F456726
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 507 | 342 | 472 | 178 |
Family's Representative Sequence
| Representative Sequence | 3300046471|Ga0495650_0062714|Ga0495650_0062714_472_1053 |
| Length | 176 |
| Sequence | MARPDKVTAVAEIAEKFRGASLRDSLGGDTTYRVAKNTLVKRAAEDAGVQGLEQMLVGPTAIAFITGEPVDAAKALRDFAKTNPGLVIKGGFMDGRALTVTEVNQLADLESREVLLAKLAGAMKANLSKAAALFAAPASQVARLAQALADKRAEEEGPAVAEAAPEAVATEADPAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 2 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 3 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 4 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 5 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 6 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 7 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 8 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 9 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 10 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 11 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 12 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 13 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 14 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 15 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 16 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 17 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 18 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 19 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 20 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 21 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 22 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 23 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 24 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 25 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 26 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 27 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 28 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 29 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 30 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 31 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 32 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 33 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 34 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 35 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 36 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 37 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 38 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 39 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 40 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 41 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 43 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 46 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 49 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 86 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 88 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 89 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 100 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 101 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 102 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 106 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 107 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 141 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 142 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 194 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 195 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 198 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 207 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 208 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 209 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 210 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 211 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 212 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 213 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 217 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 218 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 219 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 220 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 221 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 222 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 223 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 224 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 225 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 228 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 229 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 230 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 231 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 232 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 233 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 236 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 237 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 238 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 239 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 240 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 241 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 242 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 243 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 244 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 245 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 246 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 247 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 288 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 289 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 290 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 291 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 292 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 293 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 294 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 295 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 296 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 314 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 315 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 316 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 317 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 320 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 321 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 322 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 325 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 327 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 328 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 329 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 330 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 331 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 332 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 333 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 334 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 335 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 336 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 337 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 338 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 340 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 341 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 342 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.15 |
| Metatranscriptomes | 3.94 |
| Isolates | 6.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.03 |
| Nodule | 0.2 |
| Rhizoplane | 9.07 |
| Rhizosphere | 66.86 |
| Stem | 0 |
| Stem Tuber | 0.2 |
| Unclassified | 11.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1008055 | 3300001977 | Bacteria | 1598 |
| 2 | JGI24743J22301_10019621 | 3300001991 | Bacteria | 1285 |
| 3 | JGI24745J21846_1001995 | 3300002073 | Bacteria | 2038 |
| 4 | JGI24748J21848_1007123 | 3300002074 | Bacteria | 1308 |
| 5 | JGI24738J21930_10023224 | 3300002075 | Bacteria | 1279 |
| 6 | JGI24749J21850_1006396 | 3300002076 | Bacteria | 1642 |
| 7 | JGI24744J21845_10018782 | 3300002077 | Bacteria | 1369 |
| 8 | JGI24034J26672_10003918 | 3300002239 | Bacteria | 2094 |
| 9 | JGI24034J26672_10019804 | 3300002239 | Bacteria | 1052 |
| 10 | JGI25406J46586_10000352 | 3300003203 | Bacteria | 20841 |
| 11 | Ga0007429J51699_1041500 | 3300003579 | Bacteria | 1067 |
| 12 | Ga0007429J51699_1152951 | 3300003579 | Bacteria | 900 |
| 13 | Ga0070676_10034219 | 3300005328 | Bacteria | 2917 |
| 14 | Ga0070690_100080359 | 3300005330 | Bacteria | 2132 |
| 15 | Ga0068869_100017836 | 3300005334 | Bacteria | 4822 |
| 16 | Ga0070666_10282779 | 3300005335 | Bacteria | 1179 |
| 17 | Ga0070682_100012214 | 3300005337 | Bacteria | 4918 |
| 18 | Ga0070682_100069055 | 3300005337 | Bacteria | 2255 |
| 19 | Ga0068868_100359553 | 3300005338 | Bacteria | 1249 |
| 20 | Ga0068868_100611388 | 3300005338 | Bacteria | 967 |
| 21 | Ga0068868_100763775 | 3300005338 | Bacteria | 869 |
| 22 | Ga0070691_10039689 | 3300005341 | Bacteria | 2224 |
| 23 | Ga0070687_100132763 | 3300005343 | Bacteria | 1439 |
| 24 | Ga0070692_10101827 | 3300005345 | Bacteria | 1576 |
| 25 | Ga0070668_100005182 | 3300005347 | Bacteria | 9666 |
| 26 | Ga0070668_100173581 | 3300005347 | Bacteria | 1756 |
| 27 | Ga0070668_100456196 | 3300005347 | Bacteria | 1100 |
| 28 | Ga0070669_100003150 | 3300005353 | Bacteria | 11859 |
| 29 | Ga0070669_100008483 | 3300005353 | Bacteria | 7336 |
| 30 | Ga0070671_100106155 | 3300005355 | Bacteria | 2357 |
| 31 | Ga0070674_100020764 | 3300005356 | Bacteria | 4204 |
| 32 | Ga0070674_100272225 | 3300005356 | Bacteria | 1339 |
| 33 | Ga0070673_100068687 | 3300005364 | Bacteria | 2838 |
| 34 | Ga0070673_100495091 | 3300005364 | Bacteria | 1105 |
| 35 | Ga0070688_100096555 | 3300005365 | Bacteria | 1941 |
| 36 | Ga0070659_101065645 | 3300005366 | Bacteria | 711 |
| 37 | Ga0070667_100000182 | 3300005367 | Bacteria | 75588 |
| 38 | Ga0070667_100039079 | 3300005367 | Bacteria | 3977 |
| 39 | Ga0070709_10137734 | 3300005434 | Bacteria | 1674 |
| 40 | Ga0070709_10707171 | 3300005434 | Bacteria | 784 |
| 41 | Ga0070714_100061871 | 3300005435 | Bacteria | 3216 |
| 42 | Ga0070714_100139699 | 3300005435 | Bacteria | 2173 |
| 43 | Ga0070713_100183300 | 3300005436 | Bacteria | 1882 |
| 44 | Ga0070710_10000440 | 3300005437 | Bacteria | 19508 |
| 45 | Ga0070701_10391377 | 3300005438 | Bacteria | 878 |
| 46 | Ga0070711_100023291 | 3300005439 | Bacteria | 4025 |
| 47 | Ga0070694_100059428 | 3300005444 | Bacteria | 2604 |
| 48 | Ga0070708_100665604 | 3300005445 | Bacteria | 981 |
| 49 | Ga0070663_100008819 | 3300005455 | Bacteria | 6222 |
| 50 | Ga0070678_100024948 | 3300005456 | Bacteria | 4012 |
| 51 | Ga0070678_100931486 | 3300005456 | Bacteria | 796 |
| 52 | Ga0070678_101116074 | 3300005456 | Bacteria | 729 |
| 53 | Ga0070662_100838424 | 3300005457 | Bacteria | 782 |
| 54 | Ga0070681_10051164 | 3300005458 | Bacteria | 4121 |
| 55 | Ga0070685_10103161 | 3300005466 | Bacteria | 1744 |
| 56 | Ga0070707_100385254 | 3300005468 | Bacteria | 1362 |
| 57 | Ga0070698_101618216 | 3300005471 | Bacteria | 600 |
| 58 | Ga0070684_100140483 | 3300005535 | Bacteria | 2184 |
| 59 | Ga0068853_100050120 | 3300005539 | Bacteria | 3591 |
| 60 | Ga0068853_100157366 | 3300005539 | Bacteria | 2048 |
| 61 | Ga0070686_100190485 | 3300005544 | Bacteria | 1463 |
| 62 | Ga0070695_100028151 | 3300005545 | Bacteria | 3486 |
| 63 | Ga0070696_100168343 | 3300005546 | Bacteria | 1618 |
| 64 | Ga0070693_100009478 | 3300005547 | Bacteria | 4844 |
| 65 | Ga0070665_100020670 | 3300005548 | Bacteria | 6613 |
| 66 | Ga0070704_100501237 | 3300005549 | Bacteria | 1053 |
| 67 | Ga0070664_100211857 | 3300005564 | Bacteria | 1732 |
| 68 | Ga0068857_100133976 | 3300005577 | Bacteria | 2237 |
| 69 | Ga0068856_100506993 | 3300005614 | Bacteria | 1228 |
| 70 | Ga0070702_100016098 | 3300005615 | Bacteria | 3830 |
| 71 | Ga0068852_100265143 | 3300005616 | Bacteria | 1651 |
| 72 | Ga0068852_100906319 | 3300005616 | Bacteria | 899 |
| 73 | Ga0068859_100003253 | 3300005617 | Bacteria | 16538 |
| 74 | Ga0068864_100062360 | 3300005618 | Bacteria | 3230 |
| 75 | Ga0068861_100385509 | 3300005719 | Bacteria | 1239 |
| 76 | Ga0068851_10040703 | 3300005834 | Bacteria | 2336 |
| 77 | Ga0068863_100005851 | 3300005841 | Bacteria | 12049 |
| 78 | Ga0068863_100054502 | 3300005841 | Bacteria | 3788 |
| 79 | Ga0068858_100707223 | 3300005842 | Bacteria | 981 |
| 80 | Ga0068860_100000048 | 3300005843 | Bacteria | 209375 |
| 81 | Ga0068860_100419919 | 3300005843 | Bacteria | 1326 |
| 82 | Ga0068862_100000053 | 3300005844 | Bacteria | 143631 |
| 83 | Ga0081455_10045957 | 3300005937 | Bacteria | 3794 |
| 84 | Ga0081539_10000132 | 3300005985 | Bacteria | 175454 |
| 85 | Ga0070717_10584156 | 3300006028 | Bacteria | 1013 |
| 86 | Ga0075365_10091651 | 3300006038 | Bacteria | 2071 |
| 87 | Ga0075365_10100820 | 3300006038 | Bacteria | 1977 |
| 88 | Ga0075365_10177000 | 3300006038 | Bacteria | 1490 |
| 89 | Ga0075365_10464010 | 3300006038 | Bacteria | 894 |
| 90 | Ga0075365_10558476 | 3300006038 | Bacteria | 810 |
| 91 | Ga0075363_100016960 | 3300006048 | Bacteria | 3605 |
| 92 | Ga0075363_100589092 | 3300006048 | Bacteria | 666 |
| 93 | Ga0075364_10029284 | 3300006051 | Bacteria | 3530 |
| 94 | Ga0075364_10068525 | 3300006051 | Bacteria | 2333 |
| 95 | Ga0075364_10089313 | 3300006051 | Bacteria | 2043 |
| 96 | Ga0075364_10452949 | 3300006051 | Bacteria | 877 |
| 97 | Ga0070715_10002591 | 3300006163 | Bacteria | 5584 |
| 98 | Ga0070716_100025226 | 3300006173 | Bacteria | 3170 |
| 99 | Ga0070716_100293994 | 3300006173 | Bacteria | 1127 |
| 100 | Ga0070712_100254562 | 3300006175 | Bacteria | 1405 |
| 101 | Ga0070712_100407273 | 3300006175 | Bacteria | 1124 |
| 102 | Ga0070712_100512460 | 3300006175 | Bacteria | 1007 |
| 103 | Ga0075362_10277310 | 3300006177 | Bacteria | 829 |
| 104 | Ga0075367_10052085 | 3300006178 | Bacteria | 2422 |
| 105 | Ga0075369_10000881 | 3300006186 | Bacteria | 9945 |
| 106 | Ga0075369_10033107 | 3300006186 | Bacteria | 2189 |
| 107 | Ga0075369_10052426 | 3300006186 | Bacteria | 1768 |
| 108 | Ga0075369_10054029 | 3300006186 | Bacteria | 1744 |
| 109 | Ga0075369_10201788 | 3300006186 | Bacteria | 918 |
| 110 | Ga0097621_100356176 | 3300006237 | Bacteria | 1302 |
| 111 | Ga0075370_10005308 | 3300006353 | Bacteria | 6385 |
| 112 | Ga0075370_10144220 | 3300006353 | Bacteria | 1393 |
| 113 | Ga0075370_10294879 | 3300006353 | Bacteria | 964 |
| 114 | Ga0075428_100026507 | 3300006844 | Bacteria | 6416 |
| 115 | Ga0075430_100396100 | 3300006846 | Bacteria | 1140 |
| 116 | Ga0075434_100721830 | 3300006871 | Bacteria | 1014 |
| 117 | Ga0097620_100003253 | 3300006931 | Bacteria | 16538 |
| 118 | Ga0105250_10081616 | 3300009092 | Bacteria | 1311 |
| 119 | Ga0105240_11227694 | 3300009093 | Bacteria | 793 |
| 120 | Ga0105245_10013916 | 3300009098 | Bacteria | 7007 |
| 121 | Ga0105245_10252212 | 3300009098 | Bacteria | 1715 |
| 122 | Ga0105245_10823839 | 3300009098 | Bacteria | 967 |
| 123 | Ga0105247_10000195 | 3300009101 | Bacteria | 59840 |
| 124 | Ga0105247_10032105 | 3300009101 | Bacteria | 3189 |
| 125 | Ga0105247_10805153 | 3300009101 | Bacteria | 717 |
| 126 | Ga0105243_10010077 | 3300009148 | Bacteria | 7186 |
| 127 | Ga0105241_10101524 | 3300009174 | Bacteria | 2287 |
| 128 | Ga0105242_10288041 | 3300009176 | Bacteria | 1494 |
| 129 | Ga0105248_10005324 | 3300009177 | Bacteria | 14167 |
| 130 | Ga0105248_10814442 | 3300009177 | Bacteria | 1054 |
| 131 | Ga0105237_10267488 | 3300009545 | Bacteria | 1712 |
| 132 | Ga0105238_10155760 | 3300009551 | Bacteria | 2260 |
| 133 | Ga0105249_10000022 | 3300009553 | Bacteria | 258377 |
| 134 | Ga0105249_10776234 | 3300009553 | Bacteria | 1021 |
| 135 | Ga0105249_12045362 | 3300009553 | Bacteria | 645 |
| 136 | Ga0099796_10148080 | 3300010159 | Bacteria | 922 |
| 137 | Ga0105239_10086453 | 3300010375 | Bacteria | 3456 |
| 138 | Ga0157371_10081996 | 3300013102 | Bacteria | 2284 |
| 139 | Ga0157369_10522498 | 3300013105 | Bacteria | 1228 |
| 140 | Ga0157374_10176284 | 3300013296 | Bacteria | 2087 |
| 141 | Ga0157374_10847130 | 3300013296 | Bacteria | 931 |
| 142 | Ga0157378_11108307 | 3300013297 | Bacteria | 829 |
| 143 | Ga0163162_10021950 | 3300013306 | Bacteria | 6289 |
| 144 | Ga0163162_10040909 | 3300013306 | Bacteria | 4637 |
| 145 | Ga0163162_10434238 | 3300013306 | Bacteria | 1445 |
| 146 | Ga0157375_10539287 | 3300013308 | Bacteria | 1329 |
| 147 | Ga0163163_10031308 | 3300014325 | Bacteria | 5134 |
| 148 | Ga0163163_10049333 | 3300014325 | Bacteria | 4142 |
| 149 | Ga0157379_10121187 | 3300014968 | Bacteria | 2353 |
| 150 | Ga0157379_10135295 | 3300014968 | Bacteria | 2220 |
| 151 | Ga0157379_10230117 | 3300014968 | Bacteria | 1680 |
| 152 | Ga0157376_10429564 | 3300014969 | Bacteria | 1284 |
| 153 | Ga0163161_10002416 | 3300017792 | Bacteria | 13397 |
| 154 | Ga0163161_10028266 | 3300017792 | Bacteria | 3981 |
| 155 | Ga0206356_11228734 | 3300020070 | Bacteria | 1213 |
| 156 | Ga0206356_11485773 | 3300020070 | Bacteria | 749 |
| 157 | Ga0206350_10285795 | 3300020080 | Bacteria | 1077 |
| 158 | Ga0206353_11819126 | 3300020082 | Bacteria | 1210 |
| 159 | Ga0213876_10050359 | 3300021384 | Bacteria | 2200 |
| 160 | Ga0213875_10206957 | 3300021388 | Bacteria | 923 |
| 161 | Ga0224712_10101591 | 3300022467 | Bacteria | 1220 |
| 162 | Ga0224712_10199734 | 3300022467 | Bacteria | 908 |
| 163 | Ga0209025_1092662 | 3300025294 | Bacteria | 983 |
| 164 | Ga0209051_1003277 | 3300025303 | Bacteria | 10740 |
| 165 | Ga0209051_1007600 | 3300025303 | Bacteria | 5902 |
| 166 | Ga0209051_1035079 | 3300025303 | Bacteria | 1871 |
| 167 | Ga0207653_10116497 | 3300025885 | Bacteria | 958 |
| 168 | Ga0207692_10079631 | 3300025898 | Bacteria | 1749 |
| 169 | Ga0207688_10032066 | 3300025901 | Bacteria | 2903 |
| 170 | Ga0207688_10041585 | 3300025901 | Bacteria | 2557 |
| 171 | Ga0207688_10057716 | 3300025901 | Bacteria | 2183 |
| 172 | Ga0207688_10157064 | 3300025901 | Bacteria | 1346 |
| 173 | Ga0207680_10197384 | 3300025903 | Bacteria | 1369 |
| 174 | Ga0207647_10219044 | 3300025904 | Bacteria | 1097 |
| 175 | Ga0207685_10358088 | 3300025905 | Bacteria | 738 |
| 176 | Ga0207699_10263218 | 3300025906 | Bacteria | 1193 |
| 177 | Ga0207645_10455065 | 3300025907 | Bacteria | 864 |
| 178 | Ga0207643_10267033 | 3300025908 | Bacteria | 1058 |
| 179 | Ga0207643_10287935 | 3300025908 | Bacteria | 1020 |
| 180 | Ga0207654_10046587 | 3300025911 | Bacteria | 2473 |
| 181 | Ga0207707_10271353 | 3300025912 | Bacteria | 1470 |
| 182 | Ga0207671_10138394 | 3300025914 | Bacteria | 1874 |
| 183 | Ga0207671_10206930 | 3300025914 | Bacteria | 1534 |
| 184 | Ga0207693_10004307 | 3300025915 | Bacteria | 12051 |
| 185 | Ga0207693_10038303 | 3300025915 | Bacteria | 3776 |
| 186 | Ga0207662_10093228 | 3300025918 | Bacteria | 1855 |
| 187 | Ga0207657_10020453 | 3300025919 | Bacteria | 6254 |
| 188 | Ga0207649_11184615 | 3300025920 | Bacteria | 604 |
| 189 | Ga0207652_10514385 | 3300025921 | Bacteria | 1077 |
| 190 | Ga0207646_10642958 | 3300025922 | Bacteria | 950 |
| 191 | Ga0207681_10041645 | 3300025923 | Bacteria | 3064 |
| 192 | Ga0207694_10833481 | 3300025924 | Bacteria | 779 |
| 193 | Ga0207687_10017222 | 3300025927 | Bacteria | 4753 |
| 194 | Ga0207687_10236285 | 3300025927 | Bacteria | 1446 |
| 195 | Ga0207664_10002268 | 3300025929 | Bacteria | 12671 |
| 196 | Ga0207664_10377159 | 3300025929 | Bacteria | 1258 |
| 197 | Ga0207690_10281123 | 3300025932 | Bacteria | 1296 |
| 198 | Ga0207690_10361343 | 3300025932 | Bacteria | 1150 |
| 199 | Ga0207686_10511534 | 3300025934 | Bacteria | 933 |
| 200 | Ga0207669_10008330 | 3300025937 | Bacteria | 4859 |
| 201 | Ga0207704_10008101 | 3300025938 | Bacteria | 5003 |
| 202 | Ga0207704_10825121 | 3300025938 | Bacteria | 776 |
| 203 | Ga0207665_10011729 | 3300025939 | Bacteria | 5758 |
| 204 | Ga0207665_10184822 | 3300025939 | Bacteria | 1511 |
| 205 | Ga0207691_10284003 | 3300025940 | Bacteria | 1424 |
| 206 | Ga0207711_10067288 | 3300025941 | Bacteria | 3100 |
| 207 | Ga0207711_10069827 | 3300025941 | Bacteria | 3046 |
| 208 | Ga0207689_10008495 | 3300025942 | Bacteria | 8950 |
| 209 | Ga0207651_10093906 | 3300025960 | Bacteria | 2204 |
| 210 | Ga0207712_10231081 | 3300025961 | Bacteria | 1485 |
| 211 | Ga0207712_10481306 | 3300025961 | Bacteria | 1058 |
| 212 | Ga0207668_10005451 | 3300025972 | Bacteria | 7493 |
| 213 | Ga0207668_10130447 | 3300025972 | Bacteria | 1918 |
| 214 | Ga0207668_10716799 | 3300025972 | Bacteria | 880 |
| 215 | Ga0207668_10855030 | 3300025972 | Bacteria | 808 |
| 216 | Ga0207668_11049715 | 3300025972 | Bacteria | 729 |
| 217 | Ga0207640_10160570 | 3300025981 | Bacteria | 1662 |
| 218 | Ga0207677_10253750 | 3300026023 | Bacteria | 1430 |
| 219 | Ga0207703_10011909 | 3300026035 | Bacteria | 6773 |
| 220 | Ga0207639_10083339 | 3300026041 | Bacteria | 2538 |
| 221 | Ga0207639_10124972 | 3300026041 | Bacteria | 2120 |
| 222 | Ga0207678_10006251 | 3300026067 | Bacteria | 10579 |
| 223 | Ga0207678_10029201 | 3300026067 | Bacteria | 4812 |
| 224 | Ga0207678_10417167 | 3300026067 | Bacteria | 1164 |
| 225 | Ga0207708_10002115 | 3300026075 | Bacteria | 14642 |
| 226 | Ga0207641_10382878 | 3300026088 | Bacteria | 1347 |
| 227 | Ga0207641_11204415 | 3300026088 | Bacteria | 757 |
| 228 | Ga0207648_10075832 | 3300026089 | Bacteria | 2931 |
| 229 | Ga0207676_10360274 | 3300026095 | Bacteria | 1347 |
| 230 | Ga0207676_11281127 | 3300026095 | Bacteria | 727 |
| 231 | Ga0207674_10417677 | 3300026116 | Bacteria | 1296 |
| 232 | Ga0207675_101183149 | 3300026118 | Bacteria | 785 |
| 233 | Ga0207683_11159932 | 3300026121 | Bacteria | 716 |
| 234 | Ga0268266_10032883 | 3300028379 | Bacteria | 4408 |
| 235 | Ga0268266_10299868 | 3300028379 | Bacteria | 1499 |
| 236 | Ga0268266_10521859 | 3300028379 | Bacteria | 1136 |
| 237 | Ga0268265_10316322 | 3300028380 | Bacteria | 1412 |
| 238 | Ga0268264_10087425 | 3300028381 | Bacteria | 2680 |
| 239 | Ga0307511_10000810 | 3300030521 | Bacteria | 33393 |
| 240 | Ga0307512_10026066 | 3300030522 | Bacteria | 5165 |
| 241 | Ga0265327_10000964 | 3300031251 | Bacteria | 41214 |
| 242 | Ga0265327_10012527 | 3300031251 | Bacteria | 5712 |
| 243 | Ga0307513_10030199 | 3300031456 | Bacteria | 6159 |
| 244 | Ga0307408_101291888 | 3300031548 | Bacteria | 684 |
| 245 | Ga0316578_10185364 | 3300031728 | Bacteria | 1254 |
| 246 | Ga0307405_10043096 | 3300031731 | Bacteria | 2751 |
| 247 | Ga0307413_10198306 | 3300031824 | Bacteria | 1447 |
| 248 | Ga0307413_10637125 | 3300031824 | Bacteria | 877 |
| 249 | Ga0307410_10041488 | 3300031852 | Bacteria | 3036 |
| 250 | Ga0307410_10674316 | 3300031852 | Bacteria | 869 |
| 251 | Ga0307406_10012099 | 3300031901 | Bacteria | 4911 |
| 252 | Ga0307407_10184435 | 3300031903 | Bacteria | 1385 |
| 253 | Ga0307409_100361760 | 3300031995 | Bacteria | 1373 |
| 254 | Ga0307409_100440220 | 3300031995 | Bacteria | 1255 |
| 255 | Ga0307416_100807723 | 3300032002 | Bacteria | 1034 |
| 256 | Ga0307416_101119410 | 3300032002 | Bacteria | 892 |
| 257 | Ga0307416_101424105 | 3300032002 | Bacteria | 799 |
| 258 | Ga0307414_10651921 | 3300032004 | Bacteria | 949 |
| 259 | Ga0307411_10503728 | 3300032005 | Bacteria | 1024 |
| 260 | Ga0307415_100542612 | 3300032126 | Bacteria | 1025 |
| 261 | Ga0307507_10089098 | 3300033179 | Bacteria | 2657 |
| 262 | Ga0307507_10181533 | 3300033179 | Bacteria | 1503 |
| 263 | Ga0373928_0044688 | 3300035084 | Bacteria | 1029 |
| 264 | Ga0373952_0028170 | 3300035092 | Bacteria | 1231 |
| 265 | Ga0373939_0060300 | 3300035114 | Bacteria | 1206 |
| 266 | Ga0373941_0071765 | 3300035115 | Bacteria | 1151 |
| 267 | Ga0373946_0314789 | 3300035171 | Bacteria | 776 |
| 268 | Ga0373947_0223391 | 3300035725 | Bacteria | 1239 |
| 269 | Ga0373947_0718970 | 3300035725 | Bacteria | 681 |
| 270 | Ga0316582_0331809 | 3300036647 | Bacteria | 1046 |
| 271 | Ga0316584_0093491 | 3300036712 | Bacteria | 2251 |
| 272 | Ga0395900_0361519 | 3300037418 | Bacteria | 1423 |
| 273 | Ga0436365_0437998 | 3300039437 | Bacteria | 29340 |
| 274 | Ga0436365_0748242 | 3300039437 | Bacteria | 9474 |
| 275 | Ga0436363_1657922 | 3300039450 | Bacteria | 915 |
| 276 | Ga0436362_1246353 | 3300039453 | Bacteria | 2063 |
| 277 | Ga0439461_0002430 | 3300041410 | Bacteria | 2971 |
| 278 | Ga0439466_0006035 | 3300041411 | Bacteria | 4613 |
| 279 | Ga0439465_0015539 | 3300041413 | Bacteria | 2375 |
| 280 | Ga0451793_0774705 | 3300041452 | Bacteria | 700 |
| 281 | Ga0451793_1816863 | 3300041452 | Bacteria | 1641 |
| 282 | Ga0451807_2247844 | 3300041486 | Bacteria | 1084 |
| 283 | Ga0451841_0264764 | 3300041498 | Bacteria | 887 |
| 284 | Ga0451853_3717851 | 3300041512 | Bacteria | 1366 |
| 285 | Ga0439431_0006068 | 3300041997 | Bacteria | 2668 |
| 286 | Ga0439445_0038935 | 3300042004 | Bacteria | 1258 |
| 287 | Ga0439450_021487 | 3300042008 | Bacteria | 1386 |
| 288 | Ga0439463_140840 | 3300042016 | Bacteria | 625 |
| 289 | Ga0439434_0017212 | 3300042435 | Bacteria | 2162 |
| 290 | Ga0451577_0378516 | 3300042876 | Bacteria | 1284 |
| 291 | Ga0466969_0024794 | 3300044656 | Bacteria | 3085 |
| 292 | Ga0466972_0089901 | 3300044658 | Bacteria | 1456 |
| 293 | Ga0466972_0371458 | 3300044658 | Bacteria | 669 |
| 294 | Ga0466965_0012386 | 3300044683 | Bacteria | 4010 |
| 295 | Ga0466965_0023212 | 3300044683 | Bacteria | 2995 |
| 296 | Ga0466965_0087245 | 3300044683 | Bacteria | 1583 |
| 297 | Ga0466966_0037242 | 3300044684 | Bacteria | 3138 |
| 298 | Ga0466961_0004274 | 3300044693 | Bacteria | 8941 |
| 299 | Ga0466961_0017823 | 3300044693 | Bacteria | 4563 |
| 300 | Ga0466963_0013708 | 3300044694 | Bacteria | 4985 |
| 301 | Ga0466971_0013740 | 3300044719 | Bacteria | 3560 |
| 302 | Ga0466971_0019254 | 3300044719 | Bacteria | 3030 |
| 303 | Ga0466968_0045984 | 3300044735 | Bacteria | 1854 |
| 304 | Ga0466968_0202500 | 3300044735 | Bacteria | 930 |
| 305 | Ga0466970_0025539 | 3300044765 | Bacteria | 3093 |
| 306 | Ga0466957_0028635 | 3300044842 | Bacteria | 3317 |
| 307 | Ga0466960_0000524 | 3300044901 | Bacteria | 13143 |
| 308 | Ga0466960_0006720 | 3300044901 | Bacteria | 4628 |
| 309 | Ga0466959_0002390 | 3300045049 | Bacteria | 11968 |
| 310 | Ga0466959_0088114 | 3300045049 | Bacteria | 2231 |
| 311 | Ga0466959_0366625 | 3300045049 | Bacteria | 981 |
| 312 | Ga0466958_0044166 | 3300045836 | Bacteria | 2685 |
| 313 | Ga0466967_0038042 | 3300045976 | Bacteria | 4123 |
| 314 | Ga0466967_0218207 | 3300045976 | Bacteria | 1811 |
| 315 | Ga0466967_0466830 | 3300045976 | Bacteria | 1235 |
| 316 | Ga0495603_0015496 | 3300046455 | Bacteria | 4614 |
| 317 | Ga0495629_0029521 | 3300046459 | Bacteria | 3887 |
| 318 | Ga0495638_0000745 | 3300046460 | Bacteria | 34919 |
| 319 | Ga0495638_0030524 | 3300046460 | Bacteria | 3468 |
| 320 | Ga0495650_0062714 | 3300046471 | Bacteria | 1484 |
| 321 | Ga0495582_0128578 | 3300046473 | Bacteria | 1430 |
| 322 | Ga0495607_0094009 | 3300046501 | Bacteria | 1618 |
| 323 | Ga0495608_0225298 | 3300046511 | Bacteria | 1175 |
| 324 | Ga0495644_0248958 | 3300046523 | Bacteria | 690 |
| 325 | Ga0495648_0068853 | 3300046524 | Bacteria | 2062 |
| 326 | Ga0495652_0184503 | 3300046529 | Bacteria | 1598 |
| 327 | Ga0495665_0022481 | 3300046531 | Bacteria | 3390 |
| 328 | Ga0495640_0075567 | 3300046533 | Bacteria | 2250 |
| 329 | Ga0495640_0137063 | 3300046533 | Bacteria | 1580 |
| 330 | Ga0495640_0465630 | 3300046533 | Bacteria | 771 |
| 331 | Ga0495668_0324202 | 3300046616 | Bacteria | 845 |
| 332 | Ga0495635_0241139 | 3300046663 | Bacteria | 1220 |
| 333 | Ga0495646_0340484 | 3300046680 | Bacteria | 787 |
| 334 | Ga0495649_0429552 | 3300046694 | Bacteria | 661 |
| 335 | Ga0495581_0039652 | 3300047315 | Bacteria | 2727 |
| 336 | Ga0495674_0091311 | 3300047319 | Bacteria | 2601 |
| 337 | Ga0495672_0059830 | 3300047320 | Bacteria | 2202 |
| 338 | Ga0495672_0104402 | 3300047320 | Bacteria | 1531 |
| 339 | Ga0495683_0000314 | 3300047323 | Bacteria | 40788 |
| 340 | Ga0495673_0006586 | 3300047469 | Bacteria | 6812 |
| 341 | Ga0495686_0018348 | 3300047472 | Bacteria | 4697 |
| 342 | Ga0495593_0017479 | 3300047673 | Bacteria | 4037 |
| 343 | Ga0496100_0001051 | 3300048903 | Bacteria | 13348 |
| 344 | Ga0496100_0002523 | 3300048903 | Bacteria | 9326 |
| 345 | Ga0496100_0170427 | 3300048903 | Bacteria | 1567 |
| 346 | Ga0496100_0234022 | 3300048903 | Bacteria | 1353 |
| 347 | Ga0496101_0000172 | 3300048904 | Bacteria | 53462 |
| 348 | Ga0496101_0001677 | 3300048904 | Bacteria | 13268 |
| 349 | Ga0496101_0010626 | 3300048904 | Bacteria | 6082 |
| 350 | Ga0496101_0083697 | 3300048904 | Bacteria | 2362 |
| 351 | Ga0496102_0000003 | 3300048905 | Bacteria | 592263 |
| 352 | Ga0496102_0000050 | 3300048905 | Bacteria | 179469 |
| 353 | Ga0496102_0254211 | 3300048905 | Bacteria | 1657 |
| 354 | Ga0496102_0485862 | 3300048905 | Bacteria | 1156 |
| 355 | Ga0496103_0001528 | 3300048906 | Bacteria | 15464 |
| 356 | Ga0496103_0057233 | 3300048906 | Bacteria | 2420 |
| 357 | Ga0496104_0174677 | 3300048907 | Bacteria | 2059 |
| 358 | Ga0496104_0264775 | 3300048907 | Bacteria | 1631 |
| 359 | Ga0496105_0038562 | 3300048908 | Bacteria | 3936 |
| 360 | Ga0496105_0341098 | 3300048908 | Bacteria | 1198 |
| 361 | Ga0496106_0000805 | 3300048909 | Bacteria | 22727 |
| 362 | Ga0496106_0006034 | 3300048909 | Bacteria | 8967 |
| 363 | Ga0496106_0131095 | 3300048909 | Bacteria | 1966 |
| 364 | Ga0496107_0001147 | 3300048910 | Bacteria | 16029 |
| 365 | Ga0496107_0040877 | 3300048910 | Bacteria | 3329 |
| 366 | Ga0496107_0045169 | 3300048910 | Bacteria | 3168 |
| 367 | Ga0496108_0000687 | 3300048911 | Bacteria | 26194 |
| 368 | Ga0496108_0180772 | 3300048911 | Bacteria | 1826 |
| 369 | Ga0496108_0582313 | 3300048911 | Bacteria | 975 |
| 370 | Ga0496109_0005077 | 3300048912 | Bacteria | 10996 |
| 371 | Ga0496109_0005459 | 3300048912 | Bacteria | 10634 |
| 372 | Ga0496109_0387643 | 3300048912 | Bacteria | 1320 |
| 373 | Ga0496110_0034028 | 3300048913 | Bacteria | 4411 |
| 374 | Ga0496112_0003894 | 3300048915 | Bacteria | 12488 |
| 375 | Ga0496112_0007121 | 3300048915 | Bacteria | 9894 |
| 376 | Ga0496112_0044339 | 3300048915 | Bacteria | 4357 |
| 377 | Ga0496112_0103566 | 3300048915 | Bacteria | 2816 |
| 378 | Ga0496113_0012113 | 3300048916 | Bacteria | 5785 |
| 379 | Ga0496113_0046574 | 3300048916 | Bacteria | 3219 |
| 380 | Ga0496113_0321651 | 3300048916 | Bacteria | 1240 |
| 381 | Ga0496113_0709417 | 3300048916 | Bacteria | 802 |
| 382 | Ga0496114_0002245 | 3300048917 | Bacteria | 14723 |
| 383 | Ga0496114_0172366 | 3300048917 | Bacteria | 1886 |
| 384 | Ga0496115_0048577 | 3300048918 | Bacteria | 3394 |
| 385 | Ga0496115_0694993 | 3300048918 | Bacteria | 800 |
| 386 | Ga0496116_0000040 | 3300048919 | Bacteria | 346900 |
| 387 | Ga0496116_0023625 | 3300048919 | Bacteria | 4573 |
| 388 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 389 | Ga0496117_0000459 | 3300048920 | Bacteria | 68055 |
| 390 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 391 | Ga0496118_0000452 | 3300048921 | Bacteria | 67982 |
| 392 | Ga0496118_0001853 | 3300048921 | Bacteria | 30292 |
| 393 | Ga0496119_0000591 | 3300048922 | Bacteria | 49100 |
| 394 | Ga0496119_0092022 | 3300048922 | Bacteria | 1721 |
| 395 | Ga0496120_0000293 | 3300048923 | Bacteria | 83834 |
| 396 | Ga0496120_0040497 | 3300048923 | Bacteria | 2737 |
| 397 | Ga0496121_0000019 | 3300048924 | Bacteria | 499976 |
| 398 | Ga0496121_0003539 | 3300048924 | Bacteria | 22126 |
| 399 | Ga0496121_0345900 | 3300048924 | Bacteria | 992 |
| 400 | Ga0496122_0026427 | 3300048925 | Bacteria | 5004 |
| 401 | Ga0496122_0186060 | 3300048925 | Bacteria | 1232 |
| 402 | Ga0496123_0072153 | 3300048926 | Bacteria | 2149 |
| 403 | Ga0496123_0306947 | 3300048926 | Bacteria | 755 |
| 404 | Ga0496124_0062969 | 3300048927 | Bacteria | 3101 |
| 405 | Ga0496125_0205063 | 3300048928 | Bacteria | 1286 |
| 406 | Ga0496126_0001018 | 3300048929 | Bacteria | 47580 |
| 407 | Ga0496126_0008738 | 3300048929 | Bacteria | 10876 |
| 408 | Ga0496126_0011701 | 3300048929 | Bacteria | 9046 |
| 409 | Ga0496126_0020413 | 3300048929 | Bacteria | 6495 |
| 410 | Ga0496126_0243723 | 3300048929 | Bacteria | 1500 |
| 411 | Ga0501306_018386 | 3300049127 | Bacteria | 955 |
| 412 | Ga0501310_010500 | 3300049130 | Bacteria | 1034 |
| 413 | Ga0501307_001203 | 3300049162 | Bacteria | 2113 |
| 414 | Ga0501307_006906 | 3300049162 | Bacteria | 1239 |
| 415 | Ga0501311_019014 | 3300049527 | Bacteria | 918 |
| 416 | Ga0501311_024877 | 3300049527 | Bacteria | 836 |
| 417 | Ga0501312_056150 | 3300049528 | Bacteria | 674 |
| 418 | Ga0501312_070820 | 3300049528 | Bacteria | 618 |
| 419 | Ga0501315_025361 | 3300049531 | Bacteria | 825 |
| 420 | Ga0501318_010361 | 3300049534 | Bacteria | 1033 |
| 421 | Ga0501321_006192 | 3300049537 | Bacteria | 1209 |
| 422 | Ga0501033_0026093 | 3300049570 | Bacteria | 4398 |
| 423 | Ga0501036_0170081 | 3300049572 | Bacteria | 1836 |
| 424 | Ga0501068_0518347 | 3300049584 | Bacteria | 774 |
| 425 | Ga0501072_0350031 | 3300049588 | Bacteria | 1173 |
| 426 | Ga0501076_0434421 | 3300049592 | Bacteria | 1081 |
| 427 | Ga0501035_0000662 | 3300049822 | Bacteria | 37968 |
| 428 | Ga0501044_0002840 | 3300049823 | Bacteria | 19713 |
| 429 | Ga0501044_0027749 | 3300049823 | Bacteria | 5977 |
| 430 | nmdc:mga03n38_217904_c1 | 3300050490 | Bacteria | 995 |
| 431 | nmdc:mga03n38_24391_c1 | 3300050490 | Bacteria | 2473 |
| 432 | nmdc:mga03n38_30894_c1 | 3300050490 | Bacteria | 2256 |
| 433 | nmdc:mga00v17_1162_c1 | 3300050491 | Bacteria | 13828 |
| 434 | nmdc:mga00v17_298030_c1 | 3300050491 | Bacteria | 1047 |
| 435 | nmdc:mga00v17_562240_c1 | 3300050491 | Bacteria | 737 |
| 436 | nmdc:mga0yw44_629925_c1 | 3300050492 | Bacteria | 729 |
| 437 | nmdc:mga0yw44_69923_c1 | 3300050492 | Bacteria | 2175 |
| 438 | nmdc:mga0yw44_854453_c1 | 3300050492 | Bacteria | 618 |
| 439 | nmdc:mga0yw44_86229_c1 | 3300050492 | Bacteria | 1977 |
| 440 | nmdc:mga07m45_129984_c1 | 3300050496 | Bacteria | 1457 |
| 441 | nmdc:mga07m45_55438_c1 | 3300050496 | Bacteria | 2241 |
| 442 | nmdc:mga07m45_69589_c1 | 3300050496 | Bacteria | 2001 |
| 443 | nmdc:mga05p37_5582_c1 | 3300050507 | Bacteria | 14790 |
| 444 | nmdc:mga0qj67_434633_c1 | 3300050509 | Bacteria | 1058 |
| 445 | nmdc:mga0sz30_2111_c1 | 3300050516 | Bacteria | 7104 |
| 446 | nmdc:mga0sz30_47785_c1 | 3300050516 | Bacteria | 1809 |
| 447 | nmdc:mga0sz30_84938_c1 | 3300050516 | Bacteria | 1373 |
| 448 | Ga0500610_0011879 | 3300053079 | Bacteria | 3988 |
| 449 | Ga0500635_0097567 | 3300053080 | Bacteria | 1077 |
| 450 | Ga0495655_0004921 | 3300053083 | Bacteria | 2324 |
| 451 | Ga0495619_0312034 | 3300053085 | Bacteria | 1089 |
| 452 | Ga0500643_019899 | 3300053087 | Bacteria | 2204 |
| 453 | Ga0500643_051311 | 3300053087 | Bacteria | 1178 |
| 454 | Ga0500644_0032695 | 3300053088 | Bacteria | 1664 |
| 455 | Ga0500651_0586367 | 3300053093 | Bacteria | 606 |
| 456 | Ga0500641_0029538 | 3300053096 | Bacteria | 2149 |
| 457 | Ga0500650_0106110 | 3300053098 | Bacteria | 1313 |
| 458 | Ga0500556_0002609 | 3300053104 | Bacteria | 5666 |
| 459 | Ga0500556_0164238 | 3300053104 | Bacteria | 876 |
| 460 | Ga0500642_0203934 | 3300053130 | Bacteria | 920 |
| 461 | Ga0500658_0093853 | 3300053134 | Bacteria | 1301 |
| 462 | Ga0500559_0066633 | 3300053136 | Bacteria | 1615 |
| 463 | Ga0500559_0079212 | 3300053136 | Bacteria | 1491 |
| 464 | Ga0500577_0116959 | 3300053142 | Bacteria | 1106 |
| 465 | Ga0500588_0068949 | 3300053146 | Bacteria | 1154 |
| 466 | Ga0500604_0105289 | 3300053151 | Bacteria | 933 |
| 467 | Ga0500616_0010594 | 3300053153 | Bacteria | 5507 |
| 468 | Ga0500616_0086634 | 3300053153 | Bacteria | 1561 |
| 469 | Ga0500645_000070 | 3300053730 | Bacteria | 79917 |
| 470 | Ga0587107_042223 | 3300059652 | Bacteria | 742 |
| 471 | Ga0466962_0003600 | 3300061719 | Bacteria | 7381 |
| 472 | Ga0466962_0396766 | 3300061719 | Bacteria | 690 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046471 | Ga0495650_0062714 | Ga0495650_0062714_472_1053 | 156 |
| 2 | 3300050496 | nmdc:mga07m45_69589_c1 | nmdc:mga07m45_69589_c1_210_965 | 156 |
| 3 | 3300005437 | Ga0070710_10000440 | Ga0070710_1000044015 | 163 |
| 4 | 3300025898 | Ga0207692_10079631 | Ga0207692_100796313 | 167 |
| 5 | iso_pu_bacteria | 2795385472 | 2795793287 | 168 |
| 6 | iso_pu_bacteria | 2891326441 | 2891331546 | 168 |
| 7 | 3300044683 | Ga0466965_0087245 | Ga0466965_0087245_375_944 | 169 |
| 8 | 3300048921 | Ga0496118_0000452 | Ga0496118_0000452_26039_26647 | 169 |
| 9 | iso_pu_bacteria | 2751185792 | 2753326112 | 169 |
| 10 | iso_pu_bacteria | 2795385470 | 2795781401 | 169 |
| 11 | 3300005353 | Ga0070669_100008483 | Ga0070669_1000084835 | 170 |
| 12 | 3300005367 | Ga0070667_100000182 | Ga0070667_10000018259 | 170 |
| 13 | 3300005548 | Ga0070665_100020670 | Ga0070665_1000206705 | 170 |
| 14 | 3300005617 | Ga0068859_100003253 | Ga0068859_1000032535 | 170 |
| 15 | 3300005841 | Ga0068863_100005851 | Ga0068863_1000058514 | 170 |
| 16 | 3300005843 | Ga0068860_100000048 | Ga0068860_100000048204 | 170 |
| 17 | 3300005844 | Ga0068862_100000053 | Ga0068862_100000053142 | 170 |
| 18 | 3300006931 | Ga0097620_100003253 | Ga0097620_1000032535 | 170 |
| 19 | 3300009101 | Ga0105247_10000195 | Ga0105247_100001957 | 170 |
| 20 | 3300009177 | Ga0105248_10005324 | Ga0105248_100053245 | 170 |
| 21 | 3300009553 | Ga0105249_10000022 | Ga0105249_10000022195 | 170 |
| 22 | 3300014325 | Ga0163163_10031308 | Ga0163163_100313084 | 170 |
| 23 | 3300014968 | Ga0157379_10121187 | Ga0157379_101211872 | 170 |
| 24 | 3300048904 | Ga0496101_0010626 | Ga0496101_0010626_3111_3776 | 170 |
| 25 | 3300048905 | Ga0496102_0000050 | Ga0496102_0000050_67437_68084 | 170 |
| 26 | 3300048906 | Ga0496103_0001528 | Ga0496103_0001528_4778_5425 | 170 |
| 27 | 3300048909 | Ga0496106_0131095 | Ga0496106_0131095_1041_1706 | 170 |
| 28 | 3300048910 | Ga0496107_0045169 | Ga0496107_0045169_256_903 | 170 |
| 29 | 3300048915 | Ga0496112_0103566 | Ga0496112_0103566_1776_2291 | 170 |
| 30 | 3300048919 | Ga0496116_0023625 | Ga0496116_0023625_1220_1867 | 170 |
| 31 | 3300048920 | Ga0496117_0000459 | Ga0496117_0000459_31323_31970 | 170 |
| 32 | 3300048921 | Ga0496118_0001853 | Ga0496118_0001853_7791_8438 | 170 |
| 33 | 3300048922 | Ga0496119_0092022 | Ga0496119_0092022_541_1188 | 170 |
| 34 | 3300048923 | Ga0496120_0040497 | Ga0496120_0040497_1787_2434 | 170 |
| 35 | 3300048924 | Ga0496121_0003539 | Ga0496121_0003539_18418_19083 | 170 |
| 36 | 3300048927 | Ga0496124_0062969 | Ga0496124_0062969_1121_1768 | 170 |
| 37 | 3300048929 | Ga0496126_0008738 | Ga0496126_0008738_396_1061 | 170 |
| 38 | iso_pu_bacteria | 2565956761 | 2566992592 | 170 |
| 39 | iso_pu_bacteria | 2582580736 | 2583148974 | 170 |
| 40 | iso_pu_bacteria | 2738543034 | 2739366610 | 170 |
| 41 | iso_pu_bacteria | 2751185734 | 2753069896 | 170 |
| 42 | iso_pu_bacteria | 2808606522 | 2809586190 | 170 |
| 43 | iso_pu_bacteria | 2866612099 | 2866617139 | 170 |
| 44 | iso_pu_bacteria | 2891968417 | 2891973202 | 170 |
| 45 | iso_pu_bacteria | 2899359706 | 2899364675 | 170 |
| 46 | iso_pu_bacteria | 2899370129 | 2899373857 | 170 |
| 47 | iso_pu_bacteria | 2904535858 | 2904541546 | 170 |
| 48 | iso_pu_bacteria | 2904765812 | 2904767499 | 170 |
| 49 | iso_pu_bacteria | 2904770941 | 2904774844 | 170 |
| 50 | iso_pu_bacteria | 2908811453 | 2908813146 | 170 |
| 51 | iso_pu_bacteria | 2915768154 | 2915768429 | 170 |
| 52 | iso_pu_bacteria | 2919420072 | 2919423881 | 170 |
| 53 | iso_pu_bacteria | 2919432681 | 2919436667 | 170 |
| 54 | iso_pu_bacteria | 2922554459 | 2922560078 | 170 |
| 55 | iso_pu_bacteria | 8047710418 | 8047717810 | 170 |
| 56 | iso_pu_bacteria | 8054472261 | 8054479138 | 170 |
| 57 | 3300005347 | Ga0070668_100005182 | Ga0070668_1000051827 | 171 |
| 58 | 3300025972 | Ga0207668_10005451 | Ga0207668_100054514 | 171 |
| 59 | 3300059652 | Ga0587107_042223 | Ga0587107_042223_186_716 | 171 |
| 60 | iso_pu_bacteria | 2643221692 | 2644514091 | 171 |
| 61 | iso_pu_bacteria | 2643221715 | 2644635594 | 171 |
| 62 | iso_pu_bacteria | 2738541274 | 2738704715 | 171 |
| 63 | iso_pu_bacteria | 2738543028 | 2739329884 | 171 |
| 64 | iso_pu_bacteria | 2808606439 | 2809194291 | 171 |
| 65 | iso_pu_bacteria | 2842134933 | 2842136715 | 171 |
| 66 | iso_pu_bacteria | 2902799365 | 2902803573 | 171 |
| 67 | iso_pu_bacteria | 2902810491 | 2902813787 | 171 |
| 68 | iso_pu_bacteria | 2902837492 | 2902841784 | 171 |
| 69 | iso_pu_bacteria | 2929212328 | 2929213700 | 171 |
| 70 | iso_pu_bacteria | 2939582691 | 2939586711 | 171 |
| 71 | 3300003203 | JGI25406J46586_10000352 | JGI25406J46586_1000035212 | 172 |
| 72 | 3300005347 | Ga0070668_100456196 | Ga0070668_1004561962 | 172 |
| 73 | 3300005434 | Ga0070709_10137734 | Ga0070709_101377342 | 172 |
| 74 | 3300005435 | Ga0070714_100061871 | Ga0070714_1000618714 | 172 |
| 75 | 3300005436 | Ga0070713_100183300 | Ga0070713_1001833003 | 172 |
| 76 | 3300005458 | Ga0070681_10051164 | Ga0070681_100511644 | 172 |
| 77 | 3300005468 | Ga0070707_100385254 | Ga0070707_1003852543 | 172 |
| 78 | 3300005535 | Ga0070684_100140483 | Ga0070684_1001404833 | 172 |
| 79 | 3300005564 | Ga0070664_100211857 | Ga0070664_1002118571 | 172 |
| 80 | 3300005577 | Ga0068857_100133976 | Ga0068857_1001339761 | 172 |
| 81 | 3300005614 | Ga0068856_100506993 | Ga0068856_1005069933 | 172 |
| 82 | 3300005618 | Ga0068864_100062360 | Ga0068864_1000623603 | 172 |
| 83 | 3300005841 | Ga0068863_100054502 | Ga0068863_1000545025 | 172 |
| 84 | 3300005843 | Ga0068860_100419919 | Ga0068860_1004199191 | 172 |
| 85 | 3300005985 | Ga0081539_10000132 | Ga0081539_10000132162 | 172 |
| 86 | 3300006173 | Ga0070716_100293994 | Ga0070716_1002939942 | 172 |
| 87 | 3300006175 | Ga0070712_100254562 | Ga0070712_1002545623 | 172 |
| 88 | 3300006871 | Ga0075434_100721830 | Ga0075434_1007218302 | 172 |
| 89 | 3300009092 | Ga0105250_10081616 | Ga0105250_100816162 | 172 |
| 90 | 3300009545 | Ga0105237_10267488 | Ga0105237_102674883 | 172 |
| 91 | 3300013306 | Ga0163162_10434238 | Ga0163162_104342381 | 172 |
| 92 | 3300014325 | Ga0163163_10049333 | Ga0163163_100493336 | 172 |
| 93 | 3300014968 | Ga0157379_10230117 | Ga0157379_102301172 | 172 |
| 94 | 3300014969 | Ga0157376_10429564 | Ga0157376_104295642 | 172 |
| 95 | 3300020082 | Ga0206353_11819126 | Ga0206353_118191262 | 172 |
| 96 | 3300025906 | Ga0207699_10263218 | Ga0207699_102632182 | 172 |
| 97 | 3300025912 | Ga0207707_10271353 | Ga0207707_102713532 | 172 |
| 98 | 3300025914 | Ga0207671_10206930 | Ga0207671_102069303 | 172 |
| 99 | 3300025915 | Ga0207693_10038303 | Ga0207693_100383034 | 172 |
| 100 | 3300025920 | Ga0207649_11184615 | Ga0207649_111846151 | 172 |
| 101 | 3300025922 | Ga0207646_10642958 | Ga0207646_106429581 | 172 |
| 102 | 3300025939 | Ga0207665_10184822 | Ga0207665_101848222 | 172 |
| 103 | 3300025941 | Ga0207711_10069827 | Ga0207711_100698273 | 172 |
| 104 | 3300025972 | Ga0207668_10716799 | Ga0207668_107167992 | 172 |
| 105 | 3300026088 | Ga0207641_10382878 | Ga0207641_103828782 | 172 |
| 106 | 3300026095 | Ga0207676_10360274 | Ga0207676_103602741 | 172 |
| 107 | 3300026116 | Ga0207674_10417677 | Ga0207674_104176772 | 172 |
| 108 | 3300028379 | Ga0268266_10299868 | Ga0268266_102998682 | 172 |
| 109 | 3300030522 | Ga0307512_10026066 | Ga0307512_100260664 | 172 |
| 110 | 3300031456 | Ga0307513_10030199 | Ga0307513_100301993 | 172 |
| 111 | 3300031824 | Ga0307413_10198306 | Ga0307413_101983062 | 172 |
| 112 | 3300032126 | Ga0307415_100542612 | Ga0307415_1005426121 | 172 |
| 113 | 3300033179 | Ga0307507_10181533 | Ga0307507_101815332 | 172 |
| 114 | 3300035171 | Ga0373946_0314789 | Ga0373946_0314789_125_673 | 172 |
| 115 | 3300035725 | Ga0373947_0718970 | Ga0373947_0718970_81_629 | 172 |
| 116 | 3300039437 | Ga0436365_0748242 | Ga0436365_0748242_3374_4012 | 172 |
| 117 | 3300041452 | Ga0451793_0774705 | Ga0451793_0774705_58_579 | 172 |
| 118 | 3300041498 | Ga0451841_0264764 | Ga0451841_0264764_323_850 | 172 |
| 119 | 3300044694 | Ga0466963_0013708 | Ga0466963_0013708_3346_3966 | 172 |
| 120 | 3300044901 | Ga0466960_0000524 | Ga0466960_0000524_10883_11503 | 172 |
| 121 | 3300045976 | Ga0466967_0038042 | Ga0466967_0038042_3047_3565 | 172 |
| 122 | 3300045976 | Ga0466967_0218207 | Ga0466967_0218207_1175_1795 | 172 |
| 123 | 3300046460 | Ga0495638_0000745 | Ga0495638_0000745_27335_27967 | 172 |
| 124 | 3300046524 | Ga0495648_0068853 | Ga0495648_0068853_785_1417 | 172 |
| 125 | 3300046533 | Ga0495640_0465630 | Ga0495640_0465630_146_694 | 172 |
| 126 | 3300046616 | Ga0495668_0324202 | Ga0495668_0324202_138_770 | 172 |
| 127 | 3300047320 | Ga0495672_0059830 | Ga0495672_0059830_1141_1773 | 172 |
| 128 | 3300047469 | Ga0495673_0006586 | Ga0495673_0006586_4430_5062 | 172 |
| 129 | 3300047472 | Ga0495686_0018348 | Ga0495686_0018348_2702_3307 | 172 |
| 130 | 3300048903 | Ga0496100_0002523 | Ga0496100_0002523_3333_3956 | 172 |
| 131 | 3300048903 | Ga0496100_0234022 | Ga0496100_0234022_776_1324 | 172 |
| 132 | 3300048904 | Ga0496101_0000172 | Ga0496101_0000172_6630_7253 | 172 |
| 133 | 3300048905 | Ga0496102_0000003 | Ga0496102_0000003_290338_290961 | 172 |
| 134 | 3300048907 | Ga0496104_0264775 | Ga0496104_0264775_620_1168 | 172 |
| 135 | 3300048908 | Ga0496105_0038562 | Ga0496105_0038562_689_1237 | 172 |
| 136 | 3300048909 | Ga0496106_0006034 | Ga0496106_0006034_7529_8152 | 172 |
| 137 | 3300048910 | Ga0496107_0040877 | Ga0496107_0040877_2562_3185 | 172 |
| 138 | 3300048911 | Ga0496108_0180772 | Ga0496108_0180772_719_1267 | 172 |
| 139 | 3300048912 | Ga0496109_0005077 | Ga0496109_0005077_481_1029 | 172 |
| 140 | 3300048913 | Ga0496110_0034028 | Ga0496110_0034028_3376_3924 | 172 |
| 141 | 3300048915 | Ga0496112_0007121 | Ga0496112_0007121_3711_4259 | 172 |
| 142 | 3300048916 | Ga0496113_0012113 | Ga0496113_0012113_495_1043 | 172 |
| 143 | 3300048918 | Ga0496115_0694993 | Ga0496115_0694993_32_580 | 172 |
| 144 | 3300048919 | Ga0496116_0000040 | Ga0496116_0000040_44978_45601 | 172 |
| 145 | 3300048920 | Ga0496117_0000003 | Ga0496117_0000003_301303_301926 | 172 |
| 146 | 3300048921 | Ga0496118_0000001 | Ga0496118_0000001_301306_301929 | 172 |
| 147 | 3300048922 | Ga0496119_0000591 | Ga0496119_0000591_27770_28393 | 172 |
| 148 | 3300048923 | Ga0496120_0000293 | Ga0496120_0000293_38221_38844 | 172 |
| 149 | 3300048924 | Ga0496121_0000019 | Ga0496121_0000019_299757_300380 | 172 |
| 150 | 3300048929 | Ga0496126_0001018 | Ga0496126_0001018_44992_45615 | 172 |
| 151 | 3300048929 | Ga0496126_0011701 | Ga0496126_0011701_7716_8336 | 172 |
| 152 | 3300050516 | nmdc:mga0sz30_47785_c1 | nmdc:mga0sz30_47785_c1_335_1003 | 172 |
| 153 | 3300053079 | Ga0500610_0011879 | Ga0500610_0011879_3057_3683 | 172 |
| 154 | 3300053087 | Ga0500643_051311 | Ga0500643_051311_285_917 | 172 |
| 155 | 3300053088 | Ga0500644_0032695 | Ga0500644_0032695_228_770 | 172 |
| 156 | 3300053098 | Ga0500650_0106110 | Ga0500650_0106110_633_1265 | 172 |
| 157 | 3300053104 | Ga0500556_0002609 | Ga0500556_0002609_3720_4352 | 172 |
| 158 | 3300053104 | Ga0500556_0164238 | Ga0500556_0164238_170_820 | 172 |
| 159 | 3300053130 | Ga0500642_0203934 | Ga0500642_0203934_144_776 | 172 |
| 160 | 3300053142 | Ga0500577_0116959 | Ga0500577_0116959_299_931 | 172 |
| 161 | 3300053146 | Ga0500588_0068949 | Ga0500588_0068949_204_836 | 172 |
| 162 | 3300053151 | Ga0500604_0105289 | Ga0500604_0105289_14_646 | 172 |
| 163 | 3300053153 | Ga0500616_0010594 | Ga0500616_0010594_2124_2750 | 172 |
| 164 | 3300053153 | Ga0500616_0086634 | Ga0500616_0086634_147_773 | 172 |
| 165 | iso_pu_bacteria | 8057568493 | 8057570151 | 172 |
| 166 | 3300006038 | Ga0075365_10100820 | Ga0075365_101008203 | 173 |
| 167 | 3300006048 | Ga0075363_100016960 | Ga0075363_1000169603 | 173 |
| 168 | 3300006051 | Ga0075364_10029284 | Ga0075364_100292842 | 173 |
| 169 | 3300006051 | Ga0075364_10089313 | Ga0075364_100893133 | 173 |
| 170 | 3300006051 | Ga0075364_10452949 | Ga0075364_104529492 | 173 |
| 171 | 3300006175 | Ga0070712_100512460 | Ga0070712_1005124602 | 173 |
| 172 | 3300006178 | Ga0075367_10052085 | Ga0075367_100520853 | 173 |
| 173 | 3300006186 | Ga0075369_10052426 | Ga0075369_100524262 | 173 |
| 174 | 3300006186 | Ga0075369_10054029 | Ga0075369_100540292 | 173 |
| 175 | 3300006353 | Ga0075370_10005308 | Ga0075370_100053086 | 173 |
| 176 | 3300009098 | Ga0105245_10823839 | Ga0105245_108238391 | 173 |
| 177 | 3300009174 | Ga0105241_10101524 | Ga0105241_101015243 | 173 |
| 178 | 3300020070 | Ga0206356_11485773 | Ga0206356_114857731 | 173 |
| 179 | 3300020080 | Ga0206350_10285795 | Ga0206350_102857952 | 173 |
| 180 | 3300021384 | Ga0213876_10050359 | Ga0213876_100503593 | 173 |
| 181 | 3300021388 | Ga0213875_10206957 | Ga0213875_102069571 | 173 |
| 182 | 3300022467 | Ga0224712_10101591 | Ga0224712_101015911 | 173 |
| 183 | 3300025303 | Ga0209051_1003277 | Ga0209051_10032775 | 173 |
| 184 | 3300025303 | Ga0209051_1007600 | Ga0209051_10076002 | 173 |
| 185 | 3300039437 | Ga0436365_0437998 | Ga0436365_0437998_20647_21252 | 173 |
| 186 | 3300041452 | Ga0451793_1816863 | Ga0451793_1816863_350_964 | 173 |
| 187 | 3300041486 | Ga0451807_2247844 | Ga0451807_2247844_85_699 | 173 |
| 188 | 3300041512 | Ga0451853_3717851 | Ga0451853_3717851_687_1319 | 173 |
| 189 | 3300048925 | Ga0496122_0186060 | Ga0496122_0186060_358_972 | 173 |
| 190 | 3300048926 | Ga0496123_0306947 | Ga0496123_0306947_27_641 | 173 |
| 191 | 3300050490 | nmdc:mga03n38_24391_c1 | nmdc:mga03n38_24391_c1_218_823 | 173 |
| 192 | 3300050491 | nmdc:mga00v17_1162_c1 | nmdc:mga00v17_1162_c1_3485_4102 | 173 |
| 193 | 3300050492 | nmdc:mga0yw44_86229_c1 | nmdc:mga0yw44_86229_c1_587_1204 | 173 |
| 194 | 3300050496 | nmdc:mga07m45_55438_c1 | nmdc:mga07m45_55438_c1_1146_1751 | 173 |
| 195 | 3300050516 | nmdc:mga0sz30_84938_c1 | nmdc:mga0sz30_84938_c1_656_1186 | 173 |
| 196 | 3300053093 | Ga0500651_0586367 | Ga0500651_0586367_16_546 | 173 |
| 197 | 3300053134 | Ga0500658_0093853 | Ga0500658_0093853_385_915 | 173 |
| 198 | 3300003579 | Ga0007429J51699_1152951 | Ga0007429J51699_11529511 | 174 |
| 199 | 3300005337 | Ga0070682_100069055 | Ga0070682_1000690553 | 174 |
| 200 | 3300006028 | Ga0070717_10584156 | Ga0070717_105841562 | 174 |
| 201 | 3300020070 | Ga0206356_11228734 | Ga0206356_112287341 | 174 |
| 202 | 3300025929 | Ga0207664_10002268 | Ga0207664_100022687 | 174 |
| 203 | 3300030521 | Ga0307511_10000810 | Ga0307511_1000081018 | 174 |
| 204 | 3300031852 | Ga0307410_10674316 | Ga0307410_106743161 | 174 |
| 205 | 3300031995 | Ga0307409_100361760 | Ga0307409_1003617602 | 174 |
| 206 | 3300033179 | Ga0307507_10089098 | Ga0307507_100890984 | 174 |
| 207 | 3300037418 | Ga0395900_0361519 | Ga0395900_0361519_601_1332 | 174 |
| 208 | 3300044693 | Ga0466961_0004274 | Ga0466961_0004274_2400_2933 | 174 |
| 209 | 3300044719 | Ga0466971_0013740 | Ga0466971_0013740_2130_2663 | 174 |
| 210 | 3300044765 | Ga0466970_0025539 | Ga0466970_0025539_1456_1989 | 174 |
| 211 | 3300045049 | Ga0466959_0002390 | Ga0466959_0002390_805_1338 | 174 |
| 212 | 3300045976 | Ga0466967_0466830 | Ga0466967_0466830_291_860 | 174 |
| 213 | 3300048917 | Ga0496114_0172366 | Ga0496114_0172366_1078_1698 | 174 |
| 214 | 3300049127 | Ga0501306_018386 | Ga0501306_018386_105_761 | 174 |
| 215 | 3300049130 | Ga0501310_010500 | Ga0501310_010500_64_720 | 174 |
| 216 | 3300049162 | Ga0501307_001203 | Ga0501307_001203_1390_1944 | 174 |
| 217 | 3300049162 | Ga0501307_006906 | Ga0501307_006906_179_835 | 174 |
| 218 | 3300049527 | Ga0501311_019014 | Ga0501311_019014_91_747 | 174 |
| 219 | 3300049528 | Ga0501312_056150 | Ga0501312_056150_20_574 | 174 |
| 220 | 3300049531 | Ga0501315_025361 | Ga0501315_025361_14_670 | 174 |
| 221 | 3300049534 | Ga0501318_010361 | Ga0501318_010361_233_889 | 174 |
| 222 | 3300049537 | Ga0501321_006192 | Ga0501321_006192_199_855 | 174 |
| 223 | 3300049584 | Ga0501068_0518347 | Ga0501068_0518347_13_567 | 174 |
| 224 | 3300049588 | Ga0501072_0350031 | Ga0501072_0350031_228_782 | 174 |
| 225 | 3300049592 | Ga0501076_0434421 | Ga0501076_0434421_93_749 | 174 |
| 226 | 3300053136 | Ga0500559_0066633 | Ga0500559_0066633_523_1104 | 174 |
| 227 | 3300061719 | Ga0466962_0396766 | Ga0466962_0396766_40_573 | 174 |
| 228 | 3300001977 | JGI24746J21847_1008055 | JGI24746J21847_10080552 | 175 |
| 229 | 3300001991 | JGI24743J22301_10019621 | JGI24743J22301_100196212 | 175 |
| 230 | 3300002073 | JGI24745J21846_1001995 | JGI24745J21846_10019953 | 175 |
| 231 | 3300002074 | JGI24748J21848_1007123 | JGI24748J21848_10071231 | 175 |
| 232 | 3300002075 | JGI24738J21930_10023224 | JGI24738J21930_100232241 | 175 |
| 233 | 3300002076 | JGI24749J21850_1006396 | JGI24749J21850_10063963 | 175 |
| 234 | 3300002077 | JGI24744J21845_10018782 | JGI24744J21845_100187822 | 175 |
| 235 | 3300002239 | JGI24034J26672_10003918 | JGI24034J26672_100039183 | 175 |
| 236 | 3300002239 | JGI24034J26672_10019804 | JGI24034J26672_100198042 | 175 |
| 237 | 3300003579 | Ga0007429J51699_1041500 | Ga0007429J51699_10415001 | 175 |
| 238 | 3300005328 | Ga0070676_10034219 | Ga0070676_100342194 | 175 |
| 239 | 3300005330 | Ga0070690_100080359 | Ga0070690_1000803592 | 175 |
| 240 | 3300005334 | Ga0068869_100017836 | Ga0068869_1000178364 | 175 |
| 241 | 3300005335 | Ga0070666_10282779 | Ga0070666_102827793 | 175 |
| 242 | 3300005337 | Ga0070682_100012214 | Ga0070682_1000122142 | 175 |
| 243 | 3300005338 | Ga0068868_100359553 | Ga0068868_1003595532 | 175 |
| 244 | 3300005338 | Ga0068868_100611388 | Ga0068868_1006113882 | 175 |
| 245 | 3300005338 | Ga0068868_100763775 | Ga0068868_1007637751 | 175 |
| 246 | 3300005341 | Ga0070691_10039689 | Ga0070691_100396891 | 175 |
| 247 | 3300005343 | Ga0070687_100132763 | Ga0070687_1001327631 | 175 |
| 248 | 3300005345 | Ga0070692_10101827 | Ga0070692_101018272 | 175 |
| 249 | 3300005347 | Ga0070668_100173581 | Ga0070668_1001735811 | 175 |
| 250 | 3300005353 | Ga0070669_100003150 | Ga0070669_1000031507 | 175 |
| 251 | 3300005355 | Ga0070671_100106155 | Ga0070671_1001061553 | 175 |
| 252 | 3300005356 | Ga0070674_100020764 | Ga0070674_1000207641 | 175 |
| 253 | 3300005356 | Ga0070674_100272225 | Ga0070674_1002722251 | 175 |
| 254 | 3300005364 | Ga0070673_100068687 | Ga0070673_1000686873 | 175 |
| 255 | 3300005364 | Ga0070673_100495091 | Ga0070673_1004950911 | 175 |
| 256 | 3300005365 | Ga0070688_100096555 | Ga0070688_1000965552 | 175 |
| 257 | 3300005366 | Ga0070659_101065645 | Ga0070659_1010656451 | 175 |
| 258 | 3300005367 | Ga0070667_100039079 | Ga0070667_1000390796 | 175 |
| 259 | 3300005434 | Ga0070709_10707171 | Ga0070709_107071711 | 175 |
| 260 | 3300005435 | Ga0070714_100139699 | Ga0070714_1001396993 | 175 |
| 261 | 3300005438 | Ga0070701_10391377 | Ga0070701_103913771 | 175 |
| 262 | 3300005439 | Ga0070711_100023291 | Ga0070711_1000232916 | 175 |
| 263 | 3300005444 | Ga0070694_100059428 | Ga0070694_1000594283 | 175 |
| 264 | 3300005445 | Ga0070708_100665604 | Ga0070708_1006656042 | 175 |
| 265 | 3300005455 | Ga0070663_100008819 | Ga0070663_1000088192 | 175 |
| 266 | 3300005456 | Ga0070678_100024948 | Ga0070678_1000249486 | 175 |
| 267 | 3300005456 | Ga0070678_100931486 | Ga0070678_1009314861 | 175 |
| 268 | 3300005456 | Ga0070678_101116074 | Ga0070678_1011160742 | 175 |
| 269 | 3300005457 | Ga0070662_100838424 | Ga0070662_1008384241 | 175 |
| 270 | 3300005466 | Ga0070685_10103161 | Ga0070685_101031613 | 175 |
| 271 | 3300005471 | Ga0070698_101618216 | Ga0070698_1016182161 | 175 |
| 272 | 3300005539 | Ga0068853_100050120 | Ga0068853_1000501204 | 175 |
| 273 | 3300005539 | Ga0068853_100157366 | Ga0068853_1001573663 | 175 |
| 274 | 3300005544 | Ga0070686_100190485 | Ga0070686_1001904852 | 175 |
| 275 | 3300005545 | Ga0070695_100028151 | Ga0070695_1000281513 | 175 |
| 276 | 3300005546 | Ga0070696_100168343 | Ga0070696_1001683433 | 175 |
| 277 | 3300005547 | Ga0070693_100009478 | Ga0070693_1000094786 | 175 |
| 278 | 3300005549 | Ga0070704_100501237 | Ga0070704_1005012371 | 175 |
| 279 | 3300005615 | Ga0070702_100016098 | Ga0070702_1000160986 | 175 |
| 280 | 3300005616 | Ga0068852_100265143 | Ga0068852_1002651432 | 175 |
| 281 | 3300005616 | Ga0068852_100906319 | Ga0068852_1009063192 | 175 |
| 282 | 3300005719 | Ga0068861_100385509 | Ga0068861_1003855092 | 175 |
| 283 | 3300005834 | Ga0068851_10040703 | Ga0068851_100407033 | 175 |
| 284 | 3300005842 | Ga0068858_100707223 | Ga0068858_1007072231 | 175 |
| 285 | 3300005937 | Ga0081455_10045957 | Ga0081455_100459573 | 175 |
| 286 | 3300006038 | Ga0075365_10091651 | Ga0075365_100916512 | 175 |
| 287 | 3300006038 | Ga0075365_10177000 | Ga0075365_101770001 | 175 |
| 288 | 3300006038 | Ga0075365_10464010 | Ga0075365_104640101 | 175 |
| 289 | 3300006038 | Ga0075365_10558476 | Ga0075365_105584762 | 175 |
| 290 | 3300006048 | Ga0075363_100589092 | Ga0075363_1005890921 | 175 |
| 291 | 3300006051 | Ga0075364_10068525 | Ga0075364_100685253 | 175 |
| 292 | 3300006163 | Ga0070715_10002591 | Ga0070715_100025912 | 175 |
| 293 | 3300006173 | Ga0070716_100025226 | Ga0070716_1000252262 | 175 |
| 294 | 3300006175 | Ga0070712_100407273 | Ga0070712_1004072732 | 175 |
| 295 | 3300006177 | Ga0075362_10277310 | Ga0075362_102773102 | 175 |
| 296 | 3300006186 | Ga0075369_10000881 | Ga0075369_100008813 | 175 |
| 297 | 3300006186 | Ga0075369_10033107 | Ga0075369_100331073 | 175 |
| 298 | 3300006186 | Ga0075369_10201788 | Ga0075369_102017882 | 175 |
| 299 | 3300006237 | Ga0097621_100356176 | Ga0097621_1003561762 | 175 |
| 300 | 3300006353 | Ga0075370_10144220 | Ga0075370_101442202 | 175 |
| 301 | 3300006353 | Ga0075370_10294879 | Ga0075370_102948791 | 175 |
| 302 | 3300006844 | Ga0075428_100026507 | Ga0075428_1000265076 | 175 |
| 303 | 3300006846 | Ga0075430_100396100 | Ga0075430_1003961002 | 175 |
| 304 | 3300009093 | Ga0105240_11227694 | Ga0105240_112276941 | 175 |
| 305 | 3300009098 | Ga0105245_10013916 | Ga0105245_100139165 | 175 |
| 306 | 3300009098 | Ga0105245_10252212 | Ga0105245_102522122 | 175 |
| 307 | 3300009101 | Ga0105247_10032105 | Ga0105247_100321053 | 175 |
| 308 | 3300009101 | Ga0105247_10805153 | Ga0105247_108051532 | 175 |
| 309 | 3300009148 | Ga0105243_10010077 | Ga0105243_100100772 | 175 |
| 310 | 3300009176 | Ga0105242_10288041 | Ga0105242_102880412 | 175 |
| 311 | 3300009177 | Ga0105248_10814442 | Ga0105248_108144422 | 175 |
| 312 | 3300009551 | Ga0105238_10155760 | Ga0105238_101557603 | 175 |
| 313 | 3300009553 | Ga0105249_10776234 | Ga0105249_107762341 | 175 |
| 314 | 3300009553 | Ga0105249_12045362 | Ga0105249_120453621 | 175 |
| 315 | 3300010159 | Ga0099796_10148080 | Ga0099796_101480802 | 175 |
| 316 | 3300010375 | Ga0105239_10086453 | Ga0105239_100864531 | 175 |
| 317 | 3300013102 | Ga0157371_10081996 | Ga0157371_100819962 | 175 |
| 318 | 3300013105 | Ga0157369_10522498 | Ga0157369_105224982 | 175 |
| 319 | 3300013296 | Ga0157374_10176284 | Ga0157374_101762841 | 175 |
| 320 | 3300013296 | Ga0157374_10847130 | Ga0157374_108471302 | 175 |
| 321 | 3300013297 | Ga0157378_11108307 | Ga0157378_111083071 | 175 |
| 322 | 3300013306 | Ga0163162_10021950 | Ga0163162_100219503 | 175 |
| 323 | 3300013306 | Ga0163162_10040909 | Ga0163162_100409096 | 175 |
| 324 | 3300013308 | Ga0157375_10539287 | Ga0157375_105392871 | 175 |
| 325 | 3300014968 | Ga0157379_10135295 | Ga0157379_101352952 | 175 |
| 326 | 3300017792 | Ga0163161_10002416 | Ga0163161_100024163 | 175 |
| 327 | 3300017792 | Ga0163161_10028266 | Ga0163161_100282664 | 175 |
| 328 | 3300022467 | Ga0224712_10199734 | Ga0224712_101997341 | 175 |
| 329 | 3300025294 | Ga0209025_1092662 | Ga0209025_10926622 | 175 |
| 330 | 3300025303 | Ga0209051_1035079 | Ga0209051_10350792 | 175 |
| 331 | 3300025885 | Ga0207653_10116497 | Ga0207653_101164971 | 175 |
| 332 | 3300025901 | Ga0207688_10032066 | Ga0207688_100320663 | 175 |
| 333 | 3300025901 | Ga0207688_10041585 | Ga0207688_100415851 | 175 |
| 334 | 3300025901 | Ga0207688_10057716 | Ga0207688_100577162 | 175 |
| 335 | 3300025901 | Ga0207688_10157064 | Ga0207688_101570642 | 175 |
| 336 | 3300025903 | Ga0207680_10197384 | Ga0207680_101973841 | 175 |
| 337 | 3300025904 | Ga0207647_10219044 | Ga0207647_102190441 | 175 |
| 338 | 3300025905 | Ga0207685_10358088 | Ga0207685_103580881 | 175 |
| 339 | 3300025907 | Ga0207645_10455065 | Ga0207645_104550652 | 175 |
| 340 | 3300025908 | Ga0207643_10267033 | Ga0207643_102670331 | 175 |
| 341 | 3300025908 | Ga0207643_10287935 | Ga0207643_102879351 | 175 |
| 342 | 3300025911 | Ga0207654_10046587 | Ga0207654_100465873 | 175 |
| 343 | 3300025914 | Ga0207671_10138394 | Ga0207671_101383941 | 175 |
| 344 | 3300025915 | Ga0207693_10004307 | Ga0207693_100043072 | 175 |
| 345 | 3300025918 | Ga0207662_10093228 | Ga0207662_100932283 | 175 |
| 346 | 3300025919 | Ga0207657_10020453 | Ga0207657_100204535 | 175 |
| 347 | 3300025921 | Ga0207652_10514385 | Ga0207652_105143852 | 175 |
| 348 | 3300025923 | Ga0207681_10041645 | Ga0207681_100416454 | 175 |
| 349 | 3300025924 | Ga0207694_10833481 | Ga0207694_108334811 | 175 |
| 350 | 3300025927 | Ga0207687_10017222 | Ga0207687_100172224 | 175 |
| 351 | 3300025927 | Ga0207687_10236285 | Ga0207687_102362852 | 175 |
| 352 | 3300025929 | Ga0207664_10377159 | Ga0207664_103771592 | 175 |
| 353 | 3300025932 | Ga0207690_10281123 | Ga0207690_102811231 | 175 |
| 354 | 3300025932 | Ga0207690_10361343 | Ga0207690_103613432 | 175 |
| 355 | 3300025934 | Ga0207686_10511534 | Ga0207686_105115341 | 175 |
| 356 | 3300025937 | Ga0207669_10008330 | Ga0207669_100083302 | 175 |
| 357 | 3300025938 | Ga0207704_10008101 | Ga0207704_100081016 | 175 |
| 358 | 3300025938 | Ga0207704_10825121 | Ga0207704_108251211 | 175 |
| 359 | 3300025939 | Ga0207665_10011729 | Ga0207665_100117291 | 175 |
| 360 | 3300025940 | Ga0207691_10284003 | Ga0207691_102840031 | 175 |
| 361 | 3300025941 | Ga0207711_10067288 | Ga0207711_100672883 | 175 |
| 362 | 3300025942 | Ga0207689_10008495 | Ga0207689_100084953 | 175 |
| 363 | 3300025960 | Ga0207651_10093906 | Ga0207651_100939063 | 175 |
| 364 | 3300025961 | Ga0207712_10231081 | Ga0207712_102310811 | 175 |
| 365 | 3300025961 | Ga0207712_10481306 | Ga0207712_104813061 | 175 |
| 366 | 3300025972 | Ga0207668_10130447 | Ga0207668_101304471 | 175 |
| 367 | 3300025972 | Ga0207668_10855030 | Ga0207668_108550302 | 175 |
| 368 | 3300025972 | Ga0207668_11049715 | Ga0207668_110497151 | 175 |
| 369 | 3300025981 | Ga0207640_10160570 | Ga0207640_101605702 | 175 |
| 370 | 3300026023 | Ga0207677_10253750 | Ga0207677_102537502 | 175 |
| 371 | 3300026035 | Ga0207703_10011909 | Ga0207703_100119096 | 175 |
| 372 | 3300026041 | Ga0207639_10083339 | Ga0207639_100833395 | 175 |
| 373 | 3300026041 | Ga0207639_10124972 | Ga0207639_101249723 | 175 |
| 374 | 3300026067 | Ga0207678_10006251 | Ga0207678_100062511 | 175 |
| 375 | 3300026067 | Ga0207678_10029201 | Ga0207678_100292011 | 175 |
| 376 | 3300026067 | Ga0207678_10417167 | Ga0207678_104171672 | 175 |
| 377 | 3300026075 | Ga0207708_10002115 | Ga0207708_1000211510 | 175 |
| 378 | 3300026088 | Ga0207641_11204415 | Ga0207641_112044151 | 175 |
| 379 | 3300026089 | Ga0207648_10075832 | Ga0207648_100758322 | 175 |
| 380 | 3300026095 | Ga0207676_11281127 | Ga0207676_112811271 | 175 |
| 381 | 3300026118 | Ga0207675_101183149 | Ga0207675_1011831492 | 175 |
| 382 | 3300026121 | Ga0207683_11159932 | Ga0207683_111599321 | 175 |
| 383 | 3300028379 | Ga0268266_10032883 | Ga0268266_100328831 | 175 |
| 384 | 3300028379 | Ga0268266_10521859 | Ga0268266_105218592 | 175 |
| 385 | 3300028380 | Ga0268265_10316322 | Ga0268265_103163222 | 175 |
| 386 | 3300028381 | Ga0268264_10087425 | Ga0268264_100874253 | 175 |
| 387 | 3300031251 | Ga0265327_10000964 | Ga0265327_100009642 | 175 |
| 388 | 3300031251 | Ga0265327_10012527 | Ga0265327_100125273 | 175 |
| 389 | 3300031548 | Ga0307408_101291888 | Ga0307408_1012918881 | 175 |
| 390 | 3300031728 | Ga0316578_10185364 | Ga0316578_101853641 | 175 |
| 391 | 3300031731 | Ga0307405_10043096 | Ga0307405_100430963 | 175 |
| 392 | 3300031824 | Ga0307413_10637125 | Ga0307413_106371252 | 175 |
| 393 | 3300031852 | Ga0307410_10041488 | Ga0307410_100414884 | 175 |
| 394 | 3300031901 | Ga0307406_10012099 | Ga0307406_100120991 | 175 |
| 395 | 3300031903 | Ga0307407_10184435 | Ga0307407_101844352 | 175 |
| 396 | 3300031995 | Ga0307409_100440220 | Ga0307409_1004402202 | 175 |
| 397 | 3300032002 | Ga0307416_100807723 | Ga0307416_1008077232 | 175 |
| 398 | 3300032002 | Ga0307416_101119410 | Ga0307416_1011194102 | 175 |
| 399 | 3300032002 | Ga0307416_101424105 | Ga0307416_1014241052 | 175 |
| 400 | 3300032004 | Ga0307414_10651921 | Ga0307414_106519211 | 175 |
| 401 | 3300032005 | Ga0307411_10503728 | Ga0307411_105037281 | 175 |
| 402 | 3300035084 | Ga0373928_0044688 | Ga0373928_0044688_439_966 | 175 |
| 403 | 3300035092 | Ga0373952_0028170 | Ga0373952_0028170_13_540 | 175 |
| 404 | 3300035114 | Ga0373939_0060300 | Ga0373939_0060300_141_668 | 175 |
| 405 | 3300035115 | Ga0373941_0071765 | Ga0373941_0071765_247_774 | 175 |
| 406 | 3300035725 | Ga0373947_0223391 | Ga0373947_0223391_199_729 | 175 |
| 407 | 3300036647 | Ga0316582_0331809 | Ga0316582_0331809_215_745 | 175 |
| 408 | 3300036712 | Ga0316584_0093491 | Ga0316584_0093491_1371_1901 | 175 |
| 409 | 3300039450 | Ga0436363_1657922 | Ga0436363_1657922_166_732 | 175 |
| 410 | 3300039453 | Ga0436362_1246353 | Ga0436362_1246353_657_1286 | 175 |
| 411 | 3300041410 | Ga0439461_0002430 | Ga0439461_0002430_1366_1896 | 175 |
| 412 | 3300041411 | Ga0439466_0006035 | Ga0439466_0006035_496_1026 | 175 |
| 413 | 3300041413 | Ga0439465_0015539 | Ga0439465_0015539_376_906 | 175 |
| 414 | 3300041997 | Ga0439431_0006068 | Ga0439431_0006068_1616_2146 | 175 |
| 415 | 3300042004 | Ga0439445_0038935 | Ga0439445_0038935_383_913 | 175 |
| 416 | 3300042008 | Ga0439450_021487 | Ga0439450_021487_325_867 | 175 |
| 417 | 3300042016 | Ga0439463_140840 | Ga0439463_140840_30_557 | 175 |
| 418 | 3300042435 | Ga0439434_0017212 | Ga0439434_0017212_1193_1723 | 175 |
| 419 | 3300042876 | Ga0451577_0378516 | Ga0451577_0378516_351_1037 | 175 |
| 420 | 3300044656 | Ga0466969_0024794 | Ga0466969_0024794_956_1483 | 175 |
| 421 | 3300044658 | Ga0466972_0089901 | Ga0466972_0089901_72_599 | 175 |
| 422 | 3300044658 | Ga0466972_0371458 | Ga0466972_0371458_92_619 | 175 |
| 423 | 3300044683 | Ga0466965_0012386 | Ga0466965_0012386_1186_1713 | 175 |
| 424 | 3300044683 | Ga0466965_0023212 | Ga0466965_0023212_1425_1952 | 175 |
| 425 | 3300044684 | Ga0466966_0037242 | Ga0466966_0037242_1239_1766 | 175 |
| 426 | 3300044693 | Ga0466961_0017823 | Ga0466961_0017823_763_1290 | 175 |
| 427 | 3300044719 | Ga0466971_0019254 | Ga0466971_0019254_1728_2255 | 175 |
| 428 | 3300044735 | Ga0466968_0045984 | Ga0466968_0045984_165_809 | 175 |
| 429 | 3300044735 | Ga0466968_0202500 | Ga0466968_0202500_184_711 | 175 |
| 430 | 3300044842 | Ga0466957_0028635 | Ga0466957_0028635_229_756 | 175 |
| 431 | 3300044901 | Ga0466960_0006720 | Ga0466960_0006720_1965_2492 | 175 |
| 432 | 3300045049 | Ga0466959_0088114 | Ga0466959_0088114_105_632 | 175 |
| 433 | 3300045049 | Ga0466959_0366625 | Ga0466959_0366625_203_847 | 175 |
| 434 | 3300045836 | Ga0466958_0044166 | Ga0466958_0044166_2062_2589 | 175 |
| 435 | 3300046455 | Ga0495603_0015496 | Ga0495603_0015496_2668_3198 | 175 |
| 436 | 3300046459 | Ga0495629_0029521 | Ga0495629_0029521_1178_1708 | 175 |
| 437 | 3300046460 | Ga0495638_0030524 | Ga0495638_0030524_2188_2727 | 175 |
| 438 | 3300046473 | Ga0495582_0128578 | Ga0495582_0128578_446_976 | 175 |
| 439 | 3300046501 | Ga0495607_0094009 | Ga0495607_0094009_112_672 | 175 |
| 440 | 3300046511 | Ga0495608_0225298 | Ga0495608_0225298_631_1161 | 175 |
| 441 | 3300046523 | Ga0495644_0248958 | Ga0495644_0248958_85_624 | 175 |
| 442 | 3300046529 | Ga0495652_0184503 | Ga0495652_0184503_352_882 | 175 |
| 443 | 3300046531 | Ga0495665_0022481 | Ga0495665_0022481_856_1386 | 175 |
| 444 | 3300046533 | Ga0495640_0075567 | Ga0495640_0075567_1708_2238 | 175 |
| 445 | 3300046533 | Ga0495640_0137063 | Ga0495640_0137063_324_851 | 175 |
| 446 | 3300046663 | Ga0495635_0241139 | Ga0495635_0241139_257_787 | 175 |
| 447 | 3300046680 | Ga0495646_0340484 | Ga0495646_0340484_231_761 | 175 |
| 448 | 3300046694 | Ga0495649_0429552 | Ga0495649_0429552_112_639 | 175 |
| 449 | 3300047315 | Ga0495581_0039652 | Ga0495581_0039652_2127_2657 | 175 |
| 450 | 3300047319 | Ga0495674_0091311 | Ga0495674_0091311_2034_2564 | 175 |
| 451 | 3300047320 | Ga0495672_0104402 | Ga0495672_0104402_690_1229 | 175 |
| 452 | 3300047323 | Ga0495683_0000314 | Ga0495683_0000314_27364_27924 | 175 |
| 453 | 3300047673 | Ga0495593_0017479 | Ga0495593_0017479_1822_2352 | 175 |
| 454 | 3300048903 | Ga0496100_0001051 | Ga0496100_0001051_1307_1834 | 175 |
| 455 | 3300048903 | Ga0496100_0170427 | Ga0496100_0170427_354_893 | 175 |
| 456 | 3300048904 | Ga0496101_0001677 | Ga0496101_0001677_7385_7912 | 175 |
| 457 | 3300048904 | Ga0496101_0083697 | Ga0496101_0083697_1115_1654 | 175 |
| 458 | 3300048905 | Ga0496102_0254211 | Ga0496102_0254211_644_1174 | 175 |
| 459 | 3300048905 | Ga0496102_0485862 | Ga0496102_0485862_512_1039 | 175 |
| 460 | 3300048906 | Ga0496103_0057233 | Ga0496103_0057233_1653_2180 | 175 |
| 461 | 3300048907 | Ga0496104_0174677 | Ga0496104_0174677_1402_1929 | 175 |
| 462 | 3300048908 | Ga0496105_0341098 | Ga0496105_0341098_474_1001 | 175 |
| 463 | 3300048909 | Ga0496106_0000805 | Ga0496106_0000805_10655_11182 | 175 |
| 464 | 3300048910 | Ga0496107_0001147 | Ga0496107_0001147_6361_6888 | 175 |
| 465 | 3300048911 | Ga0496108_0000687 | Ga0496108_0000687_4327_4854 | 175 |
| 466 | 3300048911 | Ga0496108_0582313 | Ga0496108_0582313_67_597 | 175 |
| 467 | 3300048912 | Ga0496109_0005459 | Ga0496109_0005459_9399_9926 | 175 |
| 468 | 3300048912 | Ga0496109_0387643 | Ga0496109_0387643_713_1243 | 175 |
| 469 | 3300048915 | Ga0496112_0003894 | Ga0496112_0003894_1432_1971 | 175 |
| 470 | 3300048915 | Ga0496112_0044339 | Ga0496112_0044339_3073_3600 | 175 |
| 471 | 3300048916 | Ga0496113_0046574 | Ga0496113_0046574_1908_2447 | 175 |
| 472 | 3300048916 | Ga0496113_0321651 | Ga0496113_0321651_630_1160 | 175 |
| 473 | 3300048916 | Ga0496113_0709417 | Ga0496113_0709417_21_548 | 175 |
| 474 | 3300048917 | Ga0496114_0002245 | Ga0496114_0002245_1060_1587 | 175 |
| 475 | 3300048918 | Ga0496115_0048577 | Ga0496115_0048577_1869_2396 | 175 |
| 476 | 3300048924 | Ga0496121_0345900 | Ga0496121_0345900_33_572 | 175 |
| 477 | 3300048925 | Ga0496122_0026427 | Ga0496122_0026427_3580_4119 | 175 |
| 478 | 3300048926 | Ga0496123_0072153 | Ga0496123_0072153_866_1405 | 175 |
| 479 | 3300048928 | Ga0496125_0205063 | Ga0496125_0205063_524_1108 | 175 |
| 480 | 3300048929 | Ga0496126_0020413 | Ga0496126_0020413_713_1252 | 175 |
| 481 | 3300048929 | Ga0496126_0243723 | Ga0496126_0243723_35_574 | 175 |
| 482 | 3300049527 | Ga0501311_024877 | Ga0501311_024877_201_740 | 175 |
| 483 | 3300049528 | Ga0501312_070820 | Ga0501312_070820_16_588 | 175 |
| 484 | 3300049570 | Ga0501033_0026093 | Ga0501033_0026093_1690_2298 | 175 |
| 485 | 3300049572 | Ga0501036_0170081 | Ga0501036_0170081_1151_1759 | 175 |
| 486 | 3300049822 | Ga0501035_0000662 | Ga0501035_0000662_35242_35850 | 175 |
| 487 | 3300049823 | Ga0501044_0002840 | Ga0501044_0002840_8092_8700 | 175 |
| 488 | 3300049823 | Ga0501044_0027749 | Ga0501044_0027749_5312_5854 | 175 |
| 489 | 3300050490 | nmdc:mga03n38_217904_c1 | nmdc:mga03n38_217904_c1_103_633 | 175 |
| 490 | 3300050490 | nmdc:mga03n38_30894_c1 | nmdc:mga03n38_30894_c1_805_1374 | 175 |
| 491 | 3300050491 | nmdc:mga00v17_298030_c1 | nmdc:mga00v17_298030_c1_503_1030 | 175 |
| 492 | 3300050491 | nmdc:mga00v17_562240_c1 | nmdc:mga00v17_562240_c1_137_664 | 175 |
| 493 | 3300050492 | nmdc:mga0yw44_629925_c1 | nmdc:mga0yw44_629925_c1_131_670 | 175 |
| 494 | 3300050492 | nmdc:mga0yw44_69923_c1 | nmdc:mga0yw44_69923_c1_818_1348 | 175 |
| 495 | 3300050492 | nmdc:mga0yw44_854453_c1 | nmdc:mga0yw44_854453_c1_49_576 | 175 |
| 496 | 3300050496 | nmdc:mga07m45_129984_c1 | nmdc:mga07m45_129984_c1_355_924 | 175 |
| 497 | 3300050507 | nmdc:mga05p37_5582_c1 | nmdc:mga05p37_5582_c1_493_1020 | 175 |
| 498 | 3300050509 | nmdc:mga0qj67_434633_c1 | nmdc:mga0qj67_434633_c1_346_873 | 175 |
| 499 | 3300050516 | nmdc:mga0sz30_2111_c1 | nmdc:mga0sz30_2111_c1_3569_4099 | 175 |
| 500 | 3300053080 | Ga0500635_0097567 | Ga0500635_0097567_106_645 | 175 |
| 501 | 3300053083 | Ga0495655_0004921 | Ga0495655_0004921_173_700 | 175 |
| 502 | 3300053085 | Ga0495619_0312034 | Ga0495619_0312034_228_758 | 175 |
| 503 | 3300053087 | Ga0500643_019899 | Ga0500643_019899_1002_1541 | 175 |
| 504 | 3300053096 | Ga0500641_0029538 | Ga0500641_0029538_1523_2062 | 175 |
| 505 | 3300053136 | Ga0500559_0079212 | Ga0500559_0079212_772_1311 | 175 |
| 506 | 3300053730 | Ga0500645_000070 | Ga0500645_000070_73565_74104 | 175 |
| 507 | 3300061719 | Ga0466962_0003600 | Ga0466962_0003600_5687_6214 | 175 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fn2-assembly1.cif.gz_J | the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi | 0.9359 | 6 | 129 |
| 5zeb-assembly1.cif.gz_I | m. smegmatis p/p state 70s ribosome structure | 0.9305 | 1 | 126 |
| 7as8-assembly1.cif.gz_L | bacillus subtilis ribosome quality control complex state b. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo | 0.9289 | 6 | 125 |
| 5zeb-assembly1.cif.gz_I | m. smegmatis p/p state 70s ribosome structure | 0.9235 | 1 | 126 |
| 5j5b-assembly1.cif.gz_DI | structure of the wt e coli ribosome bound to tetracycline | 0.9174 | 5 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1zaxA01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain | 0.9157 | 6 | 126 | 3.30.70.1730 |
| af_Q9FY50_43_174_3.30.70.1730 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain | 0.8999 | 1 | 129 | 3.30.70.1730 |
| af_Q8I1U9_104_236_3.30.70.1730 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain | 0.8887 | 1 | 126 | 3.30.70.1730 |
| 6dzpI00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain | 0.8761 | 1 | 126 | 3.30.70.1730 |
| af_Q9FY50_43_174_3.30.70.1730 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain | 0.8745 | 1 | 129 | 3.30.70.1730 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D5CD46-F1-model_v4 | 50S ribosomal protein L10 | 0.9852 | 6 | 100 |
GO:0003735
GO:0006412 GO:0015934 |
| AF-A0A074TV13-F1-model_v4 | deleted | 0.9814 | 6 | 82 |
|
| AF-A0A1E4HDP3-F1-model_v4 | 50S ribosomal protein L10 | 0.9614 | 1 | 129 |
GO:0003735
GO:0006412 GO:0015934 |
| AF-A0A7C1MGM9-F1-model_v4 | Large ribosomal subunit protein uL10 (50S ribosomal protein L10) | 0.9604 | 6 | 109 |
GO:0005840
GO:1990904 |
| AF-A0A6I2V2C9-F1-model_v4 | Large ribosomal subunit protein uL10 (50S ribosomal protein L10) | 0.949 | 1 | 110 |
GO:0005840
GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar