F456726

General Info

Members Datasets Scaffolds Average Seq Length
507 342 472 178

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0062714|Ga0495650_0062714_472_1053
Length 176
Sequence MARPDKVTAVAEIAEKFRGASLRDSLGGDTTYRVAKNTLVKRAAEDAGVQGLEQMLVGPTAIAFITGEPVDAAKALRDFAKTNPGLVIKGGFMDGRALTVTEVNQLADLESREVLLAKLAGAMKANLSKAAALFAAPASQVARLAQALADKRAEEEGPAVAEAAPEAVATEADPAS

Samples

Sample ID Description Type Environment
1 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
2 2582580736 Prauserella sp. Am3 Isolate Unclassified
3 2643221692 Nocardia sp. Root136 Isolate Unclassified
4 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
5 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
6 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
7 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
8 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
9 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
10 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
11 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
12 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
13 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
14 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
15 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
16 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
17 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
18 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
19 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
20 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
21 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
22 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
23 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
24 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
25 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
26 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
27 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
28 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
29 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
30 2922554459 Rhodococcus sp. 66b Isolate Unclassified
31 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
32 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
33 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
34 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
35 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
36 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
37 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
38 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
39 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
40 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
41 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
43 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
73 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
74 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
75 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
103 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
104 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
105 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
142 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
194 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
210 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
211 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
214 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
217 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
218 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
221 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
222 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
223 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
224 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
225 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
226 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
227 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
228 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
229 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
230 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
231 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
232 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
233 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
237 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
240 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
241 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
242 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
243 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
244 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
245 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
246 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
247 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
252 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
257 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
260 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
264 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
268 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
269 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
288 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
291 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
294 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
309 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
314 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
315 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
316 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
319 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
320 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
321 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
322 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
323 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
324 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
325 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
326 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
327 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
328 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
329 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
330 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
331 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
332 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
333 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
334 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
335 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
336 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
337 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
338 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
340 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
341 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
342 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.15
Metatranscriptomes 3.94
Isolates 6.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.03
Nodule 0.2
Rhizoplane 9.07
Rhizosphere 66.86
Stem 0
Stem Tuber 0.2
Unclassified 11.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1008055 3300001977 Bacteria 1598
2 JGI24743J22301_10019621 3300001991 Bacteria 1285
3 JGI24745J21846_1001995 3300002073 Bacteria 2038
4 JGI24748J21848_1007123 3300002074 Bacteria 1308
5 JGI24738J21930_10023224 3300002075 Bacteria 1279
6 JGI24749J21850_1006396 3300002076 Bacteria 1642
7 JGI24744J21845_10018782 3300002077 Bacteria 1369
8 JGI24034J26672_10003918 3300002239 Bacteria 2094
9 JGI24034J26672_10019804 3300002239 Bacteria 1052
10 JGI25406J46586_10000352 3300003203 Bacteria 20841
11 Ga0007429J51699_1041500 3300003579 Bacteria 1067
12 Ga0007429J51699_1152951 3300003579 Bacteria 900
13 Ga0070676_10034219 3300005328 Bacteria 2917
14 Ga0070690_100080359 3300005330 Bacteria 2132
15 Ga0068869_100017836 3300005334 Bacteria 4822
16 Ga0070666_10282779 3300005335 Bacteria 1179
17 Ga0070682_100012214 3300005337 Bacteria 4918
18 Ga0070682_100069055 3300005337 Bacteria 2255
19 Ga0068868_100359553 3300005338 Bacteria 1249
20 Ga0068868_100611388 3300005338 Bacteria 967
21 Ga0068868_100763775 3300005338 Bacteria 869
22 Ga0070691_10039689 3300005341 Bacteria 2224
23 Ga0070687_100132763 3300005343 Bacteria 1439
24 Ga0070692_10101827 3300005345 Bacteria 1576
25 Ga0070668_100005182 3300005347 Bacteria 9666
26 Ga0070668_100173581 3300005347 Bacteria 1756
27 Ga0070668_100456196 3300005347 Bacteria 1100
28 Ga0070669_100003150 3300005353 Bacteria 11859
29 Ga0070669_100008483 3300005353 Bacteria 7336
30 Ga0070671_100106155 3300005355 Bacteria 2357
31 Ga0070674_100020764 3300005356 Bacteria 4204
32 Ga0070674_100272225 3300005356 Bacteria 1339
33 Ga0070673_100068687 3300005364 Bacteria 2838
34 Ga0070673_100495091 3300005364 Bacteria 1105
35 Ga0070688_100096555 3300005365 Bacteria 1941
36 Ga0070659_101065645 3300005366 Bacteria 711
37 Ga0070667_100000182 3300005367 Bacteria 75588
38 Ga0070667_100039079 3300005367 Bacteria 3977
39 Ga0070709_10137734 3300005434 Bacteria 1674
40 Ga0070709_10707171 3300005434 Bacteria 784
41 Ga0070714_100061871 3300005435 Bacteria 3216
42 Ga0070714_100139699 3300005435 Bacteria 2173
43 Ga0070713_100183300 3300005436 Bacteria 1882
44 Ga0070710_10000440 3300005437 Bacteria 19508
45 Ga0070701_10391377 3300005438 Bacteria 878
46 Ga0070711_100023291 3300005439 Bacteria 4025
47 Ga0070694_100059428 3300005444 Bacteria 2604
48 Ga0070708_100665604 3300005445 Bacteria 981
49 Ga0070663_100008819 3300005455 Bacteria 6222
50 Ga0070678_100024948 3300005456 Bacteria 4012
51 Ga0070678_100931486 3300005456 Bacteria 796
52 Ga0070678_101116074 3300005456 Bacteria 729
53 Ga0070662_100838424 3300005457 Bacteria 782
54 Ga0070681_10051164 3300005458 Bacteria 4121
55 Ga0070685_10103161 3300005466 Bacteria 1744
56 Ga0070707_100385254 3300005468 Bacteria 1362
57 Ga0070698_101618216 3300005471 Bacteria 600
58 Ga0070684_100140483 3300005535 Bacteria 2184
59 Ga0068853_100050120 3300005539 Bacteria 3591
60 Ga0068853_100157366 3300005539 Bacteria 2048
61 Ga0070686_100190485 3300005544 Bacteria 1463
62 Ga0070695_100028151 3300005545 Bacteria 3486
63 Ga0070696_100168343 3300005546 Bacteria 1618
64 Ga0070693_100009478 3300005547 Bacteria 4844
65 Ga0070665_100020670 3300005548 Bacteria 6613
66 Ga0070704_100501237 3300005549 Bacteria 1053
67 Ga0070664_100211857 3300005564 Bacteria 1732
68 Ga0068857_100133976 3300005577 Bacteria 2237
69 Ga0068856_100506993 3300005614 Bacteria 1228
70 Ga0070702_100016098 3300005615 Bacteria 3830
71 Ga0068852_100265143 3300005616 Bacteria 1651
72 Ga0068852_100906319 3300005616 Bacteria 899
73 Ga0068859_100003253 3300005617 Bacteria 16538
74 Ga0068864_100062360 3300005618 Bacteria 3230
75 Ga0068861_100385509 3300005719 Bacteria 1239
76 Ga0068851_10040703 3300005834 Bacteria 2336
77 Ga0068863_100005851 3300005841 Bacteria 12049
78 Ga0068863_100054502 3300005841 Bacteria 3788
79 Ga0068858_100707223 3300005842 Bacteria 981
80 Ga0068860_100000048 3300005843 Bacteria 209375
81 Ga0068860_100419919 3300005843 Bacteria 1326
82 Ga0068862_100000053 3300005844 Bacteria 143631
83 Ga0081455_10045957 3300005937 Bacteria 3794
84 Ga0081539_10000132 3300005985 Bacteria 175454
85 Ga0070717_10584156 3300006028 Bacteria 1013
86 Ga0075365_10091651 3300006038 Bacteria 2071
87 Ga0075365_10100820 3300006038 Bacteria 1977
88 Ga0075365_10177000 3300006038 Bacteria 1490
89 Ga0075365_10464010 3300006038 Bacteria 894
90 Ga0075365_10558476 3300006038 Bacteria 810
91 Ga0075363_100016960 3300006048 Bacteria 3605
92 Ga0075363_100589092 3300006048 Bacteria 666
93 Ga0075364_10029284 3300006051 Bacteria 3530
94 Ga0075364_10068525 3300006051 Bacteria 2333
95 Ga0075364_10089313 3300006051 Bacteria 2043
96 Ga0075364_10452949 3300006051 Bacteria 877
97 Ga0070715_10002591 3300006163 Bacteria 5584
98 Ga0070716_100025226 3300006173 Bacteria 3170
99 Ga0070716_100293994 3300006173 Bacteria 1127
100 Ga0070712_100254562 3300006175 Bacteria 1405
101 Ga0070712_100407273 3300006175 Bacteria 1124
102 Ga0070712_100512460 3300006175 Bacteria 1007
103 Ga0075362_10277310 3300006177 Bacteria 829
104 Ga0075367_10052085 3300006178 Bacteria 2422
105 Ga0075369_10000881 3300006186 Bacteria 9945
106 Ga0075369_10033107 3300006186 Bacteria 2189
107 Ga0075369_10052426 3300006186 Bacteria 1768
108 Ga0075369_10054029 3300006186 Bacteria 1744
109 Ga0075369_10201788 3300006186 Bacteria 918
110 Ga0097621_100356176 3300006237 Bacteria 1302
111 Ga0075370_10005308 3300006353 Bacteria 6385
112 Ga0075370_10144220 3300006353 Bacteria 1393
113 Ga0075370_10294879 3300006353 Bacteria 964
114 Ga0075428_100026507 3300006844 Bacteria 6416
115 Ga0075430_100396100 3300006846 Bacteria 1140
116 Ga0075434_100721830 3300006871 Bacteria 1014
117 Ga0097620_100003253 3300006931 Bacteria 16538
118 Ga0105250_10081616 3300009092 Bacteria 1311
119 Ga0105240_11227694 3300009093 Bacteria 793
120 Ga0105245_10013916 3300009098 Bacteria 7007
121 Ga0105245_10252212 3300009098 Bacteria 1715
122 Ga0105245_10823839 3300009098 Bacteria 967
123 Ga0105247_10000195 3300009101 Bacteria 59840
124 Ga0105247_10032105 3300009101 Bacteria 3189
125 Ga0105247_10805153 3300009101 Bacteria 717
126 Ga0105243_10010077 3300009148 Bacteria 7186
127 Ga0105241_10101524 3300009174 Bacteria 2287
128 Ga0105242_10288041 3300009176 Bacteria 1494
129 Ga0105248_10005324 3300009177 Bacteria 14167
130 Ga0105248_10814442 3300009177 Bacteria 1054
131 Ga0105237_10267488 3300009545 Bacteria 1712
132 Ga0105238_10155760 3300009551 Bacteria 2260
133 Ga0105249_10000022 3300009553 Bacteria 258377
134 Ga0105249_10776234 3300009553 Bacteria 1021
135 Ga0105249_12045362 3300009553 Bacteria 645
136 Ga0099796_10148080 3300010159 Bacteria 922
137 Ga0105239_10086453 3300010375 Bacteria 3456
138 Ga0157371_10081996 3300013102 Bacteria 2284
139 Ga0157369_10522498 3300013105 Bacteria 1228
140 Ga0157374_10176284 3300013296 Bacteria 2087
141 Ga0157374_10847130 3300013296 Bacteria 931
142 Ga0157378_11108307 3300013297 Bacteria 829
143 Ga0163162_10021950 3300013306 Bacteria 6289
144 Ga0163162_10040909 3300013306 Bacteria 4637
145 Ga0163162_10434238 3300013306 Bacteria 1445
146 Ga0157375_10539287 3300013308 Bacteria 1329
147 Ga0163163_10031308 3300014325 Bacteria 5134
148 Ga0163163_10049333 3300014325 Bacteria 4142
149 Ga0157379_10121187 3300014968 Bacteria 2353
150 Ga0157379_10135295 3300014968 Bacteria 2220
151 Ga0157379_10230117 3300014968 Bacteria 1680
152 Ga0157376_10429564 3300014969 Bacteria 1284
153 Ga0163161_10002416 3300017792 Bacteria 13397
154 Ga0163161_10028266 3300017792 Bacteria 3981
155 Ga0206356_11228734 3300020070 Bacteria 1213
156 Ga0206356_11485773 3300020070 Bacteria 749
157 Ga0206350_10285795 3300020080 Bacteria 1077
158 Ga0206353_11819126 3300020082 Bacteria 1210
159 Ga0213876_10050359 3300021384 Bacteria 2200
160 Ga0213875_10206957 3300021388 Bacteria 923
161 Ga0224712_10101591 3300022467 Bacteria 1220
162 Ga0224712_10199734 3300022467 Bacteria 908
163 Ga0209025_1092662 3300025294 Bacteria 983
164 Ga0209051_1003277 3300025303 Bacteria 10740
165 Ga0209051_1007600 3300025303 Bacteria 5902
166 Ga0209051_1035079 3300025303 Bacteria 1871
167 Ga0207653_10116497 3300025885 Bacteria 958
168 Ga0207692_10079631 3300025898 Bacteria 1749
169 Ga0207688_10032066 3300025901 Bacteria 2903
170 Ga0207688_10041585 3300025901 Bacteria 2557
171 Ga0207688_10057716 3300025901 Bacteria 2183
172 Ga0207688_10157064 3300025901 Bacteria 1346
173 Ga0207680_10197384 3300025903 Bacteria 1369
174 Ga0207647_10219044 3300025904 Bacteria 1097
175 Ga0207685_10358088 3300025905 Bacteria 738
176 Ga0207699_10263218 3300025906 Bacteria 1193
177 Ga0207645_10455065 3300025907 Bacteria 864
178 Ga0207643_10267033 3300025908 Bacteria 1058
179 Ga0207643_10287935 3300025908 Bacteria 1020
180 Ga0207654_10046587 3300025911 Bacteria 2473
181 Ga0207707_10271353 3300025912 Bacteria 1470
182 Ga0207671_10138394 3300025914 Bacteria 1874
183 Ga0207671_10206930 3300025914 Bacteria 1534
184 Ga0207693_10004307 3300025915 Bacteria 12051
185 Ga0207693_10038303 3300025915 Bacteria 3776
186 Ga0207662_10093228 3300025918 Bacteria 1855
187 Ga0207657_10020453 3300025919 Bacteria 6254
188 Ga0207649_11184615 3300025920 Bacteria 604
189 Ga0207652_10514385 3300025921 Bacteria 1077
190 Ga0207646_10642958 3300025922 Bacteria 950
191 Ga0207681_10041645 3300025923 Bacteria 3064
192 Ga0207694_10833481 3300025924 Bacteria 779
193 Ga0207687_10017222 3300025927 Bacteria 4753
194 Ga0207687_10236285 3300025927 Bacteria 1446
195 Ga0207664_10002268 3300025929 Bacteria 12671
196 Ga0207664_10377159 3300025929 Bacteria 1258
197 Ga0207690_10281123 3300025932 Bacteria 1296
198 Ga0207690_10361343 3300025932 Bacteria 1150
199 Ga0207686_10511534 3300025934 Bacteria 933
200 Ga0207669_10008330 3300025937 Bacteria 4859
201 Ga0207704_10008101 3300025938 Bacteria 5003
202 Ga0207704_10825121 3300025938 Bacteria 776
203 Ga0207665_10011729 3300025939 Bacteria 5758
204 Ga0207665_10184822 3300025939 Bacteria 1511
205 Ga0207691_10284003 3300025940 Bacteria 1424
206 Ga0207711_10067288 3300025941 Bacteria 3100
207 Ga0207711_10069827 3300025941 Bacteria 3046
208 Ga0207689_10008495 3300025942 Bacteria 8950
209 Ga0207651_10093906 3300025960 Bacteria 2204
210 Ga0207712_10231081 3300025961 Bacteria 1485
211 Ga0207712_10481306 3300025961 Bacteria 1058
212 Ga0207668_10005451 3300025972 Bacteria 7493
213 Ga0207668_10130447 3300025972 Bacteria 1918
214 Ga0207668_10716799 3300025972 Bacteria 880
215 Ga0207668_10855030 3300025972 Bacteria 808
216 Ga0207668_11049715 3300025972 Bacteria 729
217 Ga0207640_10160570 3300025981 Bacteria 1662
218 Ga0207677_10253750 3300026023 Bacteria 1430
219 Ga0207703_10011909 3300026035 Bacteria 6773
220 Ga0207639_10083339 3300026041 Bacteria 2538
221 Ga0207639_10124972 3300026041 Bacteria 2120
222 Ga0207678_10006251 3300026067 Bacteria 10579
223 Ga0207678_10029201 3300026067 Bacteria 4812
224 Ga0207678_10417167 3300026067 Bacteria 1164
225 Ga0207708_10002115 3300026075 Bacteria 14642
226 Ga0207641_10382878 3300026088 Bacteria 1347
227 Ga0207641_11204415 3300026088 Bacteria 757
228 Ga0207648_10075832 3300026089 Bacteria 2931
229 Ga0207676_10360274 3300026095 Bacteria 1347
230 Ga0207676_11281127 3300026095 Bacteria 727
231 Ga0207674_10417677 3300026116 Bacteria 1296
232 Ga0207675_101183149 3300026118 Bacteria 785
233 Ga0207683_11159932 3300026121 Bacteria 716
234 Ga0268266_10032883 3300028379 Bacteria 4408
235 Ga0268266_10299868 3300028379 Bacteria 1499
236 Ga0268266_10521859 3300028379 Bacteria 1136
237 Ga0268265_10316322 3300028380 Bacteria 1412
238 Ga0268264_10087425 3300028381 Bacteria 2680
239 Ga0307511_10000810 3300030521 Bacteria 33393
240 Ga0307512_10026066 3300030522 Bacteria 5165
241 Ga0265327_10000964 3300031251 Bacteria 41214
242 Ga0265327_10012527 3300031251 Bacteria 5712
243 Ga0307513_10030199 3300031456 Bacteria 6159
244 Ga0307408_101291888 3300031548 Bacteria 684
245 Ga0316578_10185364 3300031728 Bacteria 1254
246 Ga0307405_10043096 3300031731 Bacteria 2751
247 Ga0307413_10198306 3300031824 Bacteria 1447
248 Ga0307413_10637125 3300031824 Bacteria 877
249 Ga0307410_10041488 3300031852 Bacteria 3036
250 Ga0307410_10674316 3300031852 Bacteria 869
251 Ga0307406_10012099 3300031901 Bacteria 4911
252 Ga0307407_10184435 3300031903 Bacteria 1385
253 Ga0307409_100361760 3300031995 Bacteria 1373
254 Ga0307409_100440220 3300031995 Bacteria 1255
255 Ga0307416_100807723 3300032002 Bacteria 1034
256 Ga0307416_101119410 3300032002 Bacteria 892
257 Ga0307416_101424105 3300032002 Bacteria 799
258 Ga0307414_10651921 3300032004 Bacteria 949
259 Ga0307411_10503728 3300032005 Bacteria 1024
260 Ga0307415_100542612 3300032126 Bacteria 1025
261 Ga0307507_10089098 3300033179 Bacteria 2657
262 Ga0307507_10181533 3300033179 Bacteria 1503
263 Ga0373928_0044688 3300035084 Bacteria 1029
264 Ga0373952_0028170 3300035092 Bacteria 1231
265 Ga0373939_0060300 3300035114 Bacteria 1206
266 Ga0373941_0071765 3300035115 Bacteria 1151
267 Ga0373946_0314789 3300035171 Bacteria 776
268 Ga0373947_0223391 3300035725 Bacteria 1239
269 Ga0373947_0718970 3300035725 Bacteria 681
270 Ga0316582_0331809 3300036647 Bacteria 1046
271 Ga0316584_0093491 3300036712 Bacteria 2251
272 Ga0395900_0361519 3300037418 Bacteria 1423
273 Ga0436365_0437998 3300039437 Bacteria 29340
274 Ga0436365_0748242 3300039437 Bacteria 9474
275 Ga0436363_1657922 3300039450 Bacteria 915
276 Ga0436362_1246353 3300039453 Bacteria 2063
277 Ga0439461_0002430 3300041410 Bacteria 2971
278 Ga0439466_0006035 3300041411 Bacteria 4613
279 Ga0439465_0015539 3300041413 Bacteria 2375
280 Ga0451793_0774705 3300041452 Bacteria 700
281 Ga0451793_1816863 3300041452 Bacteria 1641
282 Ga0451807_2247844 3300041486 Bacteria 1084
283 Ga0451841_0264764 3300041498 Bacteria 887
284 Ga0451853_3717851 3300041512 Bacteria 1366
285 Ga0439431_0006068 3300041997 Bacteria 2668
286 Ga0439445_0038935 3300042004 Bacteria 1258
287 Ga0439450_021487 3300042008 Bacteria 1386
288 Ga0439463_140840 3300042016 Bacteria 625
289 Ga0439434_0017212 3300042435 Bacteria 2162
290 Ga0451577_0378516 3300042876 Bacteria 1284
291 Ga0466969_0024794 3300044656 Bacteria 3085
292 Ga0466972_0089901 3300044658 Bacteria 1456
293 Ga0466972_0371458 3300044658 Bacteria 669
294 Ga0466965_0012386 3300044683 Bacteria 4010
295 Ga0466965_0023212 3300044683 Bacteria 2995
296 Ga0466965_0087245 3300044683 Bacteria 1583
297 Ga0466966_0037242 3300044684 Bacteria 3138
298 Ga0466961_0004274 3300044693 Bacteria 8941
299 Ga0466961_0017823 3300044693 Bacteria 4563
300 Ga0466963_0013708 3300044694 Bacteria 4985
301 Ga0466971_0013740 3300044719 Bacteria 3560
302 Ga0466971_0019254 3300044719 Bacteria 3030
303 Ga0466968_0045984 3300044735 Bacteria 1854
304 Ga0466968_0202500 3300044735 Bacteria 930
305 Ga0466970_0025539 3300044765 Bacteria 3093
306 Ga0466957_0028635 3300044842 Bacteria 3317
307 Ga0466960_0000524 3300044901 Bacteria 13143
308 Ga0466960_0006720 3300044901 Bacteria 4628
309 Ga0466959_0002390 3300045049 Bacteria 11968
310 Ga0466959_0088114 3300045049 Bacteria 2231
311 Ga0466959_0366625 3300045049 Bacteria 981
312 Ga0466958_0044166 3300045836 Bacteria 2685
313 Ga0466967_0038042 3300045976 Bacteria 4123
314 Ga0466967_0218207 3300045976 Bacteria 1811
315 Ga0466967_0466830 3300045976 Bacteria 1235
316 Ga0495603_0015496 3300046455 Bacteria 4614
317 Ga0495629_0029521 3300046459 Bacteria 3887
318 Ga0495638_0000745 3300046460 Bacteria 34919
319 Ga0495638_0030524 3300046460 Bacteria 3468
320 Ga0495650_0062714 3300046471 Bacteria 1484
321 Ga0495582_0128578 3300046473 Bacteria 1430
322 Ga0495607_0094009 3300046501 Bacteria 1618
323 Ga0495608_0225298 3300046511 Bacteria 1175
324 Ga0495644_0248958 3300046523 Bacteria 690
325 Ga0495648_0068853 3300046524 Bacteria 2062
326 Ga0495652_0184503 3300046529 Bacteria 1598
327 Ga0495665_0022481 3300046531 Bacteria 3390
328 Ga0495640_0075567 3300046533 Bacteria 2250
329 Ga0495640_0137063 3300046533 Bacteria 1580
330 Ga0495640_0465630 3300046533 Bacteria 771
331 Ga0495668_0324202 3300046616 Bacteria 845
332 Ga0495635_0241139 3300046663 Bacteria 1220
333 Ga0495646_0340484 3300046680 Bacteria 787
334 Ga0495649_0429552 3300046694 Bacteria 661
335 Ga0495581_0039652 3300047315 Bacteria 2727
336 Ga0495674_0091311 3300047319 Bacteria 2601
337 Ga0495672_0059830 3300047320 Bacteria 2202
338 Ga0495672_0104402 3300047320 Bacteria 1531
339 Ga0495683_0000314 3300047323 Bacteria 40788
340 Ga0495673_0006586 3300047469 Bacteria 6812
341 Ga0495686_0018348 3300047472 Bacteria 4697
342 Ga0495593_0017479 3300047673 Bacteria 4037
343 Ga0496100_0001051 3300048903 Bacteria 13348
344 Ga0496100_0002523 3300048903 Bacteria 9326
345 Ga0496100_0170427 3300048903 Bacteria 1567
346 Ga0496100_0234022 3300048903 Bacteria 1353
347 Ga0496101_0000172 3300048904 Bacteria 53462
348 Ga0496101_0001677 3300048904 Bacteria 13268
349 Ga0496101_0010626 3300048904 Bacteria 6082
350 Ga0496101_0083697 3300048904 Bacteria 2362
351 Ga0496102_0000003 3300048905 Bacteria 592263
352 Ga0496102_0000050 3300048905 Bacteria 179469
353 Ga0496102_0254211 3300048905 Bacteria 1657
354 Ga0496102_0485862 3300048905 Bacteria 1156
355 Ga0496103_0001528 3300048906 Bacteria 15464
356 Ga0496103_0057233 3300048906 Bacteria 2420
357 Ga0496104_0174677 3300048907 Bacteria 2059
358 Ga0496104_0264775 3300048907 Bacteria 1631
359 Ga0496105_0038562 3300048908 Bacteria 3936
360 Ga0496105_0341098 3300048908 Bacteria 1198
361 Ga0496106_0000805 3300048909 Bacteria 22727
362 Ga0496106_0006034 3300048909 Bacteria 8967
363 Ga0496106_0131095 3300048909 Bacteria 1966
364 Ga0496107_0001147 3300048910 Bacteria 16029
365 Ga0496107_0040877 3300048910 Bacteria 3329
366 Ga0496107_0045169 3300048910 Bacteria 3168
367 Ga0496108_0000687 3300048911 Bacteria 26194
368 Ga0496108_0180772 3300048911 Bacteria 1826
369 Ga0496108_0582313 3300048911 Bacteria 975
370 Ga0496109_0005077 3300048912 Bacteria 10996
371 Ga0496109_0005459 3300048912 Bacteria 10634
372 Ga0496109_0387643 3300048912 Bacteria 1320
373 Ga0496110_0034028 3300048913 Bacteria 4411
374 Ga0496112_0003894 3300048915 Bacteria 12488
375 Ga0496112_0007121 3300048915 Bacteria 9894
376 Ga0496112_0044339 3300048915 Bacteria 4357
377 Ga0496112_0103566 3300048915 Bacteria 2816
378 Ga0496113_0012113 3300048916 Bacteria 5785
379 Ga0496113_0046574 3300048916 Bacteria 3219
380 Ga0496113_0321651 3300048916 Bacteria 1240
381 Ga0496113_0709417 3300048916 Bacteria 802
382 Ga0496114_0002245 3300048917 Bacteria 14723
383 Ga0496114_0172366 3300048917 Bacteria 1886
384 Ga0496115_0048577 3300048918 Bacteria 3394
385 Ga0496115_0694993 3300048918 Bacteria 800
386 Ga0496116_0000040 3300048919 Bacteria 346900
387 Ga0496116_0023625 3300048919 Bacteria 4573
388 Ga0496117_0000003 3300048920 Bacteria 1881097
389 Ga0496117_0000459 3300048920 Bacteria 68055
390 Ga0496118_0000001 3300048921 Bacteria 1881100
391 Ga0496118_0000452 3300048921 Bacteria 67982
392 Ga0496118_0001853 3300048921 Bacteria 30292
393 Ga0496119_0000591 3300048922 Bacteria 49100
394 Ga0496119_0092022 3300048922 Bacteria 1721
395 Ga0496120_0000293 3300048923 Bacteria 83834
396 Ga0496120_0040497 3300048923 Bacteria 2737
397 Ga0496121_0000019 3300048924 Bacteria 499976
398 Ga0496121_0003539 3300048924 Bacteria 22126
399 Ga0496121_0345900 3300048924 Bacteria 992
400 Ga0496122_0026427 3300048925 Bacteria 5004
401 Ga0496122_0186060 3300048925 Bacteria 1232
402 Ga0496123_0072153 3300048926 Bacteria 2149
403 Ga0496123_0306947 3300048926 Bacteria 755
404 Ga0496124_0062969 3300048927 Bacteria 3101
405 Ga0496125_0205063 3300048928 Bacteria 1286
406 Ga0496126_0001018 3300048929 Bacteria 47580
407 Ga0496126_0008738 3300048929 Bacteria 10876
408 Ga0496126_0011701 3300048929 Bacteria 9046
409 Ga0496126_0020413 3300048929 Bacteria 6495
410 Ga0496126_0243723 3300048929 Bacteria 1500
411 Ga0501306_018386 3300049127 Bacteria 955
412 Ga0501310_010500 3300049130 Bacteria 1034
413 Ga0501307_001203 3300049162 Bacteria 2113
414 Ga0501307_006906 3300049162 Bacteria 1239
415 Ga0501311_019014 3300049527 Bacteria 918
416 Ga0501311_024877 3300049527 Bacteria 836
417 Ga0501312_056150 3300049528 Bacteria 674
418 Ga0501312_070820 3300049528 Bacteria 618
419 Ga0501315_025361 3300049531 Bacteria 825
420 Ga0501318_010361 3300049534 Bacteria 1033
421 Ga0501321_006192 3300049537 Bacteria 1209
422 Ga0501033_0026093 3300049570 Bacteria 4398
423 Ga0501036_0170081 3300049572 Bacteria 1836
424 Ga0501068_0518347 3300049584 Bacteria 774
425 Ga0501072_0350031 3300049588 Bacteria 1173
426 Ga0501076_0434421 3300049592 Bacteria 1081
427 Ga0501035_0000662 3300049822 Bacteria 37968
428 Ga0501044_0002840 3300049823 Bacteria 19713
429 Ga0501044_0027749 3300049823 Bacteria 5977
430 nmdc:mga03n38_217904_c1 3300050490 Bacteria 995
431 nmdc:mga03n38_24391_c1 3300050490 Bacteria 2473
432 nmdc:mga03n38_30894_c1 3300050490 Bacteria 2256
433 nmdc:mga00v17_1162_c1 3300050491 Bacteria 13828
434 nmdc:mga00v17_298030_c1 3300050491 Bacteria 1047
435 nmdc:mga00v17_562240_c1 3300050491 Bacteria 737
436 nmdc:mga0yw44_629925_c1 3300050492 Bacteria 729
437 nmdc:mga0yw44_69923_c1 3300050492 Bacteria 2175
438 nmdc:mga0yw44_854453_c1 3300050492 Bacteria 618
439 nmdc:mga0yw44_86229_c1 3300050492 Bacteria 1977
440 nmdc:mga07m45_129984_c1 3300050496 Bacteria 1457
441 nmdc:mga07m45_55438_c1 3300050496 Bacteria 2241
442 nmdc:mga07m45_69589_c1 3300050496 Bacteria 2001
443 nmdc:mga05p37_5582_c1 3300050507 Bacteria 14790
444 nmdc:mga0qj67_434633_c1 3300050509 Bacteria 1058
445 nmdc:mga0sz30_2111_c1 3300050516 Bacteria 7104
446 nmdc:mga0sz30_47785_c1 3300050516 Bacteria 1809
447 nmdc:mga0sz30_84938_c1 3300050516 Bacteria 1373
448 Ga0500610_0011879 3300053079 Bacteria 3988
449 Ga0500635_0097567 3300053080 Bacteria 1077
450 Ga0495655_0004921 3300053083 Bacteria 2324
451 Ga0495619_0312034 3300053085 Bacteria 1089
452 Ga0500643_019899 3300053087 Bacteria 2204
453 Ga0500643_051311 3300053087 Bacteria 1178
454 Ga0500644_0032695 3300053088 Bacteria 1664
455 Ga0500651_0586367 3300053093 Bacteria 606
456 Ga0500641_0029538 3300053096 Bacteria 2149
457 Ga0500650_0106110 3300053098 Bacteria 1313
458 Ga0500556_0002609 3300053104 Bacteria 5666
459 Ga0500556_0164238 3300053104 Bacteria 876
460 Ga0500642_0203934 3300053130 Bacteria 920
461 Ga0500658_0093853 3300053134 Bacteria 1301
462 Ga0500559_0066633 3300053136 Bacteria 1615
463 Ga0500559_0079212 3300053136 Bacteria 1491
464 Ga0500577_0116959 3300053142 Bacteria 1106
465 Ga0500588_0068949 3300053146 Bacteria 1154
466 Ga0500604_0105289 3300053151 Bacteria 933
467 Ga0500616_0010594 3300053153 Bacteria 5507
468 Ga0500616_0086634 3300053153 Bacteria 1561
469 Ga0500645_000070 3300053730 Bacteria 79917
470 Ga0587107_042223 3300059652 Bacteria 742
471 Ga0466962_0003600 3300061719 Bacteria 7381
472 Ga0466962_0396766 3300061719 Bacteria 690

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046471 Ga0495650_0062714 Ga0495650_0062714_472_1053 156
2 3300050496 nmdc:mga07m45_69589_c1 nmdc:mga07m45_69589_c1_210_965 156
3 3300005437 Ga0070710_10000440 Ga0070710_1000044015 163
4 3300025898 Ga0207692_10079631 Ga0207692_100796313 167
5 iso_pu_bacteria 2795385472 2795793287 168
6 iso_pu_bacteria 2891326441 2891331546 168
7 3300044683 Ga0466965_0087245 Ga0466965_0087245_375_944 169
8 3300048921 Ga0496118_0000452 Ga0496118_0000452_26039_26647 169
9 iso_pu_bacteria 2751185792 2753326112 169
10 iso_pu_bacteria 2795385470 2795781401 169
11 3300005353 Ga0070669_100008483 Ga0070669_1000084835 170
12 3300005367 Ga0070667_100000182 Ga0070667_10000018259 170
13 3300005548 Ga0070665_100020670 Ga0070665_1000206705 170
14 3300005617 Ga0068859_100003253 Ga0068859_1000032535 170
15 3300005841 Ga0068863_100005851 Ga0068863_1000058514 170
16 3300005843 Ga0068860_100000048 Ga0068860_100000048204 170
17 3300005844 Ga0068862_100000053 Ga0068862_100000053142 170
18 3300006931 Ga0097620_100003253 Ga0097620_1000032535 170
19 3300009101 Ga0105247_10000195 Ga0105247_100001957 170
20 3300009177 Ga0105248_10005324 Ga0105248_100053245 170
21 3300009553 Ga0105249_10000022 Ga0105249_10000022195 170
22 3300014325 Ga0163163_10031308 Ga0163163_100313084 170
23 3300014968 Ga0157379_10121187 Ga0157379_101211872 170
24 3300048904 Ga0496101_0010626 Ga0496101_0010626_3111_3776 170
25 3300048905 Ga0496102_0000050 Ga0496102_0000050_67437_68084 170
26 3300048906 Ga0496103_0001528 Ga0496103_0001528_4778_5425 170
27 3300048909 Ga0496106_0131095 Ga0496106_0131095_1041_1706 170
28 3300048910 Ga0496107_0045169 Ga0496107_0045169_256_903 170
29 3300048915 Ga0496112_0103566 Ga0496112_0103566_1776_2291 170
30 3300048919 Ga0496116_0023625 Ga0496116_0023625_1220_1867 170
31 3300048920 Ga0496117_0000459 Ga0496117_0000459_31323_31970 170
32 3300048921 Ga0496118_0001853 Ga0496118_0001853_7791_8438 170
33 3300048922 Ga0496119_0092022 Ga0496119_0092022_541_1188 170
34 3300048923 Ga0496120_0040497 Ga0496120_0040497_1787_2434 170
35 3300048924 Ga0496121_0003539 Ga0496121_0003539_18418_19083 170
36 3300048927 Ga0496124_0062969 Ga0496124_0062969_1121_1768 170
37 3300048929 Ga0496126_0008738 Ga0496126_0008738_396_1061 170
38 iso_pu_bacteria 2565956761 2566992592 170
39 iso_pu_bacteria 2582580736 2583148974 170
40 iso_pu_bacteria 2738543034 2739366610 170
41 iso_pu_bacteria 2751185734 2753069896 170
42 iso_pu_bacteria 2808606522 2809586190 170
43 iso_pu_bacteria 2866612099 2866617139 170
44 iso_pu_bacteria 2891968417 2891973202 170
45 iso_pu_bacteria 2899359706 2899364675 170
46 iso_pu_bacteria 2899370129 2899373857 170
47 iso_pu_bacteria 2904535858 2904541546 170
48 iso_pu_bacteria 2904765812 2904767499 170
49 iso_pu_bacteria 2904770941 2904774844 170
50 iso_pu_bacteria 2908811453 2908813146 170
51 iso_pu_bacteria 2915768154 2915768429 170
52 iso_pu_bacteria 2919420072 2919423881 170
53 iso_pu_bacteria 2919432681 2919436667 170
54 iso_pu_bacteria 2922554459 2922560078 170
55 iso_pu_bacteria 8047710418 8047717810 170
56 iso_pu_bacteria 8054472261 8054479138 170
57 3300005347 Ga0070668_100005182 Ga0070668_1000051827 171
58 3300025972 Ga0207668_10005451 Ga0207668_100054514 171
59 3300059652 Ga0587107_042223 Ga0587107_042223_186_716 171
60 iso_pu_bacteria 2643221692 2644514091 171
61 iso_pu_bacteria 2643221715 2644635594 171
62 iso_pu_bacteria 2738541274 2738704715 171
63 iso_pu_bacteria 2738543028 2739329884 171
64 iso_pu_bacteria 2808606439 2809194291 171
65 iso_pu_bacteria 2842134933 2842136715 171
66 iso_pu_bacteria 2902799365 2902803573 171
67 iso_pu_bacteria 2902810491 2902813787 171
68 iso_pu_bacteria 2902837492 2902841784 171
69 iso_pu_bacteria 2929212328 2929213700 171
70 iso_pu_bacteria 2939582691 2939586711 171
71 3300003203 JGI25406J46586_10000352 JGI25406J46586_1000035212 172
72 3300005347 Ga0070668_100456196 Ga0070668_1004561962 172
73 3300005434 Ga0070709_10137734 Ga0070709_101377342 172
74 3300005435 Ga0070714_100061871 Ga0070714_1000618714 172
75 3300005436 Ga0070713_100183300 Ga0070713_1001833003 172
76 3300005458 Ga0070681_10051164 Ga0070681_100511644 172
77 3300005468 Ga0070707_100385254 Ga0070707_1003852543 172
78 3300005535 Ga0070684_100140483 Ga0070684_1001404833 172
79 3300005564 Ga0070664_100211857 Ga0070664_1002118571 172
80 3300005577 Ga0068857_100133976 Ga0068857_1001339761 172
81 3300005614 Ga0068856_100506993 Ga0068856_1005069933 172
82 3300005618 Ga0068864_100062360 Ga0068864_1000623603 172
83 3300005841 Ga0068863_100054502 Ga0068863_1000545025 172
84 3300005843 Ga0068860_100419919 Ga0068860_1004199191 172
85 3300005985 Ga0081539_10000132 Ga0081539_10000132162 172
86 3300006173 Ga0070716_100293994 Ga0070716_1002939942 172
87 3300006175 Ga0070712_100254562 Ga0070712_1002545623 172
88 3300006871 Ga0075434_100721830 Ga0075434_1007218302 172
89 3300009092 Ga0105250_10081616 Ga0105250_100816162 172
90 3300009545 Ga0105237_10267488 Ga0105237_102674883 172
91 3300013306 Ga0163162_10434238 Ga0163162_104342381 172
92 3300014325 Ga0163163_10049333 Ga0163163_100493336 172
93 3300014968 Ga0157379_10230117 Ga0157379_102301172 172
94 3300014969 Ga0157376_10429564 Ga0157376_104295642 172
95 3300020082 Ga0206353_11819126 Ga0206353_118191262 172
96 3300025906 Ga0207699_10263218 Ga0207699_102632182 172
97 3300025912 Ga0207707_10271353 Ga0207707_102713532 172
98 3300025914 Ga0207671_10206930 Ga0207671_102069303 172
99 3300025915 Ga0207693_10038303 Ga0207693_100383034 172
100 3300025920 Ga0207649_11184615 Ga0207649_111846151 172
101 3300025922 Ga0207646_10642958 Ga0207646_106429581 172
102 3300025939 Ga0207665_10184822 Ga0207665_101848222 172
103 3300025941 Ga0207711_10069827 Ga0207711_100698273 172
104 3300025972 Ga0207668_10716799 Ga0207668_107167992 172
105 3300026088 Ga0207641_10382878 Ga0207641_103828782 172
106 3300026095 Ga0207676_10360274 Ga0207676_103602741 172
107 3300026116 Ga0207674_10417677 Ga0207674_104176772 172
108 3300028379 Ga0268266_10299868 Ga0268266_102998682 172
109 3300030522 Ga0307512_10026066 Ga0307512_100260664 172
110 3300031456 Ga0307513_10030199 Ga0307513_100301993 172
111 3300031824 Ga0307413_10198306 Ga0307413_101983062 172
112 3300032126 Ga0307415_100542612 Ga0307415_1005426121 172
113 3300033179 Ga0307507_10181533 Ga0307507_101815332 172
114 3300035171 Ga0373946_0314789 Ga0373946_0314789_125_673 172
115 3300035725 Ga0373947_0718970 Ga0373947_0718970_81_629 172
116 3300039437 Ga0436365_0748242 Ga0436365_0748242_3374_4012 172
117 3300041452 Ga0451793_0774705 Ga0451793_0774705_58_579 172
118 3300041498 Ga0451841_0264764 Ga0451841_0264764_323_850 172
119 3300044694 Ga0466963_0013708 Ga0466963_0013708_3346_3966 172
120 3300044901 Ga0466960_0000524 Ga0466960_0000524_10883_11503 172
121 3300045976 Ga0466967_0038042 Ga0466967_0038042_3047_3565 172
122 3300045976 Ga0466967_0218207 Ga0466967_0218207_1175_1795 172
123 3300046460 Ga0495638_0000745 Ga0495638_0000745_27335_27967 172
124 3300046524 Ga0495648_0068853 Ga0495648_0068853_785_1417 172
125 3300046533 Ga0495640_0465630 Ga0495640_0465630_146_694 172
126 3300046616 Ga0495668_0324202 Ga0495668_0324202_138_770 172
127 3300047320 Ga0495672_0059830 Ga0495672_0059830_1141_1773 172
128 3300047469 Ga0495673_0006586 Ga0495673_0006586_4430_5062 172
129 3300047472 Ga0495686_0018348 Ga0495686_0018348_2702_3307 172
130 3300048903 Ga0496100_0002523 Ga0496100_0002523_3333_3956 172
131 3300048903 Ga0496100_0234022 Ga0496100_0234022_776_1324 172
132 3300048904 Ga0496101_0000172 Ga0496101_0000172_6630_7253 172
133 3300048905 Ga0496102_0000003 Ga0496102_0000003_290338_290961 172
134 3300048907 Ga0496104_0264775 Ga0496104_0264775_620_1168 172
135 3300048908 Ga0496105_0038562 Ga0496105_0038562_689_1237 172
136 3300048909 Ga0496106_0006034 Ga0496106_0006034_7529_8152 172
137 3300048910 Ga0496107_0040877 Ga0496107_0040877_2562_3185 172
138 3300048911 Ga0496108_0180772 Ga0496108_0180772_719_1267 172
139 3300048912 Ga0496109_0005077 Ga0496109_0005077_481_1029 172
140 3300048913 Ga0496110_0034028 Ga0496110_0034028_3376_3924 172
141 3300048915 Ga0496112_0007121 Ga0496112_0007121_3711_4259 172
142 3300048916 Ga0496113_0012113 Ga0496113_0012113_495_1043 172
143 3300048918 Ga0496115_0694993 Ga0496115_0694993_32_580 172
144 3300048919 Ga0496116_0000040 Ga0496116_0000040_44978_45601 172
145 3300048920 Ga0496117_0000003 Ga0496117_0000003_301303_301926 172
146 3300048921 Ga0496118_0000001 Ga0496118_0000001_301306_301929 172
147 3300048922 Ga0496119_0000591 Ga0496119_0000591_27770_28393 172
148 3300048923 Ga0496120_0000293 Ga0496120_0000293_38221_38844 172
149 3300048924 Ga0496121_0000019 Ga0496121_0000019_299757_300380 172
150 3300048929 Ga0496126_0001018 Ga0496126_0001018_44992_45615 172
151 3300048929 Ga0496126_0011701 Ga0496126_0011701_7716_8336 172
152 3300050516 nmdc:mga0sz30_47785_c1 nmdc:mga0sz30_47785_c1_335_1003 172
153 3300053079 Ga0500610_0011879 Ga0500610_0011879_3057_3683 172
154 3300053087 Ga0500643_051311 Ga0500643_051311_285_917 172
155 3300053088 Ga0500644_0032695 Ga0500644_0032695_228_770 172
156 3300053098 Ga0500650_0106110 Ga0500650_0106110_633_1265 172
157 3300053104 Ga0500556_0002609 Ga0500556_0002609_3720_4352 172
158 3300053104 Ga0500556_0164238 Ga0500556_0164238_170_820 172
159 3300053130 Ga0500642_0203934 Ga0500642_0203934_144_776 172
160 3300053142 Ga0500577_0116959 Ga0500577_0116959_299_931 172
161 3300053146 Ga0500588_0068949 Ga0500588_0068949_204_836 172
162 3300053151 Ga0500604_0105289 Ga0500604_0105289_14_646 172
163 3300053153 Ga0500616_0010594 Ga0500616_0010594_2124_2750 172
164 3300053153 Ga0500616_0086634 Ga0500616_0086634_147_773 172
165 iso_pu_bacteria 8057568493 8057570151 172
166 3300006038 Ga0075365_10100820 Ga0075365_101008203 173
167 3300006048 Ga0075363_100016960 Ga0075363_1000169603 173
168 3300006051 Ga0075364_10029284 Ga0075364_100292842 173
169 3300006051 Ga0075364_10089313 Ga0075364_100893133 173
170 3300006051 Ga0075364_10452949 Ga0075364_104529492 173
171 3300006175 Ga0070712_100512460 Ga0070712_1005124602 173
172 3300006178 Ga0075367_10052085 Ga0075367_100520853 173
173 3300006186 Ga0075369_10052426 Ga0075369_100524262 173
174 3300006186 Ga0075369_10054029 Ga0075369_100540292 173
175 3300006353 Ga0075370_10005308 Ga0075370_100053086 173
176 3300009098 Ga0105245_10823839 Ga0105245_108238391 173
177 3300009174 Ga0105241_10101524 Ga0105241_101015243 173
178 3300020070 Ga0206356_11485773 Ga0206356_114857731 173
179 3300020080 Ga0206350_10285795 Ga0206350_102857952 173
180 3300021384 Ga0213876_10050359 Ga0213876_100503593 173
181 3300021388 Ga0213875_10206957 Ga0213875_102069571 173
182 3300022467 Ga0224712_10101591 Ga0224712_101015911 173
183 3300025303 Ga0209051_1003277 Ga0209051_10032775 173
184 3300025303 Ga0209051_1007600 Ga0209051_10076002 173
185 3300039437 Ga0436365_0437998 Ga0436365_0437998_20647_21252 173
186 3300041452 Ga0451793_1816863 Ga0451793_1816863_350_964 173
187 3300041486 Ga0451807_2247844 Ga0451807_2247844_85_699 173
188 3300041512 Ga0451853_3717851 Ga0451853_3717851_687_1319 173
189 3300048925 Ga0496122_0186060 Ga0496122_0186060_358_972 173
190 3300048926 Ga0496123_0306947 Ga0496123_0306947_27_641 173
191 3300050490 nmdc:mga03n38_24391_c1 nmdc:mga03n38_24391_c1_218_823 173
192 3300050491 nmdc:mga00v17_1162_c1 nmdc:mga00v17_1162_c1_3485_4102 173
193 3300050492 nmdc:mga0yw44_86229_c1 nmdc:mga0yw44_86229_c1_587_1204 173
194 3300050496 nmdc:mga07m45_55438_c1 nmdc:mga07m45_55438_c1_1146_1751 173
195 3300050516 nmdc:mga0sz30_84938_c1 nmdc:mga0sz30_84938_c1_656_1186 173
196 3300053093 Ga0500651_0586367 Ga0500651_0586367_16_546 173
197 3300053134 Ga0500658_0093853 Ga0500658_0093853_385_915 173
198 3300003579 Ga0007429J51699_1152951 Ga0007429J51699_11529511 174
199 3300005337 Ga0070682_100069055 Ga0070682_1000690553 174
200 3300006028 Ga0070717_10584156 Ga0070717_105841562 174
201 3300020070 Ga0206356_11228734 Ga0206356_112287341 174
202 3300025929 Ga0207664_10002268 Ga0207664_100022687 174
203 3300030521 Ga0307511_10000810 Ga0307511_1000081018 174
204 3300031852 Ga0307410_10674316 Ga0307410_106743161 174
205 3300031995 Ga0307409_100361760 Ga0307409_1003617602 174
206 3300033179 Ga0307507_10089098 Ga0307507_100890984 174
207 3300037418 Ga0395900_0361519 Ga0395900_0361519_601_1332 174
208 3300044693 Ga0466961_0004274 Ga0466961_0004274_2400_2933 174
209 3300044719 Ga0466971_0013740 Ga0466971_0013740_2130_2663 174
210 3300044765 Ga0466970_0025539 Ga0466970_0025539_1456_1989 174
211 3300045049 Ga0466959_0002390 Ga0466959_0002390_805_1338 174
212 3300045976 Ga0466967_0466830 Ga0466967_0466830_291_860 174
213 3300048917 Ga0496114_0172366 Ga0496114_0172366_1078_1698 174
214 3300049127 Ga0501306_018386 Ga0501306_018386_105_761 174
215 3300049130 Ga0501310_010500 Ga0501310_010500_64_720 174
216 3300049162 Ga0501307_001203 Ga0501307_001203_1390_1944 174
217 3300049162 Ga0501307_006906 Ga0501307_006906_179_835 174
218 3300049527 Ga0501311_019014 Ga0501311_019014_91_747 174
219 3300049528 Ga0501312_056150 Ga0501312_056150_20_574 174
220 3300049531 Ga0501315_025361 Ga0501315_025361_14_670 174
221 3300049534 Ga0501318_010361 Ga0501318_010361_233_889 174
222 3300049537 Ga0501321_006192 Ga0501321_006192_199_855 174
223 3300049584 Ga0501068_0518347 Ga0501068_0518347_13_567 174
224 3300049588 Ga0501072_0350031 Ga0501072_0350031_228_782 174
225 3300049592 Ga0501076_0434421 Ga0501076_0434421_93_749 174
226 3300053136 Ga0500559_0066633 Ga0500559_0066633_523_1104 174
227 3300061719 Ga0466962_0396766 Ga0466962_0396766_40_573 174
228 3300001977 JGI24746J21847_1008055 JGI24746J21847_10080552 175
229 3300001991 JGI24743J22301_10019621 JGI24743J22301_100196212 175
230 3300002073 JGI24745J21846_1001995 JGI24745J21846_10019953 175
231 3300002074 JGI24748J21848_1007123 JGI24748J21848_10071231 175
232 3300002075 JGI24738J21930_10023224 JGI24738J21930_100232241 175
233 3300002076 JGI24749J21850_1006396 JGI24749J21850_10063963 175
234 3300002077 JGI24744J21845_10018782 JGI24744J21845_100187822 175
235 3300002239 JGI24034J26672_10003918 JGI24034J26672_100039183 175
236 3300002239 JGI24034J26672_10019804 JGI24034J26672_100198042 175
237 3300003579 Ga0007429J51699_1041500 Ga0007429J51699_10415001 175
238 3300005328 Ga0070676_10034219 Ga0070676_100342194 175
239 3300005330 Ga0070690_100080359 Ga0070690_1000803592 175
240 3300005334 Ga0068869_100017836 Ga0068869_1000178364 175
241 3300005335 Ga0070666_10282779 Ga0070666_102827793 175
242 3300005337 Ga0070682_100012214 Ga0070682_1000122142 175
243 3300005338 Ga0068868_100359553 Ga0068868_1003595532 175
244 3300005338 Ga0068868_100611388 Ga0068868_1006113882 175
245 3300005338 Ga0068868_100763775 Ga0068868_1007637751 175
246 3300005341 Ga0070691_10039689 Ga0070691_100396891 175
247 3300005343 Ga0070687_100132763 Ga0070687_1001327631 175
248 3300005345 Ga0070692_10101827 Ga0070692_101018272 175
249 3300005347 Ga0070668_100173581 Ga0070668_1001735811 175
250 3300005353 Ga0070669_100003150 Ga0070669_1000031507 175
251 3300005355 Ga0070671_100106155 Ga0070671_1001061553 175
252 3300005356 Ga0070674_100020764 Ga0070674_1000207641 175
253 3300005356 Ga0070674_100272225 Ga0070674_1002722251 175
254 3300005364 Ga0070673_100068687 Ga0070673_1000686873 175
255 3300005364 Ga0070673_100495091 Ga0070673_1004950911 175
256 3300005365 Ga0070688_100096555 Ga0070688_1000965552 175
257 3300005366 Ga0070659_101065645 Ga0070659_1010656451 175
258 3300005367 Ga0070667_100039079 Ga0070667_1000390796 175
259 3300005434 Ga0070709_10707171 Ga0070709_107071711 175
260 3300005435 Ga0070714_100139699 Ga0070714_1001396993 175
261 3300005438 Ga0070701_10391377 Ga0070701_103913771 175
262 3300005439 Ga0070711_100023291 Ga0070711_1000232916 175
263 3300005444 Ga0070694_100059428 Ga0070694_1000594283 175
264 3300005445 Ga0070708_100665604 Ga0070708_1006656042 175
265 3300005455 Ga0070663_100008819 Ga0070663_1000088192 175
266 3300005456 Ga0070678_100024948 Ga0070678_1000249486 175
267 3300005456 Ga0070678_100931486 Ga0070678_1009314861 175
268 3300005456 Ga0070678_101116074 Ga0070678_1011160742 175
269 3300005457 Ga0070662_100838424 Ga0070662_1008384241 175
270 3300005466 Ga0070685_10103161 Ga0070685_101031613 175
271 3300005471 Ga0070698_101618216 Ga0070698_1016182161 175
272 3300005539 Ga0068853_100050120 Ga0068853_1000501204 175
273 3300005539 Ga0068853_100157366 Ga0068853_1001573663 175
274 3300005544 Ga0070686_100190485 Ga0070686_1001904852 175
275 3300005545 Ga0070695_100028151 Ga0070695_1000281513 175
276 3300005546 Ga0070696_100168343 Ga0070696_1001683433 175
277 3300005547 Ga0070693_100009478 Ga0070693_1000094786 175
278 3300005549 Ga0070704_100501237 Ga0070704_1005012371 175
279 3300005615 Ga0070702_100016098 Ga0070702_1000160986 175
280 3300005616 Ga0068852_100265143 Ga0068852_1002651432 175
281 3300005616 Ga0068852_100906319 Ga0068852_1009063192 175
282 3300005719 Ga0068861_100385509 Ga0068861_1003855092 175
283 3300005834 Ga0068851_10040703 Ga0068851_100407033 175
284 3300005842 Ga0068858_100707223 Ga0068858_1007072231 175
285 3300005937 Ga0081455_10045957 Ga0081455_100459573 175
286 3300006038 Ga0075365_10091651 Ga0075365_100916512 175
287 3300006038 Ga0075365_10177000 Ga0075365_101770001 175
288 3300006038 Ga0075365_10464010 Ga0075365_104640101 175
289 3300006038 Ga0075365_10558476 Ga0075365_105584762 175
290 3300006048 Ga0075363_100589092 Ga0075363_1005890921 175
291 3300006051 Ga0075364_10068525 Ga0075364_100685253 175
292 3300006163 Ga0070715_10002591 Ga0070715_100025912 175
293 3300006173 Ga0070716_100025226 Ga0070716_1000252262 175
294 3300006175 Ga0070712_100407273 Ga0070712_1004072732 175
295 3300006177 Ga0075362_10277310 Ga0075362_102773102 175
296 3300006186 Ga0075369_10000881 Ga0075369_100008813 175
297 3300006186 Ga0075369_10033107 Ga0075369_100331073 175
298 3300006186 Ga0075369_10201788 Ga0075369_102017882 175
299 3300006237 Ga0097621_100356176 Ga0097621_1003561762 175
300 3300006353 Ga0075370_10144220 Ga0075370_101442202 175
301 3300006353 Ga0075370_10294879 Ga0075370_102948791 175
302 3300006844 Ga0075428_100026507 Ga0075428_1000265076 175
303 3300006846 Ga0075430_100396100 Ga0075430_1003961002 175
304 3300009093 Ga0105240_11227694 Ga0105240_112276941 175
305 3300009098 Ga0105245_10013916 Ga0105245_100139165 175
306 3300009098 Ga0105245_10252212 Ga0105245_102522122 175
307 3300009101 Ga0105247_10032105 Ga0105247_100321053 175
308 3300009101 Ga0105247_10805153 Ga0105247_108051532 175
309 3300009148 Ga0105243_10010077 Ga0105243_100100772 175
310 3300009176 Ga0105242_10288041 Ga0105242_102880412 175
311 3300009177 Ga0105248_10814442 Ga0105248_108144422 175
312 3300009551 Ga0105238_10155760 Ga0105238_101557603 175
313 3300009553 Ga0105249_10776234 Ga0105249_107762341 175
314 3300009553 Ga0105249_12045362 Ga0105249_120453621 175
315 3300010159 Ga0099796_10148080 Ga0099796_101480802 175
316 3300010375 Ga0105239_10086453 Ga0105239_100864531 175
317 3300013102 Ga0157371_10081996 Ga0157371_100819962 175
318 3300013105 Ga0157369_10522498 Ga0157369_105224982 175
319 3300013296 Ga0157374_10176284 Ga0157374_101762841 175
320 3300013296 Ga0157374_10847130 Ga0157374_108471302 175
321 3300013297 Ga0157378_11108307 Ga0157378_111083071 175
322 3300013306 Ga0163162_10021950 Ga0163162_100219503 175
323 3300013306 Ga0163162_10040909 Ga0163162_100409096 175
324 3300013308 Ga0157375_10539287 Ga0157375_105392871 175
325 3300014968 Ga0157379_10135295 Ga0157379_101352952 175
326 3300017792 Ga0163161_10002416 Ga0163161_100024163 175
327 3300017792 Ga0163161_10028266 Ga0163161_100282664 175
328 3300022467 Ga0224712_10199734 Ga0224712_101997341 175
329 3300025294 Ga0209025_1092662 Ga0209025_10926622 175
330 3300025303 Ga0209051_1035079 Ga0209051_10350792 175
331 3300025885 Ga0207653_10116497 Ga0207653_101164971 175
332 3300025901 Ga0207688_10032066 Ga0207688_100320663 175
333 3300025901 Ga0207688_10041585 Ga0207688_100415851 175
334 3300025901 Ga0207688_10057716 Ga0207688_100577162 175
335 3300025901 Ga0207688_10157064 Ga0207688_101570642 175
336 3300025903 Ga0207680_10197384 Ga0207680_101973841 175
337 3300025904 Ga0207647_10219044 Ga0207647_102190441 175
338 3300025905 Ga0207685_10358088 Ga0207685_103580881 175
339 3300025907 Ga0207645_10455065 Ga0207645_104550652 175
340 3300025908 Ga0207643_10267033 Ga0207643_102670331 175
341 3300025908 Ga0207643_10287935 Ga0207643_102879351 175
342 3300025911 Ga0207654_10046587 Ga0207654_100465873 175
343 3300025914 Ga0207671_10138394 Ga0207671_101383941 175
344 3300025915 Ga0207693_10004307 Ga0207693_100043072 175
345 3300025918 Ga0207662_10093228 Ga0207662_100932283 175
346 3300025919 Ga0207657_10020453 Ga0207657_100204535 175
347 3300025921 Ga0207652_10514385 Ga0207652_105143852 175
348 3300025923 Ga0207681_10041645 Ga0207681_100416454 175
349 3300025924 Ga0207694_10833481 Ga0207694_108334811 175
350 3300025927 Ga0207687_10017222 Ga0207687_100172224 175
351 3300025927 Ga0207687_10236285 Ga0207687_102362852 175
352 3300025929 Ga0207664_10377159 Ga0207664_103771592 175
353 3300025932 Ga0207690_10281123 Ga0207690_102811231 175
354 3300025932 Ga0207690_10361343 Ga0207690_103613432 175
355 3300025934 Ga0207686_10511534 Ga0207686_105115341 175
356 3300025937 Ga0207669_10008330 Ga0207669_100083302 175
357 3300025938 Ga0207704_10008101 Ga0207704_100081016 175
358 3300025938 Ga0207704_10825121 Ga0207704_108251211 175
359 3300025939 Ga0207665_10011729 Ga0207665_100117291 175
360 3300025940 Ga0207691_10284003 Ga0207691_102840031 175
361 3300025941 Ga0207711_10067288 Ga0207711_100672883 175
362 3300025942 Ga0207689_10008495 Ga0207689_100084953 175
363 3300025960 Ga0207651_10093906 Ga0207651_100939063 175
364 3300025961 Ga0207712_10231081 Ga0207712_102310811 175
365 3300025961 Ga0207712_10481306 Ga0207712_104813061 175
366 3300025972 Ga0207668_10130447 Ga0207668_101304471 175
367 3300025972 Ga0207668_10855030 Ga0207668_108550302 175
368 3300025972 Ga0207668_11049715 Ga0207668_110497151 175
369 3300025981 Ga0207640_10160570 Ga0207640_101605702 175
370 3300026023 Ga0207677_10253750 Ga0207677_102537502 175
371 3300026035 Ga0207703_10011909 Ga0207703_100119096 175
372 3300026041 Ga0207639_10083339 Ga0207639_100833395 175
373 3300026041 Ga0207639_10124972 Ga0207639_101249723 175
374 3300026067 Ga0207678_10006251 Ga0207678_100062511 175
375 3300026067 Ga0207678_10029201 Ga0207678_100292011 175
376 3300026067 Ga0207678_10417167 Ga0207678_104171672 175
377 3300026075 Ga0207708_10002115 Ga0207708_1000211510 175
378 3300026088 Ga0207641_11204415 Ga0207641_112044151 175
379 3300026089 Ga0207648_10075832 Ga0207648_100758322 175
380 3300026095 Ga0207676_11281127 Ga0207676_112811271 175
381 3300026118 Ga0207675_101183149 Ga0207675_1011831492 175
382 3300026121 Ga0207683_11159932 Ga0207683_111599321 175
383 3300028379 Ga0268266_10032883 Ga0268266_100328831 175
384 3300028379 Ga0268266_10521859 Ga0268266_105218592 175
385 3300028380 Ga0268265_10316322 Ga0268265_103163222 175
386 3300028381 Ga0268264_10087425 Ga0268264_100874253 175
387 3300031251 Ga0265327_10000964 Ga0265327_100009642 175
388 3300031251 Ga0265327_10012527 Ga0265327_100125273 175
389 3300031548 Ga0307408_101291888 Ga0307408_1012918881 175
390 3300031728 Ga0316578_10185364 Ga0316578_101853641 175
391 3300031731 Ga0307405_10043096 Ga0307405_100430963 175
392 3300031824 Ga0307413_10637125 Ga0307413_106371252 175
393 3300031852 Ga0307410_10041488 Ga0307410_100414884 175
394 3300031901 Ga0307406_10012099 Ga0307406_100120991 175
395 3300031903 Ga0307407_10184435 Ga0307407_101844352 175
396 3300031995 Ga0307409_100440220 Ga0307409_1004402202 175
397 3300032002 Ga0307416_100807723 Ga0307416_1008077232 175
398 3300032002 Ga0307416_101119410 Ga0307416_1011194102 175
399 3300032002 Ga0307416_101424105 Ga0307416_1014241052 175
400 3300032004 Ga0307414_10651921 Ga0307414_106519211 175
401 3300032005 Ga0307411_10503728 Ga0307411_105037281 175
402 3300035084 Ga0373928_0044688 Ga0373928_0044688_439_966 175
403 3300035092 Ga0373952_0028170 Ga0373952_0028170_13_540 175
404 3300035114 Ga0373939_0060300 Ga0373939_0060300_141_668 175
405 3300035115 Ga0373941_0071765 Ga0373941_0071765_247_774 175
406 3300035725 Ga0373947_0223391 Ga0373947_0223391_199_729 175
407 3300036647 Ga0316582_0331809 Ga0316582_0331809_215_745 175
408 3300036712 Ga0316584_0093491 Ga0316584_0093491_1371_1901 175
409 3300039450 Ga0436363_1657922 Ga0436363_1657922_166_732 175
410 3300039453 Ga0436362_1246353 Ga0436362_1246353_657_1286 175
411 3300041410 Ga0439461_0002430 Ga0439461_0002430_1366_1896 175
412 3300041411 Ga0439466_0006035 Ga0439466_0006035_496_1026 175
413 3300041413 Ga0439465_0015539 Ga0439465_0015539_376_906 175
414 3300041997 Ga0439431_0006068 Ga0439431_0006068_1616_2146 175
415 3300042004 Ga0439445_0038935 Ga0439445_0038935_383_913 175
416 3300042008 Ga0439450_021487 Ga0439450_021487_325_867 175
417 3300042016 Ga0439463_140840 Ga0439463_140840_30_557 175
418 3300042435 Ga0439434_0017212 Ga0439434_0017212_1193_1723 175
419 3300042876 Ga0451577_0378516 Ga0451577_0378516_351_1037 175
420 3300044656 Ga0466969_0024794 Ga0466969_0024794_956_1483 175
421 3300044658 Ga0466972_0089901 Ga0466972_0089901_72_599 175
422 3300044658 Ga0466972_0371458 Ga0466972_0371458_92_619 175
423 3300044683 Ga0466965_0012386 Ga0466965_0012386_1186_1713 175
424 3300044683 Ga0466965_0023212 Ga0466965_0023212_1425_1952 175
425 3300044684 Ga0466966_0037242 Ga0466966_0037242_1239_1766 175
426 3300044693 Ga0466961_0017823 Ga0466961_0017823_763_1290 175
427 3300044719 Ga0466971_0019254 Ga0466971_0019254_1728_2255 175
428 3300044735 Ga0466968_0045984 Ga0466968_0045984_165_809 175
429 3300044735 Ga0466968_0202500 Ga0466968_0202500_184_711 175
430 3300044842 Ga0466957_0028635 Ga0466957_0028635_229_756 175
431 3300044901 Ga0466960_0006720 Ga0466960_0006720_1965_2492 175
432 3300045049 Ga0466959_0088114 Ga0466959_0088114_105_632 175
433 3300045049 Ga0466959_0366625 Ga0466959_0366625_203_847 175
434 3300045836 Ga0466958_0044166 Ga0466958_0044166_2062_2589 175
435 3300046455 Ga0495603_0015496 Ga0495603_0015496_2668_3198 175
436 3300046459 Ga0495629_0029521 Ga0495629_0029521_1178_1708 175
437 3300046460 Ga0495638_0030524 Ga0495638_0030524_2188_2727 175
438 3300046473 Ga0495582_0128578 Ga0495582_0128578_446_976 175
439 3300046501 Ga0495607_0094009 Ga0495607_0094009_112_672 175
440 3300046511 Ga0495608_0225298 Ga0495608_0225298_631_1161 175
441 3300046523 Ga0495644_0248958 Ga0495644_0248958_85_624 175
442 3300046529 Ga0495652_0184503 Ga0495652_0184503_352_882 175
443 3300046531 Ga0495665_0022481 Ga0495665_0022481_856_1386 175
444 3300046533 Ga0495640_0075567 Ga0495640_0075567_1708_2238 175
445 3300046533 Ga0495640_0137063 Ga0495640_0137063_324_851 175
446 3300046663 Ga0495635_0241139 Ga0495635_0241139_257_787 175
447 3300046680 Ga0495646_0340484 Ga0495646_0340484_231_761 175
448 3300046694 Ga0495649_0429552 Ga0495649_0429552_112_639 175
449 3300047315 Ga0495581_0039652 Ga0495581_0039652_2127_2657 175
450 3300047319 Ga0495674_0091311 Ga0495674_0091311_2034_2564 175
451 3300047320 Ga0495672_0104402 Ga0495672_0104402_690_1229 175
452 3300047323 Ga0495683_0000314 Ga0495683_0000314_27364_27924 175
453 3300047673 Ga0495593_0017479 Ga0495593_0017479_1822_2352 175
454 3300048903 Ga0496100_0001051 Ga0496100_0001051_1307_1834 175
455 3300048903 Ga0496100_0170427 Ga0496100_0170427_354_893 175
456 3300048904 Ga0496101_0001677 Ga0496101_0001677_7385_7912 175
457 3300048904 Ga0496101_0083697 Ga0496101_0083697_1115_1654 175
458 3300048905 Ga0496102_0254211 Ga0496102_0254211_644_1174 175
459 3300048905 Ga0496102_0485862 Ga0496102_0485862_512_1039 175
460 3300048906 Ga0496103_0057233 Ga0496103_0057233_1653_2180 175
461 3300048907 Ga0496104_0174677 Ga0496104_0174677_1402_1929 175
462 3300048908 Ga0496105_0341098 Ga0496105_0341098_474_1001 175
463 3300048909 Ga0496106_0000805 Ga0496106_0000805_10655_11182 175
464 3300048910 Ga0496107_0001147 Ga0496107_0001147_6361_6888 175
465 3300048911 Ga0496108_0000687 Ga0496108_0000687_4327_4854 175
466 3300048911 Ga0496108_0582313 Ga0496108_0582313_67_597 175
467 3300048912 Ga0496109_0005459 Ga0496109_0005459_9399_9926 175
468 3300048912 Ga0496109_0387643 Ga0496109_0387643_713_1243 175
469 3300048915 Ga0496112_0003894 Ga0496112_0003894_1432_1971 175
470 3300048915 Ga0496112_0044339 Ga0496112_0044339_3073_3600 175
471 3300048916 Ga0496113_0046574 Ga0496113_0046574_1908_2447 175
472 3300048916 Ga0496113_0321651 Ga0496113_0321651_630_1160 175
473 3300048916 Ga0496113_0709417 Ga0496113_0709417_21_548 175
474 3300048917 Ga0496114_0002245 Ga0496114_0002245_1060_1587 175
475 3300048918 Ga0496115_0048577 Ga0496115_0048577_1869_2396 175
476 3300048924 Ga0496121_0345900 Ga0496121_0345900_33_572 175
477 3300048925 Ga0496122_0026427 Ga0496122_0026427_3580_4119 175
478 3300048926 Ga0496123_0072153 Ga0496123_0072153_866_1405 175
479 3300048928 Ga0496125_0205063 Ga0496125_0205063_524_1108 175
480 3300048929 Ga0496126_0020413 Ga0496126_0020413_713_1252 175
481 3300048929 Ga0496126_0243723 Ga0496126_0243723_35_574 175
482 3300049527 Ga0501311_024877 Ga0501311_024877_201_740 175
483 3300049528 Ga0501312_070820 Ga0501312_070820_16_588 175
484 3300049570 Ga0501033_0026093 Ga0501033_0026093_1690_2298 175
485 3300049572 Ga0501036_0170081 Ga0501036_0170081_1151_1759 175
486 3300049822 Ga0501035_0000662 Ga0501035_0000662_35242_35850 175
487 3300049823 Ga0501044_0002840 Ga0501044_0002840_8092_8700 175
488 3300049823 Ga0501044_0027749 Ga0501044_0027749_5312_5854 175
489 3300050490 nmdc:mga03n38_217904_c1 nmdc:mga03n38_217904_c1_103_633 175
490 3300050490 nmdc:mga03n38_30894_c1 nmdc:mga03n38_30894_c1_805_1374 175
491 3300050491 nmdc:mga00v17_298030_c1 nmdc:mga00v17_298030_c1_503_1030 175
492 3300050491 nmdc:mga00v17_562240_c1 nmdc:mga00v17_562240_c1_137_664 175
493 3300050492 nmdc:mga0yw44_629925_c1 nmdc:mga0yw44_629925_c1_131_670 175
494 3300050492 nmdc:mga0yw44_69923_c1 nmdc:mga0yw44_69923_c1_818_1348 175
495 3300050492 nmdc:mga0yw44_854453_c1 nmdc:mga0yw44_854453_c1_49_576 175
496 3300050496 nmdc:mga07m45_129984_c1 nmdc:mga07m45_129984_c1_355_924 175
497 3300050507 nmdc:mga05p37_5582_c1 nmdc:mga05p37_5582_c1_493_1020 175
498 3300050509 nmdc:mga0qj67_434633_c1 nmdc:mga0qj67_434633_c1_346_873 175
499 3300050516 nmdc:mga0sz30_2111_c1 nmdc:mga0sz30_2111_c1_3569_4099 175
500 3300053080 Ga0500635_0097567 Ga0500635_0097567_106_645 175
501 3300053083 Ga0495655_0004921 Ga0495655_0004921_173_700 175
502 3300053085 Ga0495619_0312034 Ga0495619_0312034_228_758 175
503 3300053087 Ga0500643_019899 Ga0500643_019899_1002_1541 175
504 3300053096 Ga0500641_0029538 Ga0500641_0029538_1523_2062 175
505 3300053136 Ga0500559_0079212 Ga0500559_0079212_772_1311 175
506 3300053730 Ga0500645_000070 Ga0500645_000070_73565_74104 175
507 3300061719 Ga0466962_0003600 Ga0466962_0003600_5687_6214 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00466

Ribosomal_L10

Ribosomal protein L10

19

81

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fn2-assembly1.cif.gz_J the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9359 6 129
5zeb-assembly1.cif.gz_I m. smegmatis p/p state 70s ribosome structure 0.9305 1 126
7as8-assembly1.cif.gz_L bacillus subtilis ribosome quality control complex state b. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo 0.9289 6 125
5zeb-assembly1.cif.gz_I m. smegmatis p/p state 70s ribosome structure 0.9235 1 126
5j5b-assembly1.cif.gz_DI structure of the wt e coli ribosome bound to tetracycline 0.9174 5 130
ID Description Score Start End Superfamily
1zaxA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.9157 6 126 3.30.70.1730
af_Q9FY50_43_174_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8999 1 129 3.30.70.1730
af_Q8I1U9_104_236_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8887 1 126 3.30.70.1730
6dzpI00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8761 1 126 3.30.70.1730
af_Q9FY50_43_174_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8745 1 129 3.30.70.1730
ID Description Score Start End GO Terms
AF-A0A3D5CD46-F1-model_v4 50S ribosomal protein L10 0.9852 6 100 GO:0003735
GO:0006412
GO:0015934
AF-A0A074TV13-F1-model_v4 deleted 0.9814 6 82
AF-A0A1E4HDP3-F1-model_v4 50S ribosomal protein L10 0.9614 1 129 GO:0003735
GO:0006412
GO:0015934
AF-A0A7C1MGM9-F1-model_v4 Large ribosomal subunit protein uL10 (50S ribosomal protein L10) 0.9604 6 109 GO:0005840
GO:1990904
AF-A0A6I2V2C9-F1-model_v4 Large ribosomal subunit protein uL10 (50S ribosomal protein L10) 0.949 1 110 GO:0005840
GO:1990904

Feature Viewer

pLDDT pTM Quality
88.4 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map