 Ga0070681_10476319
576 Ga0070681_10526871
577 Ga0068867_100155145
578 Ga0070685_10220451
579 Ga0068853_100000703
580 Ga0068853_100019262
581 Ga0068853_100070963
582 Ga0070672_100092224
583 Ga0070672_100133204
584 Ga0070672_100470426
585 Ga0070665_100007146
586 Ga0070665_100120909
587 Ga0070665_101080274
588 Ga0068855_100000194
589 Ga0068855_100090047
590 Ga0070664_100000098
591 Ga0070664_100000564
592 Ga0070664_100657004
593 Ga0070664_100883094
594 Ga0068857_100255223
595 Ga0068857_100498129
596 Ga0068854_100000190
597 Ga0068854_100027986
598 Ga0068854_100075703
599 Ga0068854_100213390
600 Ga0068856_100000098
601 Ga0068856_100042444
602 Ga0068856_100045376
603 Ga0068856_100227044
604 Ga0068852_100000953
605 Ga0068852_100004187
606 Ga0068852_100035170
607 Ga0068852_100068922
608 Ga0068852_100084846
609 Ga0068852_100128343
610 Ga0068852_100212960
611 Ga0068852_101259990
612 Ga0068864_100013726
613 Ga0068864_100037676
614 Ga0068866_10156662
615 Ga0068851_10034183
616 Ga0068851_10081667
617 Ga0068858_100468946
618 Ga0068860_100014304
619 Ga0068862_100391989
620 Ga0081539_10026719
621 Ga0075366_10239886
622 Ga0097621_100016498
623 Ga0097621_100053734
624 Ga0097621_100067283
625 Ga0097621_100443156
626 Ga0097621_101002778
627 Ga0075370_10113172
628 Ga0068871_101168377
629 Ga0068865_100063127
630 Ga0105251_10035303
631 Ga0105250_10006666
632 Ga0105240_10705337
633 Ga0105247_10051474
634 Ga0105248_10000206
635 Ga0105248_10664022
636 Ga0105248_10681986
637 Ga0105248_12035884
638 Ga0105237_10021979
639 Ga0105238_10474089
640 Ga0105249_10172359
641 Ga0105239_10013516
642 Ga0157373_10060058
643 Ga0157373_10061686
644 Ga0157373_10475597
645 Ga0157371_10002003
646 Ga0157371_10031652
647 Ga0157370_10001780
648 Ga0157370_10264129
649 Ga0157369_10111072
650 Ga0157369_11846512
651 Ga0157374_10121085
652 Ga0157374_10138233
653 Ga0157378_10628507
654 Ga0163162_10214574
655 Ga0163162_10738687
656 Ga0157372_10000935
657 Ga0157372_10046088
658 Ga0157372_11044040
659 Ga0163163_10000169
660 Ga0157379_10032532
661 Ga0163161_10028666
662 Ga0163161_10234846
663 Ga0213876_10051622
664 Ga0209257_1025099
665 Ga0207656_10118793
666 Ga0207656_10125973
667 Ga0207656_10162427
668 Ga0207696_1007258
669 Ga0207682_10022538
670 Ga0207688_10012631
671 Ga0207680_10001493
672 Ga0207647_10014428
673 Ga0207705_10000137
674 Ga0207705_10018022
675 Ga0207705_10038325
676 Ga0207705_10244471
677 Ga0207705_10940576
678 Ga0207707_11146186
679 Ga0207695_10145156
680 Ga0207695_10338012
681 Ga0207671_10048484
682 Ga0207660_10000099
683 Ga0207660_10003983
684 Ga0207660_10349022
685 Ga0207657_10000508
686 Ga0207657_10010922
687 Ga0207649_10000186
688 Ga0207649_10012773
689 Ga0207649_10373334
690 Ga0207649_10845655
691 Ga0207681_10000105
692 Ga0207694_10219664
693 Ga0207650_10060313
694 Ga0207659_10259237
695 Ga0207664_10255221
696 Ga0207644_10001155
697 Ga0207644_10011415
698 Ga0207644_10080322
699 Ga0207644_10136290
700 Ga0207690_10000108
701 Ga0207690_10275884
702 Ga0207690_11009933
703 Ga0207706_10000514
704 Ga0207706_10003931
705 Ga0207706_10004258
706 Ga0207706_10360462
707 Ga0207669_10093102
708 Ga0207704_10057788
709 Ga0207691_10020614
710 Ga0207691_10064621
711 Ga0207711_10011712
712 Ga0207711_10028465
713 Ga0207711_10637182
714 Ga0207711_10779572
715 Ga0207661_10002683
716 Ga0207679_10000114
717 Ga0207679_10003265
718 Ga0207679_10672321
719 Ga0207667_10003951
720 Ga0207667_10065642
721 Ga0207667_10074230
722 Ga0207667_10079013
723 Ga0207667_10898051
724 Ga0207651_10581177
725 Ga0207712_10184639
726 Ga0207640_10002181
727 Ga0207640_10021792
728 Ga0207640_10039996
729 Ga0207640_10058379
730 Ga0207658_10000205
731 Ga0207703_10753751
732 Ga0207639_10000139
733 Ga0207639_10021224
734 Ga0207639_10121945
735 Ga0207678_10001471
736 Ga0207678_10002094
737 Ga0207678_10065000
738 Ga0207702_10011773
739 Ga0207702_10040515
740 Ga0207702_10063787
741 Ga0207702_10537563
742 Ga0207702_10610768
743 Ga0207648_10190078
744 Ga0207648_10194245
745 Ga0207676_10057191
746 Ga0207676_10140616
747 Ga0207674_10066210
748 Ga0207674_10616691
749 Ga0207683_10042881
750 Ga0207698_10006324
751 Ga0207698_10062491
752 Ga0207698_10082694
753 Ga0268266_10004774
754 Ga0268266_10018643
755 Ga0268266_11188141
756 Ga0268264_10029692
757 Ga0268264_11500845
758 Ga0307408_100076800
759 Ga0307405_10009000
760 Ga0307405_10190237
761 Ga0307405_10359902
762 Ga0307413_10005140
763 Ga0307413_10238740
764 Ga0307413_10445824
765 Ga0307410_10026479
766 Ga0307410_10517207
767 Ga0307410_11186296
768 Ga0307406_10123626
769 Ga0307406_10305203
770 Ga0307407_10005479
771 Ga0307407_10249488
772 Ga0307407_10598821
773 Ga0307412_10021469
774 Ga0307412_10145279
775 Ga0307412_10992844
776 Ga0307409_100064594
777 Ga0307409_100090287
778 Ga0307409_100096348
779 Ga0307409_100130558
780 Ga0307409_100531845
781 Ga0307409_100608991
782 Ga0307416_100037316
783 Ga0307416_100986148
784 Ga0307414_10000613
785 Ga0307414_10021847
786 Ga0307414_10046577
787 Ga0307414_10194977
788 Ga0307414_10409793
789 Ga0307414_10431946
790 Ga0307411_10047831
791 Ga0307411_10385048
792 Ga0307411_10477641
793 Ga0307411_10636737
794 Ga0307415_100184021
795 Ga0307415_100288871
796 Ga0373930_0093232
797 Ga0373941_0059462
798 Ga0373962_0237021
799 Ga0395899_0000157
800 Ga0395899_0004063
801 Ga0395899_0181137
802 Ga0395899_0453244
803 Ga0395900_0000296
804 Ga0395900_0023558
805 Ga0395900_0058723
806 Ga0395900_0140894
807 Ga0395900_0165781
808 Ga0395900_0260025
809 Ga0395900_0474234
810 Ga0395900_0791145
811 Ga0395900_0950819
812 Ga0395900_0989111
813 Ga0395898_0000054
814 Ga0395898_0002796
815 Ga0395898_0287321
816 Ga0395898_0495479
817 Ga0395898_0918043
818 Ga0395905_0000046
819 Ga0395905_0000464
820 Ga0395905_0020644
821 Ga0395905_0023995
822 Ga0395905_0043210
823 Ga0395905_0047032
824 Ga0395905_0094343
825 Ga0395905_0103829
826 Ga0395905_0115056
827 Ga0395905_0443521
828 Ga0395905_0744919
829 Ga0395905_0929174
830 Ga0395901_0000102
831 Ga0395901_0007681
832 Ga0395901_0025487
833 Ga0395901_0104869
834 Ga0395901_0280245
835 Ga0436365_0297974
836 Ga0436365_0499291
837 Ga0436365_1539210
838 Ga0436363_0764936
839 Ga0451845_0624705
840 Ga0451853_1808560
841 Ga0451853_3131387
842 Ga0439448_0003219
843 Ga0439449_0045523
844 Ga0439455_0050263
845 Ga0439462_0000601
846 Ga0450912_001923
847 Ga0450898_061447
848 Ga0450905_039281
849 Ga0439458_0000054
850 Ga0439458_0000602
851 Ga0439458_0009452
852 Ga0466969_0023726
853 Ga0466969_0054687
854 Ga0466969_0337972
855 Ga0466972_0016071
856 Ga0466972_0046433
857 Ga0466972_0520713
858 Ga0466965_0092760
859 Ga0466966_0011562
860 Ga0466966_0026192
861 Ga0466966_0234118
862 Ga0466966_0599128
863 Ga0466961_0005952
864 Ga0466961_0026283
865 Ga0466961_0054856
866 Ga0466961_0113844
867 Ga0466961_0211893
868 Ga0466961_0279647
869 Ga0466961_0321434
870 Ga0466963_0015290
871 Ga0466963_0170558
872 Ga0466963_0380223
873 Ga0466963_0414988
874 Ga0466964_0338727
875 Ga0466964_0398034
876 Ga0466971_0024541
877 Ga0466971_0073042
878 Ga0466971_0196789
879 Ga0466970_0015064
880 Ga0466970_0042876
881 Ga0466970_0055675
882 Ga0466970_0182124
883 Ga0466970_0561800
884 Ga0466970_0704495
885 Ga0466957_0009362
886 Ga0466957_0029871
887 Ga0466960_0045062
888 Ga0466960_0422895
889 Ga0466959_0001462
890 Ga0466959_0017659
891 Ga0466958_0002649
892 Ga0466958_0274429
893 Ga0466958_0380492
894 Ga0466958_0612882
895 Ga0466958_0707434
896 Ga0466967_0093782
897 Ga0466967_0163859
898 Ga0466967_0206180
899 Ga0466967_0504763
900 Ga0466967_0551803
901 Ga0466967_0555246
902 Ga0466967_0785120
903 Ga0466967_1180881
904 Ga0495638_0005534
905 Ga0495638_0021653
906 Ga0495583_0000212
907 Ga0495583_0224141
908 Ga0495610_0084617
909 Ga0495637_0086879
910 Ga0495642_0163146
911 Ga0495654_0051632
912 Ga0495621_0035471
913 Ga0495597_0149384
914 Ga0495633_0436037
915 Ga0495611_0574198
916 Ga0495661_0021234
917 Ga0495669_0000394
918 Ga0495670_0000016
919 Ga0495670_0042237
920 Ga0495670_0421313
921 Ga0495649_0376954
922 Ga0495687_140035
923 Ga0495687_186441
924 Ga0495677_0020557
925 Ga0495685_246857
926 Ga0495673_0008688
927 Ga0495686_0000139
928 Ga0495686_0000483
929 Ga0495686_0131736
930 Ga0496101_0338977
931 Ga0496102_0002820
932 Ga0496103_0000289
933 Ga0496104_0000161
934 Ga0496105_0019273
935 Ga0496107_0662319
936 Ga0496108_0123190
937 Ga0496108_0380286
938 Ga0496108_1033166
939 Ga0496109_0201913
940 Ga0496110_0545215
941 Ga0496111_0041519
942 Ga0496111_0097966
943 Ga0496112_0004470
944 Ga0496112_0387739
945 Ga0496112_0695020
946 Ga0496112_0798287
947 Ga0496113_0103026
948 Ga0496114_0115491
949 Ga0496115_0348303
950 Ga0496117_0019670
951 Ga0496117_0185973
952 Ga0496118_0367232
953 Ga0496119_0000734
954 Ga0496120_0030902
955 Ga0496121_0016344
956 Ga0496122_0006228
957 Ga0496122_0104512
958 Ga0496123_0002539
959 Ga0496123_0006076
960 Ga0496124_0006526
961 Ga0496124_0040051
962 Ga0496125_0001514
963 Ga0496126_0000661
964 Ga0496126_0239650
965 Ga0495682_0010782
966 Ga0501047_0130274
967 Ga0501067_0042006
968 Ga0501070_0274763
969 Ga0501073_0122050
970 Ga0501209_117367
971 Ga0501217_100953
972 Ga0501233_114364
973 Ga0501235_099420
974 Ga0501249_010966
975 Ga0501080_0011614
976 Ga0501268_001930
977 Ga0501274_013435
978 Ga0501044_0532342
979 nmdc:mga0k408_168131_c1
980 nmdc:mga0k408_202140_c1
981 nmdc:mga07m45_218141_c1
982 nmdc:mga07m45_461852_c1
983 Ga0500643_002137
984 Ga0500643_010063
985 Ga0500646_0165386
986 Ga0500647_0020537
987 Ga0500555_000195
988 Ga0500594_0045629
989 Ga0500607_166759
990 Ga0500608_001602
991 Ga0500614_121625
992 Ga0500618_022940
993 Ga0500564_104486
994 Ga0500564_199800
995 Ga0500573_0109239
996 Ga0500616_0034578
997 Ga0500567_000596
998 Ga0500625_000004
999 Ga0500645_122099
1000 Ga0500661_042198
1001 Ga0466962_0021860
1002 Ga0466962_0061979
1003 Ga0466962_0105353
1004 2738711218
1005 2738849643
1006 2738865372
1007 2739297890
1008 2739359568
1009 2739650692
1010 2740029165
1011 2830076129
1012 2848300452
1013 2928103962
1014 2928961494

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04390

LptE

Lipopolysaccharide-assembly

39

162

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kwy-assembly2.cif.gz_B crystal structure of a putative lipoprotein (cc_3750) from caulobacter crescentus cb15 at 2.40 a resolution 0.8189 33 157
4kwy-assembly1.cif.gz_A crystal structure of a putative lipoprotein (cc_3750) from caulobacter crescentus cb15 at 2.40 a resolution 0.7835 31 165
2hhi-assembly1.cif.gz_A the solution structure of antigen mpt64 from mycobacterium tuberculosis defines a novel class of beta-grasp proteins 0.7831 66 121
4kwy-assembly2.cif.gz_B crystal structure of a putative lipoprotein (cc_3750) from caulobacter crescentus cb15 at 2.40 a resolution 0.772 33 157
4kwy-assembly1.cif.gz_A crystal structure of a putative lipoprotein (cc_3750) from caulobacter crescentus cb15 at 2.40 a resolution 0.7679 31 165
ID Description Score Start End Superfamily
4kwyB00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain 0.7974 33 157 3.30.160.150
af_P76512_1_120_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7826 68 122 2.40.128.20
af_Q4CZT4_1_148_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7744 68 119 3.10.450.50
af_Q9M386_71_218_2.60.40.1820 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7693 89 123 2.60.40.1820
4kwyB00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain 0.757 33 157 3.30.160.150
ID Description Score Start End GO Terms
AF-A0A350KZ18-F1-model_v4 deleted 0.9577 63 163
AF-A0A838VEM3-F1-model_v4 Secreted (Periplasmic)-like protein 0.9428 16 162 GO:0019867
GO:0043165
AF-A0A3D2E839-F1-model_v4 deleted 0.9367 63 163
AF-A0A2S6U8S6-F1-model_v4 Uncharacterized protein 0.9337 35 154 GO:0019867
GO:0043165
AF-A0A350KZ18-F1-model_v4 deleted 0.9308 63 163

Map