F456712

General Info

Members Datasets Scaffolds Average Seq Length
507 265 498 122

Family's Representative Sequence

Representative Sequence 3300041443|Ga0451789_0582140|Ga0451789_0582140_94_495
Length 133
Sequence MLVWSEAEQPKETTMFNELAERYIAVWNETDPQARRKAVDELYTEDARYIDPLAVAEGRDAISETIGAVQGQFPGFRFRLAGPVDGHHDQARFSWELGPEGAPAPIAGFDVAITDGQSRLRSVFGFLDRVPAG

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2671180195 Frankia sp. CcI49 Isolate Nodule
3 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
4 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
5 2773857922 Frankia sp. CcI49 Isolate Nodule
6 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
7 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
8 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
9 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
194 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
195 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
196 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
204 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
205 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
206 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
207 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
208 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
209 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
210 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
213 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
214 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
215 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
216 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
217 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
218 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
219 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
220 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
221 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
222 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
223 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
224 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
225 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
226 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
227 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
233 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
258 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
265 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 0.2
Isolates 1.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.1
Nodule 0.39
Rhizoplane 8.09
Rhizosphere 82.45
Stem 0
Stem Tuber 0
Unclassified 1.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1002483 3300000545 Bacteria 1281
2 JGI24739J22299_10027031 3300001989 Bacteria 2008
3 JGI24750J21931_1003490 3300002070 Bacteria 1882
4 JGI24748J21848_1004632 3300002074 Bacteria 1582
5 JGI24744J21845_10001047 3300002077 Bacteria 5334
6 JGI24744J21845_10006410 3300002077 Bacteria 2441
7 JGI24742J22300_10006862 3300002244 Bacteria 1877
8 Ga0070658_10248629 3300005327 Bacteria 1508
9 Ga0070658_10461863 3300005327 Bacteria 1095
10 Ga0070676_10156320 3300005328 Bacteria 1464
11 Ga0070676_10158004 3300005328 Bacteria 1457
12 Ga0070683_100570873 3300005329 Bacteria 1082
13 Ga0070670_100035787 3300005331 Bacteria 4275
14 Ga0070677_10544462 3300005333 Bacteria 635
15 Ga0068869_100014660 3300005334 Bacteria 5241
16 Ga0068869_100364543 3300005334 Bacteria 1181
17 Ga0070666_10527015 3300005335 Bacteria 858
18 Ga0070680_100099174 3300005336 Bacteria 2417
19 Ga0070680_100203961 3300005336 Bacteria 1668
20 Ga0070680_100321454 3300005336 Bacteria 1314
21 Ga0070682_100072258 3300005337 Bacteria 2211
22 Ga0070682_100110436 3300005337 Bacteria 1832
23 Ga0068868_100013777 3300005338 Bacteria 5941
24 Ga0068868_100371049 3300005338 Bacteria 1229
25 Ga0070660_100129996 3300005339 Bacteria 2014
26 Ga0070660_100546729 3300005339 Bacteria 966
27 Ga0070689_100050217 3300005340 Bacteria 3222
28 Ga0070689_100074679 3300005340 Bacteria 2653
29 Ga0070691_10014555 3300005341 Bacteria 3610
30 Ga0070691_10293687 3300005341 Bacteria 886
31 Ga0070687_100181474 3300005343 Bacteria 1261
32 Ga0070692_10169935 3300005345 Bacteria 1256
33 Ga0070668_100003753 3300005347 Bacteria 11208
34 Ga0070668_100066277 3300005347 Bacteria 2802
35 Ga0070668_100151189 3300005347 Bacteria 1877
36 Ga0070668_100520384 3300005347 Bacteria 1032
37 Ga0070668_100788745 3300005347 Bacteria 843
38 Ga0070668_101367818 3300005347 Bacteria 645
39 Ga0070669_100010231 3300005353 Bacteria 6664
40 Ga0070669_100952037 3300005353 Bacteria 735
41 Ga0070671_100679092 3300005355 Bacteria 893
42 Ga0070671_101072194 3300005355 Bacteria 707
43 Ga0070674_100016151 3300005356 Bacteria 4678
44 Ga0070674_100234565 3300005356 Bacteria 1434
45 Ga0070673_100093163 3300005364 Bacteria 2467
46 Ga0070688_100017460 3300005365 Bacteria 4119
47 Ga0070688_100091666 3300005365 Bacteria 1986
48 Ga0070659_100056881 3300005366 Bacteria 3084
49 Ga0070659_100301867 3300005366 Bacteria 1336
50 Ga0070667_100012373 3300005367 Bacteria 7058
51 Ga0070667_100111614 3300005367 Bacteria 2372
52 Ga0070667_100159921 3300005367 Bacteria 1983
53 Ga0070667_102077825 3300005367 Bacteria 535
54 Ga0070714_100118338 3300005435 Bacteria 2354
55 Ga0070714_100803992 3300005435 Bacteria 911
56 Ga0070714_101311184 3300005435 Bacteria 707
57 Ga0070713_100024986 3300005436 Bacteria 4663
58 Ga0070713_100224135 3300005436 Unclassified 1706
59 Ga0070713_100706094 3300005436 Bacteria 963
60 Ga0070713_100747217 3300005436 Bacteria 936
61 Ga0070710_10001806 3300005437 Bacteria 10112
62 Ga0070710_10007603 3300005437 Bacteria 5250
63 Ga0070710_10055817 3300005437 Bacteria 2233
64 Ga0070701_10002037 3300005438 Bacteria 7669
65 Ga0070701_10043971 3300005438 Bacteria 2287
66 Ga0070711_100001387 3300005439 Bacteria 13228
67 Ga0070711_100055229 3300005439 Bacteria 2743
68 Ga0070705_100033280 3300005440 Bacteria 2872
69 Ga0070700_100064398 3300005441 Bacteria 2321
70 Ga0070700_100229739 3300005441 Bacteria 1320
71 Ga0070694_100024605 3300005444 Bacteria 3888
72 Ga0070694_100084582 3300005444 Bacteria 2213
73 Ga0070663_100075871 3300005455 Bacteria 2458
74 Ga0070678_100002489 3300005456 Bacteria 10100
75 Ga0070678_100473825 3300005456 Bacteria 1100
76 Ga0070662_100557492 3300005457 Bacteria 961
77 Ga0070662_100603905 3300005457 Bacteria 923
78 Ga0070681_10517377 3300005458 Bacteria 1106
79 Ga0070681_11060375 3300005458 Bacteria 731
80 Ga0068867_100176515 3300005459 Bacteria 1696
81 Ga0068867_100719846 3300005459 Bacteria 882
82 Ga0070685_10490393 3300005466 Bacteria 868
83 Ga0070685_10642735 3300005466 Bacteria 768
84 Ga0070706_102078177 3300005467 Bacteria 514
85 Ga0070684_100222955 3300005535 Bacteria 1720
86 Ga0068853_100003371 3300005539 Bacteria 12227
87 Ga0068853_100308455 3300005539 Bacteria 1464
88 Ga0068853_101656140 3300005539 Bacteria 620
89 Ga0070672_100467654 3300005543 Bacteria 1088
90 Ga0070672_100643055 3300005543 Bacteria 926
91 Ga0070686_100079645 3300005544 Bacteria 2166
92 Ga0070686_100339825 3300005544 Bacteria 1125
93 Ga0070686_100430431 3300005544 Bacteria 1010
94 Ga0070695_100113737 3300005545 Bacteria 1841
95 Ga0070696_100002764 3300005546 Bacteria 11637
96 Ga0070696_100054120 3300005546 Bacteria 2796
97 Ga0070693_100111931 3300005547 Bacteria 1681
98 Ga0070665_100011105 3300005548 Bacteria 9099
99 Ga0070665_100032105 3300005548 Bacteria 5285
100 Ga0070665_100326968 3300005548 Bacteria 1537
101 Ga0070704_100005094 3300005549 Bacteria 7643
102 Ga0070704_100256485 3300005549 Bacteria 1438
103 Ga0068855_100104579 3300005563 Bacteria 3256
104 Ga0068854_100004276 3300005578 Bacteria 8996
105 Ga0068856_101655694 3300005614 Bacteria 653
106 Ga0070702_100056184 3300005615 Bacteria 2272
107 Ga0070702_100640420 3300005615 Bacteria 802
108 Ga0068852_100050509 3300005616 Bacteria 3564
109 Ga0068852_100180503 3300005616 Bacteria 1985
110 Ga0068852_101515544 3300005616 Unclassified 693
111 Ga0068859_100143502 3300005617 Bacteria 2461
112 Ga0068859_100160030 3300005617 Bacteria 2331
113 Ga0068859_100776007 3300005617 Bacteria 1047
114 Ga0068864_100279096 3300005618 Bacteria 1559
115 Ga0068864_100803449 3300005618 Bacteria 924
116 Ga0068864_100900150 3300005618 Bacteria 874
117 Ga0068866_10000565 3300005718 Bacteria 16831
118 Ga0068866_10058383 3300005718 Bacteria 1992
119 Ga0068861_100000973 3300005719 Bacteria 17463
120 Ga0068861_100219051 3300005719 Bacteria 1608
121 Ga0068861_100233425 3300005719 Bacteria 1561
122 Ga0068861_100316074 3300005719 Bacteria 1359
123 Ga0068870_10737220 3300005840 Bacteria 683
124 Ga0068863_100118298 3300005841 Bacteria 2525
125 Ga0068863_100412843 3300005841 Bacteria 1322
126 Ga0068863_102703852 3300005841 Bacteria 505
127 Ga0068858_100004674 3300005842 Bacteria 13421
128 Ga0068858_100020072 3300005842 Bacteria 6249
129 Ga0068858_101041497 3300005842 Bacteria 802
130 Ga0068860_100005325 3300005843 Bacteria 13059
131 Ga0068860_100040810 3300005843 Bacteria 4434
132 Ga0068860_100089247 3300005843 Bacteria 2935
133 Ga0068862_100182054 3300005844 Bacteria 1886
134 Ga0068862_100286832 3300005844 Bacteria 1510
135 Ga0081455_10168946 3300005937 Bacteria 1668
136 Ga0081540_1315215 3300005983 Bacteria 537
137 Ga0075365_10082689 3300006038 Bacteria 2177
138 Ga0075365_10109111 3300006038 Bacteria 1901
139 Ga0075368_10045192 3300006042 Bacteria 1739
140 Ga0075363_100003949 3300006048 Bacteria 6403
141 Ga0075363_100069442 3300006048 Bacteria 1911
142 Ga0075363_100072998 3300006048 Bacteria 1866
143 Ga0075364_10023430 3300006051 Bacteria 3909
144 Ga0075364_10037736 3300006051 Bacteria 3130
145 Ga0070715_10007514 3300006163 Bacteria 3756
146 Ga0070715_10011082 3300006163 Bacteria 3235
147 Ga0070716_100003132 3300006173 Bacteria 7730
148 Ga0070716_100016850 3300006173 Bacteria 3778
149 Ga0070716_100195107 3300006173 Bacteria 1341
150 Ga0070712_100000911 3300006175 Bacteria 17732
151 Ga0070712_100018936 3300006175 Bacteria 4481
152 Ga0070712_100149413 3300006175 Unclassified 1792
153 Ga0070712_101061140 3300006175 Bacteria 702
154 Ga0075362_10035094 3300006177 Bacteria 2188
155 Ga0075362_10096644 3300006177 Bacteria 1377
156 Ga0075367_10125359 3300006178 Bacteria 1585
157 Ga0075369_10001174 3300006186 Bacteria 8855
158 Ga0075369_10039010 3300006186 Bacteria 2027
159 Ga0075369_10068518 3300006186 Bacteria 1559
160 Ga0097621_100184725 3300006237 Bacteria 1803
161 Ga0097621_100221209 3300006237 Bacteria 1650
162 Ga0075370_10034799 3300006353 Bacteria 2824
163 Ga0075370_10052652 3300006353 Bacteria 2310
164 Ga0068871_100119139 3300006358 Bacteria 2228
165 Ga0068871_100154803 3300006358 Bacteria 1957
166 Ga0075428_100067536 3300006844 Bacteria 3912
167 Ga0075430_100038984 3300006846 Bacteria 4024
168 Ga0068865_100004101 3300006881 Bacteria 8754
169 Ga0068865_100829085 3300006881 Bacteria 800
170 Ga0097620_100143492 3300006931 Bacteria 2461
171 Ga0097620_100160026 3300006931 Bacteria 2331
172 Ga0097620_100775979 3300006931 Bacteria 1047
173 Ga0099795_10036096 3300007788 Bacteria 1732
174 Ga0105250_10015700 3300009092 Bacteria 3100
175 Ga0105250_10050262 3300009092 Bacteria 1673
176 Ga0105245_10006864 3300009098 Bacteria 9985
177 Ga0105245_10457541 3300009098 Bacteria 1286
178 Ga0105245_10906181 3300009098 Bacteria 923
179 Ga0105247_10017392 3300009101 Bacteria 4317
180 Ga0105247_10168307 3300009101 Bacteria 1455
181 Ga0114129_10036631 3300009147 Bacteria 6926
182 Ga0105243_10001473 3300009148 Bacteria 20645
183 Ga0105243_10064288 3300009148 Bacteria 2944
184 Ga0105243_10367406 3300009148 Bacteria 1326
185 Ga0105243_10436657 3300009148 Bacteria 1225
186 Ga0105241_10028680 3300009174 Bacteria 4148
187 Ga0105241_10716910 3300009174 Bacteria 914
188 Ga0105242_10008103 3300009176 Bacteria 8083
189 Ga0105242_10227962 3300009176 Bacteria 1668
190 Ga0105248_10021235 3300009177 Bacteria 7193
191 Ga0105248_10715821 3300009177 Bacteria 1130
192 Ga0105237_10519665 3300009545 Bacteria 1197
193 Ga0105238_10824177 3300009551 Bacteria 944
194 Ga0105249_10004275 3300009553 Bacteria 12344
195 Ga0105249_10048582 3300009553 Bacteria 3868
196 Ga0105249_10148814 3300009553 Bacteria 2252
197 Ga0105249_11250656 3300009553 Bacteria 814
198 Ga0105249_11528216 3300009553 Bacteria 740
199 Ga0105249_12010518 3300009553 Bacteria 651
200 Ga0099796_10000940 3300010159 Bacteria 5430
201 Ga0105239_10032691 3300010375 Bacteria 5716
202 Ga0105239_10324880 3300010375 Bacteria 1735
203 Ga0105239_13331037 3300010375 Unclassified 523
204 Ga0105246_11294507 3300011119 Bacteria 675
205 Ga0157370_10357386 3300013104 Bacteria 1346
206 Ga0157369_11249420 3300013105 Bacteria 758
207 Ga0157374_10164327 3300013296 Bacteria 2163
208 Ga0157374_10330145 3300013296 Bacteria 1513
209 Ga0157378_10007170 3300013297 Bacteria 9736
210 Ga0163162_10006580 3300013306 Bacteria 11260
211 Ga0163162_10066711 3300013306 Bacteria 3647
212 Ga0163162_10067581 3300013306 Bacteria 3624
213 Ga0163162_10332995 3300013306 Bacteria 1650
214 Ga0163162_13083170 3300013306 Bacteria 535
215 Ga0157372_10046932 3300013307 Bacteria 4797
216 Ga0157372_10521000 3300013307 Bacteria 1386
217 Ga0157375_10006350 3300013308 Bacteria 10302
218 Ga0157375_11064196 3300013308 Bacteria 946
219 Ga0157375_13046947 3300013308 Bacteria 559
220 Ga0163163_12453686 3300014325 Bacteria 580
221 Ga0157380_10004957 3300014326 Bacteria 9278
222 Ga0157380_10802222 3300014326 Bacteria 958
223 Ga0157377_10052721 3300014745 Bacteria 2297
224 Ga0157377_10325675 3300014745 Bacteria 1022
225 Ga0157379_10015673 3300014968 Bacteria 6660
226 Ga0157379_10125390 3300014968 Bacteria 2310
227 Ga0157379_11084894 3300014968 Bacteria 766
228 Ga0157376_10120907 3300014969 Bacteria 2321
229 Ga0163161_10002621 3300017792 Bacteria 12806
230 Ga0163161_10148639 3300017792 Bacteria 1779
231 Ga0163161_10683258 3300017792 Bacteria 853
232 Ga0163161_11073270 3300017792 Bacteria 691
233 Ga0206353_10210750 3300020082 Bacteria 610
234 Ga0207696_1038243 3300025711 Bacteria 1417
235 Ga0207696_1124729 3300025711 Bacteria 693
236 Ga0207653_10160600 3300025885 Bacteria 832
237 Ga0207682_10440796 3300025893 Bacteria 616
238 Ga0207692_10015837 3300025898 Bacteria 3326
239 Ga0207692_10099555 3300025898 Bacteria 1593
240 Ga0207692_10191789 3300025898 Bacteria 1196
241 Ga0207642_10000708 3300025899 Bacteria 10319
242 Ga0207710_10030989 3300025900 Bacteria 2336
243 Ga0207710_10049935 3300025900 Bacteria 1876
244 Ga0207688_10001972 3300025901 Bacteria 11002
245 Ga0207647_10034071 3300025904 Bacteria 3254
246 Ga0207647_10064065 3300025904 Bacteria 2234
247 Ga0207685_10004420 3300025905 Bacteria 3571
248 Ga0207699_10044726 3300025906 Bacteria 2579
249 Ga0207699_10747851 3300025906 Bacteria 717
250 Ga0207645_10028238 3300025907 Bacteria 3623
251 Ga0207645_10073944 3300025907 Bacteria 2182
252 Ga0207705_10547511 3300025909 Bacteria 899
253 Ga0207654_10065695 3300025911 Bacteria 2137
254 Ga0207654_10775102 3300025911 Bacteria 692
255 Ga0207707_10968476 3300025912 Bacteria 700
256 Ga0207671_10050657 3300025914 Bacteria 3075
257 Ga0207693_10000971 3300025915 Bacteria 25771
258 Ga0207693_10021145 3300025915 Bacteria 5171
259 Ga0207693_10023926 3300025915 Bacteria 4848
260 Ga0207693_10740401 3300025915 Bacteria 760
261 Ga0207663_10002738 3300025916 Bacteria 8502
262 Ga0207663_10036460 3300025916 Bacteria 2959
263 Ga0207663_10133452 3300025916 Bacteria 1719
264 Ga0207660_10247175 3300025917 Bacteria 1407
265 Ga0207662_10216687 3300025918 Bacteria 1245
266 Ga0207657_10056543 3300025919 Bacteria 3384
267 Ga0207657_10096327 3300025919 Bacteria 2461
268 Ga0207681_10010133 3300025923 Bacteria 5769
269 Ga0207694_10973189 3300025924 Bacteria 718
270 Ga0207650_10083797 3300025925 Bacteria 2422
271 Ga0207659_11137461 3300025926 Bacteria 671
272 Ga0207687_10011446 3300025927 Bacteria 5798
273 Ga0207687_10461972 3300025927 Bacteria 1054
274 Ga0207700_10002648 3300025928 Bacteria 10310
275 Ga0207700_10134012 3300025928 Bacteria 2027
276 Ga0207700_10900692 3300025928 Bacteria 792
277 Ga0207664_10090113 3300025929 Bacteria 2513
278 Ga0207664_10794195 3300025929 Bacteria 851
279 Ga0207644_10008448 3300025931 Bacteria 6738
280 Ga0207690_10071666 3300025932 Bacteria 2391
281 Ga0207690_10691341 3300025932 Bacteria 838
282 Ga0207690_10793134 3300025932 Bacteria 782
283 Ga0207706_10011396 3300025933 Bacteria 8099
284 Ga0207706_10272190 3300025933 Bacteria 1478
285 Ga0207706_10799016 3300025933 Bacteria 801
286 Ga0207686_10003058 3300025934 Bacteria 9004
287 Ga0207686_10153587 3300025934 Bacteria 1605
288 Ga0207709_10005736 3300025935 Bacteria 7013
289 Ga0207709_10357460 3300025935 Bacteria 1105
290 Ga0207709_10437715 3300025935 Bacteria 1008
291 Ga0207670_10176335 3300025936 Bacteria 1607
292 Ga0207670_10535380 3300025936 Bacteria 955
293 Ga0207669_10123560 3300025937 Bacteria 1762
294 Ga0207669_10221237 3300025937 Bacteria 1390
295 Ga0207669_10305217 3300025937 Bacteria 1211
296 Ga0207669_10448876 3300025937 Bacteria 1021
297 Ga0207704_10006477 3300025938 Bacteria 5463
298 Ga0207704_10042580 3300025938 Bacteria 2674
299 Ga0207665_10042509 3300025939 Bacteria 3038
300 Ga0207665_10056168 3300025939 Bacteria 2657
301 Ga0207691_10297056 3300025940 Bacteria 1388
302 Ga0207711_10043700 3300025941 Bacteria 3824
303 Ga0207711_10168750 3300025941 Bacteria 1985
304 Ga0207689_10001719 3300025942 Bacteria 20724
305 Ga0207689_10181326 3300025942 Bacteria 1736
306 Ga0207661_10401605 3300025944 Bacteria 1243
307 Ga0207667_10204238 3300025949 Bacteria 2027
308 Ga0207667_10595281 3300025949 Bacteria 1115
309 Ga0207651_10029750 3300025960 Bacteria 3467
310 Ga0207712_10018400 3300025961 Bacteria 4550
311 Ga0207712_10199771 3300025961 Bacteria 1585
312 Ga0207712_10447210 3300025961 Bacteria 1095
313 Ga0207712_10714284 3300025961 Bacteria 876
314 Ga0207712_10940847 3300025961 Bacteria 765
315 Ga0207668_10058876 3300025972 Bacteria 2688
316 Ga0207668_10061381 3300025972 Bacteria 2643
317 Ga0207668_10111674 3300025972 Bacteria 2052
318 Ga0207668_10627149 3300025972 Bacteria 939
319 Ga0207668_10670342 3300025972 Bacteria 909
320 Ga0207668_10739423 3300025972 Bacteria 867
321 Ga0207668_10884178 3300025972 Bacteria 794
322 Ga0207640_10062294 3300025981 Bacteria 2474
323 Ga0207658_10085018 3300025986 Bacteria 2436
324 Ga0207658_10107411 3300025986 Bacteria 2199
325 Ga0207658_10231407 3300025986 Bacteria 1560
326 Ga0207677_10058468 3300026023 Bacteria 2655
327 Ga0207677_10273985 3300026023 Bacteria 1382
328 Ga0207677_10357099 3300026023 Bacteria 1226
329 Ga0207677_10402457 3300026023 Bacteria 1161
330 Ga0207703_10136466 3300026035 Bacteria 2124
331 Ga0207703_10229849 3300026035 Bacteria 1662
332 Ga0207703_11128253 3300026035 Bacteria 753
333 Ga0207639_10009009 3300026041 Bacteria 6872
334 Ga0207639_10162544 3300026041 Bacteria 1883
335 Ga0207678_10012234 3300026067 Bacteria 7535
336 Ga0207678_10123769 3300026067 Bacteria 2207
337 Ga0207678_10442485 3300026067 Bacteria 1129
338 Ga0207708_10001627 3300026075 Bacteria 16714
339 Ga0207708_10004770 3300026075 Bacteria 9980
340 Ga0207708_10020548 3300026075 Bacteria 4980
341 Ga0207702_10589534 3300026078 Bacteria 1090
342 Ga0207641_10014725 3300026088 Bacteria 6411
343 Ga0207641_10490826 3300026088 Bacteria 1191
344 Ga0207641_10508286 3300026088 Unclassified 1171
345 Ga0207648_10008258 3300026089 Bacteria 10107
346 Ga0207648_10029818 3300026089 Bacteria 4837
347 Ga0207648_10075000 3300026089 Bacteria 2949
348 Ga0207676_10296636 3300026095 Bacteria 1474
349 Ga0207676_10676603 3300026095 Bacteria 998
350 Ga0207676_11700052 3300026095 Bacteria 629
351 Ga0207675_100003328 3300026118 Bacteria 15736
352 Ga0207675_100008751 3300026118 Bacteria 9508
353 Ga0207675_100028291 3300026118 Bacteria 5219
354 Ga0207675_100120644 3300026118 Bacteria 2480
355 Ga0207683_10000571 3300026121 Bacteria 34106
356 Ga0207683_10469740 3300026121 Bacteria 1160
357 Ga0207683_10791062 3300026121 Bacteria 880
358 Ga0207683_11467566 3300026121 Bacteria 630
359 Ga0207698_10513518 3300026142 Bacteria 1168
360 Ga0209813_10106451 3300027866 Bacteria 961
361 Ga0268266_10014417 3300028379 Bacteria 6795
362 Ga0268266_10024364 3300028379 Bacteria 5147
363 Ga0268266_10102957 3300028379 Bacteria 2519
364 Ga0268265_10017387 3300028380 Bacteria 4961
365 Ga0268265_10391030 3300028380 Bacteria 1282
366 Ga0268264_10111151 3300028381 Bacteria 2400
367 Ga0268264_10417617 3300028381 Bacteria 1293
368 Ga0268264_11559088 3300028381 Bacteria 671
369 Ga0268264_12304912 3300028381 Bacteria 545
370 Ga0307515_10114399 3300028794 Bacteria 3119
371 Ga0307513_10000354 3300031456 Bacteria 66910
372 Ga0307508_10342751 3300031616 Bacteria 1086
373 Ga0307413_10855224 3300031824 Bacteria 769
374 Ga0307413_11699927 3300031824 Bacteria 563
375 Ga0307413_11822437 3300031824 Unclassified 545
376 Ga0307416_100885944 3300032002 Bacteria 992
377 Ga0307411_11591568 3300032005 Bacteria 603
378 Ga0307415_102144663 3300032126 Bacteria 546
379 Ga0373929_0046374 3300035085 Bacteria 982
380 Ga0373952_0171962 3300035092 Bacteria 620
381 Ga0373939_0005508 3300035114 Bacteria 3019
382 Ga0373942_0141885 3300035207 Bacteria 765
383 Ga0373961_0043568 3300035241 Bacteria 1306
384 Ga0373931_0012994 3300035691 Bacteria 4045
385 Ga0373931_0043249 3300035691 Bacteria 2371
386 Ga0373927_0267921 3300035695 Bacteria 1123
387 Ga0395900_0909367 3300037418 Bacteria 803
388 Ga0395898_0949684 3300037466 Bacteria 797
389 Ga0395901_0005856 3300038443 Bacteria 12433
390 Ga0439461_0002815 3300041410 Bacteria 2815
391 Ga0439461_0050530 3300041410 Bacteria 921
392 Ga0439466_0019001 3300041411 Bacteria 2461
393 Ga0439465_0002395 3300041413 Bacteria 6136
394 Ga0439465_0073610 3300041413 Bacteria 1148
395 Ga0451789_0582140 3300041443 Bacteria 763
396 Ga0451791_0022331 3300041451 Bacteria 1019
397 Ga0451797_0325563 3300041453 Bacteria 1275
398 Ga0451845_0137376 3300041501 Bacteria 890
399 Ga0451849_1158843 3300041505 Bacteria 794
400 Ga0451853_1626027 3300041512 Bacteria 792
401 Ga0439431_0004858 3300041997 Bacteria 2963
402 Ga0439431_0066387 3300041997 Bacteria 956
403 Ga0439442_014859 3300042002 Bacteria 1603
404 Ga0439442_038236 3300042002 Bacteria 1006
405 Ga0439445_0027307 3300042004 Bacteria 1465
406 Ga0439463_055358 3300042016 Bacteria 1013
407 Ga0450902_096824 3300042137 Bacteria 523
408 Ga0439434_0023835 3300042435 Bacteria 1843
409 Ga0439435_0182950 3300042436 Bacteria 685
410 Ga0439464_0141001 3300042439 Bacteria 750
411 Ga0466972_0050280 3300044658 Bacteria 2012
412 Ga0466972_0104722 3300044658 Bacteria 1338
413 Ga0466965_0081076 3300044683 Bacteria 1640
414 Ga0466965_0407873 3300044683 Bacteria 752
415 Ga0466966_0206740 3300044684 Bacteria 1187
416 Ga0466961_0083977 3300044693 Bacteria 2014
417 Ga0466963_0550539 3300044694 Bacteria 815
418 Ga0466963_0598913 3300044694 Bacteria 778
419 Ga0466964_0727946 3300044706 Bacteria 555
420 Ga0466968_0069410 3300044735 Bacteria 1532
421 Ga0466970_0260156 3300044765 Bacteria 973
422 Ga0466970_0632831 3300044765 Bacteria 622
423 Ga0466970_0775097 3300044765 Bacteria 561
424 Ga0466957_0112079 3300044842 Bacteria 1731
425 Ga0466960_0200160 3300044901 Bacteria 1091
426 Ga0466960_0897424 3300044901 Bacteria 540
427 Ga0466959_0073304 3300045049 Bacteria 2477
428 Ga0466959_0103208 3300045049 Bacteria 2040
429 Ga0466967_0156171 3300045976 Bacteria 2137
430 Ga0466967_0213049 3300045976 Bacteria 1833
431 Ga0466967_0594308 3300045976 Bacteria 1092
432 Ga0495650_0021630 3300046471 Bacteria 3102
433 Ga0495683_0222544 3300047323 Bacteria 841
434 Ga0496100_0008800 3300048903 Bacteria 5645
435 Ga0496100_0585565 3300048903 Bacteria 865
436 Ga0496101_0049335 3300048904 Bacteria 3028
437 Ga0496101_0771503 3300048904 Bacteria 758
438 Ga0496102_0007262 3300048905 Bacteria 9458
439 Ga0496102_0007888 3300048905 Bacteria 9096
440 Ga0496102_0148473 3300048905 Bacteria 2201
441 Ga0496102_0318840 3300048905 Bacteria 1464
442 Ga0496102_0954322 3300048905 Bacteria 778
443 Ga0496103_0003214 3300048906 Bacteria 10020
444 Ga0496103_0081091 3300048906 Bacteria 2041
445 Ga0496103_0358811 3300048906 Bacteria 937
446 Ga0496104_0028273 3300048907 Bacteria 5197
447 Ga0496104_0354999 3300048907 Bacteria 1379
448 Ga0496105_0087658 3300048908 Bacteria 2572
449 Ga0496105_0267449 3300048908 Bacteria 1381
450 Ga0496106_0002557 3300048909 Bacteria 13524
451 Ga0496106_0200908 3300048909 Bacteria 1586
452 Ga0496107_0005329 3300048910 Bacteria 8792
453 Ga0496107_1381850 3300048910 Bacteria 502
454 Ga0496108_0000457 3300048911 Bacteria 32650
455 Ga0496108_0573778 3300048911 Bacteria 983
456 Ga0496109_0009547 3300048912 Bacteria 8269
457 Ga0496109_0033243 3300048912 Bacteria 4639
458 Ga0496109_0230257 3300048912 Bacteria 1743
459 Ga0496110_0012624 3300048913 Bacteria 6949
460 Ga0496110_0307017 3300048913 Bacteria 1445
461 Ga0496111_0023251 3300048914 Bacteria 4351
462 Ga0496112_0007283 3300048915 Bacteria 9806
463 Ga0496112_0053102 3300048915 Bacteria 3979
464 Ga0496112_0538513 3300048915 Bacteria 1102
465 Ga0496113_0045656 3300048916 Bacteria 3250
466 Ga0496113_0074281 3300048916 Bacteria 2592
467 Ga0496113_0698166 3300048916 Bacteria 810
468 Ga0496114_0002825 3300048917 Bacteria 13311
469 Ga0496114_0983117 3300048917 Bacteria 727
470 Ga0496115_0000532 3300048918 Bacteria 29685
471 Ga0496115_0189244 3300048918 Bacteria 1700
472 Ga0496118_0201352 3300048921 Bacteria 1179
473 Ga0501034_0352727 3300049571 Bacteria 1399
474 Ga0501067_0191273 3300049583 Bacteria 1140
475 nmdc:mga03683_135793_c1 3300050489 Bacteria 1103
476 nmdc:mga03683_43893_c1 3300050489 Bacteria 1846
477 nmdc:mga03n38_242426_c1 3300050490 Bacteria 949
478 nmdc:mga03n38_259135_c1 3300050490 Bacteria 921
479 nmdc:mga03n38_264652_c1 3300050490 Bacteria 913
480 nmdc:mga00v17_115897_c1 3300050491 Bacteria 1703
481 nmdc:mga00v17_28677_c1 3300050491 Bacteria 3262
482 nmdc:mga00v17_565105_c1 3300050491 Bacteria 735
483 nmdc:mga0yw44_115188_c1 3300050492 Bacteria 1726
484 nmdc:mga0yw44_43799_c1 3300050492 Bacteria 2674
485 nmdc:mga06z11_139075_c1 3300050494 Bacteria 1371
486 nmdc:mga06z11_520115_c1 3300050494 Bacteria 721
487 nmdc:mga07m45_145499_c1 3300050496 Bacteria 1374
488 nmdc:mga05p37_8977_c1 3300050507 Bacteria 11822
489 nmdc:mga0qj67_36059_c1 3300050509 Bacteria 3868
490 nmdc:mga0qj67_96709_c1 3300050509 Bacteria 2377
491 nmdc:mga08y16_1093735_c1 3300050511 Bacteria 772
492 nmdc:mga0sz30_20468_c1 3300050516 Bacteria 2669
493 nmdc:mga0sz30_205643_c1 3300050516 Bacteria 874
494 nmdc:mga0sz30_21808_c1 3300050516 Bacteria 2595
495 nmdc:mga0sz30_2189_c1 3300050516 Bacteria 6987
496 Ga0500616_0023893 3300053153 Bacteria 3401
497 Ga0500616_0034291 3300053153 Bacteria 2765
498 Ga0466962_0273408 3300061719 Bacteria 833

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041453 Ga0451797_0325563 Ga0451797_0325563_576_935 114
2 3300050490 nmdc:mga03n38_259135_c1 nmdc:mga03n38_259135_c1_555_905 116
3 iso_pu_bacteria 2738543011 2739239461 116
4 iso_pu_bacteria 2889300758 2889301879 116
5 iso_pu_bacteria 2939743619 2939747121 116
6 3300005336 Ga0070680_100099174 Ga0070680_1000991742 117
7 3300005458 Ga0070681_10517377 Ga0070681_105173771 117
8 3300005535 Ga0070684_100222955 Ga0070684_1002229552 117
9 3300020082 Ga0206353_10210750 Ga0206353_102107501 117
10 iso_pu_bacteria 2515154155 2515856917 118
11 iso_pu_bacteria 2929219909 2929224094 118
12 3300005347 Ga0070668_100788745 Ga0070668_1007887452 119
13 3300025972 Ga0207668_10739423 Ga0207668_107394231 119
14 3300031456 Ga0307513_10000354 Ga0307513_100003541 119
15 iso_pu_bacteria 2675903059 2676485211 119
16 3300005327 Ga0070658_10461863 Ga0070658_104618632 120
17 3300005329 Ga0070683_100570873 Ga0070683_1005708731 120
18 3300005336 Ga0070680_100321454 Ga0070680_1003214542 120
19 3300005337 Ga0070682_100072258 Ga0070682_1000722582 120
20 3300005339 Ga0070660_100546729 Ga0070660_1005467292 120
21 3300005539 Ga0068853_101656140 Ga0068853_1016561401 120
22 3300005614 Ga0068856_101655694 Ga0068856_1016556941 120
23 3300005618 Ga0068864_100900150 Ga0068864_1009001502 120
24 3300009148 Ga0105243_10001473 Ga0105243_1000147316 120
25 3300009551 Ga0105238_10824177 Ga0105238_108241772 120
26 3300025909 Ga0207705_10547511 Ga0207705_105475112 120
27 3300025924 Ga0207694_10973189 Ga0207694_109731891 120
28 3300025935 Ga0207709_10005736 Ga0207709_100057364 120
29 3300025944 Ga0207661_10401605 Ga0207661_104016052 120
30 3300026067 Ga0207678_10442485 Ga0207678_104424851 120
31 3300031824 Ga0307413_10855224 Ga0307413_108552241 120
32 3300037418 Ga0395900_0909367 Ga0395900_0909367_82_444 120
33 3300037466 Ga0395898_0949684 Ga0395898_0949684_301_663 120
34 3300038443 Ga0395901_0005856 Ga0395901_0005856_4879_5241 120
35 3300044683 Ga0466965_0081076 Ga0466965_0081076_836_1198 120
36 3300044683 Ga0466965_0407873 Ga0466965_0407873_276_638 120
37 3300044684 Ga0466966_0206740 Ga0466966_0206740_70_432 120
38 3300044693 Ga0466961_0083977 Ga0466961_0083977_893_1255 120
39 3300044694 Ga0466963_0598913 Ga0466963_0598913_390_752 120
40 3300044706 Ga0466964_0727946 Ga0466964_0727946_150_512 120
41 3300044765 Ga0466970_0632831 Ga0466970_0632831_238_600 120
42 3300044842 Ga0466957_0112079 Ga0466957_0112079_484_846 120
43 3300044901 Ga0466960_0200160 Ga0466960_0200160_189_560 120
44 3300045049 Ga0466959_0103208 Ga0466959_0103208_341_703 120
45 3300045976 Ga0466967_0156171 Ga0466967_0156171_157_519 120
46 3300045976 Ga0466967_0594308 Ga0466967_0594308_528_890 120
47 3300005327 Ga0070658_10248629 Ga0070658_102486292 121
48 3300005347 Ga0070668_100066277 Ga0070668_1000662773 121
49 3300005435 Ga0070714_101311184 Ga0070714_1013111841 121
50 3300005436 Ga0070713_100224135 Ga0070713_1002241353 121
51 3300005436 Ga0070713_100706094 Ga0070713_1007060943 121
52 3300005437 Ga0070710_10007603 Ga0070710_100076034 121
53 3300005616 Ga0068852_101515544 Ga0068852_1015155442 121
54 3300005719 Ga0068861_100219051 Ga0068861_1002190512 121
55 3300005840 Ga0068870_10737220 Ga0068870_107372201 121
56 3300005983 Ga0081540_1315215 Ga0081540_13152151 121
57 3300006173 Ga0070716_100195107 Ga0070716_1001951073 121
58 3300006175 Ga0070712_100149413 Ga0070712_1001494132 121
59 3300006358 Ga0068871_100154803 Ga0068871_1001548032 121
60 3300006844 Ga0075428_100067536 Ga0075428_1000675364 121
61 3300006846 Ga0075430_100038984 Ga0075430_1000389842 121
62 3300007788 Ga0099795_10036096 Ga0099795_100360963 121
63 3300009098 Ga0105245_10906181 Ga0105245_109061812 121
64 3300009147 Ga0114129_10036631 Ga0114129_100366314 121
65 3300009553 Ga0105249_11250656 Ga0105249_112506562 121
66 3300010159 Ga0099796_10000940 Ga0099796_100009406 121
67 3300010375 Ga0105239_13331037 Ga0105239_133310371 121
68 3300013105 Ga0157369_11249420 Ga0157369_112494201 121
69 3300013306 Ga0163162_10066711 Ga0163162_100667113 121
70 3300017792 Ga0163161_10148639 Ga0163161_101486395 121
71 3300025898 Ga0207692_10099555 Ga0207692_100995552 121
72 3300025915 Ga0207693_10021145 Ga0207693_100211456 121
73 3300025919 Ga0207657_10056543 Ga0207657_100565434 121
74 3300025928 Ga0207700_10002648 Ga0207700_100026487 121
75 3300025929 Ga0207664_10090113 Ga0207664_100901133 121
76 3300025933 Ga0207706_10799016 Ga0207706_107990161 121
77 3300025961 Ga0207712_10447210 Ga0207712_104472101 121
78 3300025972 Ga0207668_10884178 Ga0207668_108841781 121
79 3300026088 Ga0207641_10508286 Ga0207641_105082862 121
80 3300026118 Ga0207675_100028291 Ga0207675_1000282913 121
81 3300028794 Ga0307515_10114399 Ga0307515_101143992 121
82 3300031616 Ga0307508_10342751 Ga0307508_103427512 121
83 3300031824 Ga0307413_11822437 Ga0307413_118224372 121
84 3300041443 Ga0451789_0582140 Ga0451789_0582140_94_495 121
85 3300041451 Ga0451791_0022331 Ga0451791_0022331_458_829 121
86 3300044658 Ga0466972_0050280 Ga0466972_0050280_87_452 121
87 3300044735 Ga0466968_0069410 Ga0466968_0069410_898_1263 121
88 3300044765 Ga0466970_0775097 Ga0466970_0775097_118_492 121
89 3300045049 Ga0466959_0073304 Ga0466959_0073304_1905_2270 121
90 3300046471 Ga0495650_0021630 Ga0495650_0021630_882_1247 121
91 3300050507 nmdc:mga05p37_8977_c1 nmdc:mga05p37_8977_c1_7961_8326 121
92 3300050509 nmdc:mga0qj67_36059_c1 nmdc:mga0qj67_36059_c1_2457_2822 121
93 3300061719 Ga0466962_0273408 Ga0466962_0273408_160_534 121
94 iso_pu_bacteria 8023623736 8023624566 121
95 3300000545 CNXas_1002483 CNXas_10024832 122
96 3300001989 JGI24739J22299_10027031 JGI24739J22299_100270312 122
97 3300002070 JGI24750J21931_1003490 JGI24750J21931_10034904 122
98 3300002074 JGI24748J21848_1004632 JGI24748J21848_10046321 122
99 3300002077 JGI24744J21845_10001047 JGI24744J21845_100010472 122
100 3300002077 JGI24744J21845_10006410 JGI24744J21845_100064102 122
101 3300002244 JGI24742J22300_10006862 JGI24742J22300_100068622 122
102 3300005328 Ga0070676_10156320 Ga0070676_101563202 122
103 3300005328 Ga0070676_10158004 Ga0070676_101580042 122
104 3300005331 Ga0070670_100035787 Ga0070670_1000357873 122
105 3300005333 Ga0070677_10544462 Ga0070677_105444621 122
106 3300005334 Ga0068869_100014660 Ga0068869_1000146604 122
107 3300005334 Ga0068869_100364543 Ga0068869_1003645433 122
108 3300005335 Ga0070666_10527015 Ga0070666_105270151 122
109 3300005336 Ga0070680_100203961 Ga0070680_1002039613 122
110 3300005337 Ga0070682_100110436 Ga0070682_1001104361 122
111 3300005338 Ga0068868_100013777 Ga0068868_1000137774 122
112 3300005338 Ga0068868_100371049 Ga0068868_1003710492 122
113 3300005339 Ga0070660_100129996 Ga0070660_1001299963 122
114 3300005340 Ga0070689_100050217 Ga0070689_1000502175 122
115 3300005340 Ga0070689_100074679 Ga0070689_1000746793 122
116 3300005341 Ga0070691_10014555 Ga0070691_100145555 122
117 3300005341 Ga0070691_10293687 Ga0070691_102936872 122
118 3300005343 Ga0070687_100181474 Ga0070687_1001814743 122
119 3300005345 Ga0070692_10169935 Ga0070692_101699351 122
120 3300005347 Ga0070668_100003753 Ga0070668_10000375310 122
121 3300005347 Ga0070668_100151189 Ga0070668_1001511893 122
122 3300005347 Ga0070668_100520384 Ga0070668_1005203841 122
123 3300005347 Ga0070668_101367818 Ga0070668_1013678182 122
124 3300005353 Ga0070669_100010231 Ga0070669_1000102319 122
125 3300005353 Ga0070669_100952037 Ga0070669_1009520371 122
126 3300005355 Ga0070671_100679092 Ga0070671_1006790922 122
127 3300005355 Ga0070671_101072194 Ga0070671_1010721941 122
128 3300005356 Ga0070674_100016151 Ga0070674_1000161512 122
129 3300005356 Ga0070674_100234565 Ga0070674_1002345652 122
130 3300005364 Ga0070673_100093163 Ga0070673_1000931633 122
131 3300005365 Ga0070688_100017460 Ga0070688_1000174602 122
132 3300005365 Ga0070688_100091666 Ga0070688_1000916664 122
133 3300005366 Ga0070659_100056881 Ga0070659_1000568812 122
134 3300005366 Ga0070659_100301867 Ga0070659_1003018673 122
135 3300005367 Ga0070667_100012373 Ga0070667_1000123733 122
136 3300005367 Ga0070667_100111614 Ga0070667_1001116142 122
137 3300005367 Ga0070667_100159921 Ga0070667_1001599214 122
138 3300005367 Ga0070667_102077825 Ga0070667_1020778251 122
139 3300005435 Ga0070714_100118338 Ga0070714_1001183383 122
140 3300005435 Ga0070714_100803992 Ga0070714_1008039922 122
141 3300005436 Ga0070713_100024986 Ga0070713_1000249863 122
142 3300005436 Ga0070713_100747217 Ga0070713_1007472172 122
143 3300005437 Ga0070710_10001806 Ga0070710_100018062 122
144 3300005437 Ga0070710_10055817 Ga0070710_100558172 122
145 3300005438 Ga0070701_10002037 Ga0070701_100020376 122
146 3300005438 Ga0070701_10043971 Ga0070701_100439713 122
147 3300005439 Ga0070711_100001387 Ga0070711_1000013874 122
148 3300005439 Ga0070711_100055229 Ga0070711_1000552293 122
149 3300005440 Ga0070705_100033280 Ga0070705_1000332803 122
150 3300005441 Ga0070700_100064398 Ga0070700_1000643983 122
151 3300005441 Ga0070700_100229739 Ga0070700_1002297392 122
152 3300005444 Ga0070694_100024605 Ga0070694_1000246055 122
153 3300005444 Ga0070694_100084582 Ga0070694_1000845823 122
154 3300005455 Ga0070663_100075871 Ga0070663_1000758713 122
155 3300005456 Ga0070678_100002489 Ga0070678_1000024892 122
156 3300005456 Ga0070678_100473825 Ga0070678_1004738252 122
157 3300005457 Ga0070662_100557492 Ga0070662_1005574922 122
158 3300005457 Ga0070662_100603905 Ga0070662_1006039052 122
159 3300005458 Ga0070681_11060375 Ga0070681_110603752 122
160 3300005459 Ga0068867_100176515 Ga0068867_1001765152 122
161 3300005459 Ga0068867_100719846 Ga0068867_1007198462 122
162 3300005466 Ga0070685_10490393 Ga0070685_104903932 122
163 3300005466 Ga0070685_10642735 Ga0070685_106427352 122
164 3300005467 Ga0070706_102078177 Ga0070706_1020781771 122
165 3300005539 Ga0068853_100003371 Ga0068853_1000033715 122
166 3300005539 Ga0068853_100308455 Ga0068853_1003084553 122
167 3300005543 Ga0070672_100467654 Ga0070672_1004676542 122
168 3300005543 Ga0070672_100643055 Ga0070672_1006430551 122
169 3300005544 Ga0070686_100079645 Ga0070686_1000796452 122
170 3300005544 Ga0070686_100339825 Ga0070686_1003398251 122
171 3300005544 Ga0070686_100430431 Ga0070686_1004304312 122
172 3300005545 Ga0070695_100113737 Ga0070695_1001137372 122
173 3300005546 Ga0070696_100002764 Ga0070696_1000027642 122
174 3300005546 Ga0070696_100054120 Ga0070696_1000541203 122
175 3300005547 Ga0070693_100111931 Ga0070693_1001119312 122
176 3300005548 Ga0070665_100011105 Ga0070665_1000111059 122
177 3300005548 Ga0070665_100032105 Ga0070665_1000321056 122
178 3300005548 Ga0070665_100326968 Ga0070665_1003269683 122
179 3300005549 Ga0070704_100005094 Ga0070704_1000050944 122
180 3300005549 Ga0070704_100256485 Ga0070704_1002564853 122
181 3300005563 Ga0068855_100104579 Ga0068855_1001045792 122
182 3300005578 Ga0068854_100004276 Ga0068854_1000042762 122
183 3300005615 Ga0070702_100056184 Ga0070702_1000561843 122
184 3300005615 Ga0070702_100640420 Ga0070702_1006404201 122
185 3300005616 Ga0068852_100050509 Ga0068852_1000505092 122
186 3300005616 Ga0068852_100180503 Ga0068852_1001805032 122
187 3300005617 Ga0068859_100143502 Ga0068859_1001435022 122
188 3300005617 Ga0068859_100160030 Ga0068859_1001600302 122
189 3300005617 Ga0068859_100776007 Ga0068859_1007760071 122
190 3300005618 Ga0068864_100279096 Ga0068864_1002790962 122
191 3300005618 Ga0068864_100803449 Ga0068864_1008034491 122
192 3300005718 Ga0068866_10000565 Ga0068866_100005652 122
193 3300005718 Ga0068866_10058383 Ga0068866_100583833 122
194 3300005719 Ga0068861_100000973 Ga0068861_1000009739 122
195 3300005719 Ga0068861_100233425 Ga0068861_1002334252 122
196 3300005719 Ga0068861_100316074 Ga0068861_1003160742 122
197 3300005841 Ga0068863_100118298 Ga0068863_1001182984 122
198 3300005841 Ga0068863_100412843 Ga0068863_1004128431 122
199 3300005841 Ga0068863_102703852 Ga0068863_1027038521 122
200 3300005842 Ga0068858_100004674 Ga0068858_10000467410 122
201 3300005842 Ga0068858_100020072 Ga0068858_1000200725 122
202 3300005842 Ga0068858_101041497 Ga0068858_1010414972 122
203 3300005843 Ga0068860_100005325 Ga0068860_10000532512 122
204 3300005843 Ga0068860_100040810 Ga0068860_1000408102 122
205 3300005843 Ga0068860_100089247 Ga0068860_1000892472 122
206 3300005844 Ga0068862_100182054 Ga0068862_1001820544 122
207 3300005844 Ga0068862_100286832 Ga0068862_1002868321 122
208 3300005937 Ga0081455_10168946 Ga0081455_101689462 122
209 3300006038 Ga0075365_10082689 Ga0075365_100826892 122
210 3300006038 Ga0075365_10109111 Ga0075365_101091113 122
211 3300006042 Ga0075368_10045192 Ga0075368_100451922 122
212 3300006048 Ga0075363_100003949 Ga0075363_1000039495 122
213 3300006048 Ga0075363_100069442 Ga0075363_1000694424 122
214 3300006048 Ga0075363_100072998 Ga0075363_1000729983 122
215 3300006051 Ga0075364_10023430 Ga0075364_100234304 122
216 3300006051 Ga0075364_10037736 Ga0075364_100377365 122
217 3300006163 Ga0070715_10007514 Ga0070715_100075144 122
218 3300006163 Ga0070715_10011082 Ga0070715_100110823 122
219 3300006173 Ga0070716_100003132 Ga0070716_1000031324 122
220 3300006173 Ga0070716_100016850 Ga0070716_1000168505 122
221 3300006175 Ga0070712_100000911 Ga0070712_10000091110 122
222 3300006175 Ga0070712_100018936 Ga0070712_1000189362 122
223 3300006175 Ga0070712_101061140 Ga0070712_1010611401 122
224 3300006177 Ga0075362_10035094 Ga0075362_100350944 122
225 3300006177 Ga0075362_10096644 Ga0075362_100966442 122
226 3300006178 Ga0075367_10125359 Ga0075367_101253592 122
227 3300006186 Ga0075369_10001174 Ga0075369_1000117410 122
228 3300006186 Ga0075369_10039010 Ga0075369_100390104 122
229 3300006186 Ga0075369_10068518 Ga0075369_100685183 122
230 3300006237 Ga0097621_100184725 Ga0097621_1001847253 122
231 3300006237 Ga0097621_100221209 Ga0097621_1002212093 122
232 3300006353 Ga0075370_10034799 Ga0075370_100347992 122
233 3300006353 Ga0075370_10052652 Ga0075370_100526521 122
234 3300006358 Ga0068871_100119139 Ga0068871_1001191393 122
235 3300006881 Ga0068865_100004101 Ga0068865_1000041012 122
236 3300006881 Ga0068865_100829085 Ga0068865_1008290852 122
237 3300006931 Ga0097620_100143492 Ga0097620_1001434922 122
238 3300006931 Ga0097620_100160026 Ga0097620_1001600262 122
239 3300006931 Ga0097620_100775979 Ga0097620_1007759792 122
240 3300009092 Ga0105250_10015700 Ga0105250_100157005 122
241 3300009092 Ga0105250_10050262 Ga0105250_100502622 122
242 3300009098 Ga0105245_10006864 Ga0105245_1000686412 122
243 3300009098 Ga0105245_10457541 Ga0105245_104575412 122
244 3300009101 Ga0105247_10017392 Ga0105247_100173924 122
245 3300009101 Ga0105247_10168307 Ga0105247_101683072 122
246 3300009148 Ga0105243_10064288 Ga0105243_100642884 122
247 3300009148 Ga0105243_10367406 Ga0105243_103674062 122
248 3300009148 Ga0105243_10436657 Ga0105243_104366571 122
249 3300009174 Ga0105241_10028680 Ga0105241_100286802 122
250 3300009174 Ga0105241_10716910 Ga0105241_107169102 122
251 3300009176 Ga0105242_10008103 Ga0105242_1000810311 122
252 3300009176 Ga0105242_10227962 Ga0105242_102279624 122
253 3300009177 Ga0105248_10021235 Ga0105248_100212356 122
254 3300009177 Ga0105248_10715821 Ga0105248_107158212 122
255 3300009545 Ga0105237_10519665 Ga0105237_105196653 122
256 3300009553 Ga0105249_10004275 Ga0105249_100042754 122
257 3300009553 Ga0105249_10048582 Ga0105249_100485822 122
258 3300009553 Ga0105249_10148814 Ga0105249_101488143 122
259 3300009553 Ga0105249_11528216 Ga0105249_115282162 122
260 3300009553 Ga0105249_12010518 Ga0105249_120105181 122
261 3300010375 Ga0105239_10032691 Ga0105239_100326915 122
262 3300010375 Ga0105239_10324880 Ga0105239_103248802 122
263 3300011119 Ga0105246_11294507 Ga0105246_112945072 122
264 3300013104 Ga0157370_10357386 Ga0157370_103573863 122
265 3300013296 Ga0157374_10164327 Ga0157374_101643273 122
266 3300013296 Ga0157374_10330145 Ga0157374_103301452 122
267 3300013297 Ga0157378_10007170 Ga0157378_100071702 122
268 3300013306 Ga0163162_10006580 Ga0163162_1000658010 122
269 3300013306 Ga0163162_10067581 Ga0163162_100675814 122
270 3300013306 Ga0163162_10332995 Ga0163162_103329952 122
271 3300013306 Ga0163162_13083170 Ga0163162_130831701 122
272 3300013307 Ga0157372_10046932 Ga0157372_100469322 122
273 3300013307 Ga0157372_10521000 Ga0157372_105210003 122
274 3300013308 Ga0157375_10006350 Ga0157375_1000635012 122
275 3300013308 Ga0157375_11064196 Ga0157375_110641962 122
276 3300013308 Ga0157375_13046947 Ga0157375_130469471 122
277 3300014325 Ga0163163_12453686 Ga0163163_124536862 122
278 3300014326 Ga0157380_10004957 Ga0157380_100049573 122
279 3300014326 Ga0157380_10802222 Ga0157380_108022221 122
280 3300014745 Ga0157377_10052721 Ga0157377_100527212 122
281 3300014745 Ga0157377_10325675 Ga0157377_103256752 122
282 3300014968 Ga0157379_10015673 Ga0157379_100156738 122
283 3300014968 Ga0157379_10125390 Ga0157379_101253904 122
284 3300014968 Ga0157379_11084894 Ga0157379_110848942 122
285 3300014969 Ga0157376_10120907 Ga0157376_101209072 122
286 3300017792 Ga0163161_10002621 Ga0163161_1000262112 122
287 3300017792 Ga0163161_10683258 Ga0163161_106832582 122
288 3300017792 Ga0163161_11073270 Ga0163161_110732702 122
289 3300025711 Ga0207696_1038243 Ga0207696_10382433 122
290 3300025711 Ga0207696_1124729 Ga0207696_11247292 122
291 3300025885 Ga0207653_10160600 Ga0207653_101606002 122
292 3300025893 Ga0207682_10440796 Ga0207682_104407962 122
293 3300025898 Ga0207692_10015837 Ga0207692_100158374 122
294 3300025898 Ga0207692_10191789 Ga0207692_101917892 122
295 3300025899 Ga0207642_10000708 Ga0207642_100007084 122
296 3300025900 Ga0207710_10030989 Ga0207710_100309893 122
297 3300025900 Ga0207710_10049935 Ga0207710_100499352 122
298 3300025901 Ga0207688_10001972 Ga0207688_100019724 122
299 3300025904 Ga0207647_10034071 Ga0207647_100340712 122
300 3300025904 Ga0207647_10064065 Ga0207647_100640652 122
301 3300025905 Ga0207685_10004420 Ga0207685_100044202 122
302 3300025906 Ga0207699_10044726 Ga0207699_100447262 122
303 3300025906 Ga0207699_10747851 Ga0207699_107478512 122
304 3300025907 Ga0207645_10028238 Ga0207645_100282382 122
305 3300025907 Ga0207645_10073944 Ga0207645_100739443 122
306 3300025911 Ga0207654_10065695 Ga0207654_100656952 122
307 3300025911 Ga0207654_10775102 Ga0207654_107751022 122
308 3300025912 Ga0207707_10968476 Ga0207707_109684762 122
309 3300025914 Ga0207671_10050657 Ga0207671_100506575 122
310 3300025915 Ga0207693_10000971 Ga0207693_1000097112 122
311 3300025915 Ga0207693_10023926 Ga0207693_100239265 122
312 3300025915 Ga0207693_10740401 Ga0207693_107404011 122
313 3300025916 Ga0207663_10002738 Ga0207663_100027386 122
314 3300025916 Ga0207663_10036460 Ga0207663_100364603 122
315 3300025916 Ga0207663_10133452 Ga0207663_101334522 122
316 3300025917 Ga0207660_10247175 Ga0207660_102471753 122
317 3300025918 Ga0207662_10216687 Ga0207662_102166873 122
318 3300025919 Ga0207657_10096327 Ga0207657_100963272 122
319 3300025923 Ga0207681_10010133 Ga0207681_100101332 122
320 3300025925 Ga0207650_10083797 Ga0207650_100837972 122
321 3300025926 Ga0207659_11137461 Ga0207659_111374611 122
322 3300025927 Ga0207687_10011446 Ga0207687_100114464 122
323 3300025927 Ga0207687_10461972 Ga0207687_104619722 122
324 3300025928 Ga0207700_10134012 Ga0207700_101340121 122
325 3300025928 Ga0207700_10900692 Ga0207700_109006922 122
326 3300025929 Ga0207664_10794195 Ga0207664_107941952 122
327 3300025931 Ga0207644_10008448 Ga0207644_100084485 122
328 3300025932 Ga0207690_10071666 Ga0207690_100716665 122
329 3300025932 Ga0207690_10691341 Ga0207690_106913412 122
330 3300025932 Ga0207690_10793134 Ga0207690_107931341 122
331 3300025933 Ga0207706_10011396 Ga0207706_100113963 122
332 3300025933 Ga0207706_10272190 Ga0207706_102721903 122
333 3300025934 Ga0207686_10003058 Ga0207686_100030588 122
334 3300025934 Ga0207686_10153587 Ga0207686_101535871 122
335 3300025935 Ga0207709_10357460 Ga0207709_103574602 122
336 3300025935 Ga0207709_10437715 Ga0207709_104377152 122
337 3300025936 Ga0207670_10176335 Ga0207670_101763352 122
338 3300025936 Ga0207670_10535380 Ga0207670_105353802 122
339 3300025937 Ga0207669_10123560 Ga0207669_101235602 122
340 3300025937 Ga0207669_10221237 Ga0207669_102212372 122
341 3300025937 Ga0207669_10305217 Ga0207669_103052171 122
342 3300025937 Ga0207669_10448876 Ga0207669_104488762 122
343 3300025938 Ga0207704_10006477 Ga0207704_100064777 122
344 3300025938 Ga0207704_10042580 Ga0207704_100425803 122
345 3300025939 Ga0207665_10042509 Ga0207665_100425093 122
346 3300025939 Ga0207665_10056168 Ga0207665_100561682 122
347 3300025940 Ga0207691_10297056 Ga0207691_102970563 122
348 3300025941 Ga0207711_10043700 Ga0207711_100437001 122
349 3300025941 Ga0207711_10168750 Ga0207711_101687503 122
350 3300025942 Ga0207689_10001719 Ga0207689_1000171912 122
351 3300025942 Ga0207689_10181326 Ga0207689_101813263 122
352 3300025949 Ga0207667_10204238 Ga0207667_102042383 122
353 3300025949 Ga0207667_10595281 Ga0207667_105952812 122
354 3300025960 Ga0207651_10029750 Ga0207651_100297503 122
355 3300025961 Ga0207712_10018400 Ga0207712_100184005 122
356 3300025961 Ga0207712_10199771 Ga0207712_101997712 122
357 3300025961 Ga0207712_10714284 Ga0207712_107142841 122
358 3300025961 Ga0207712_10940847 Ga0207712_109408471 122
359 3300025972 Ga0207668_10058876 Ga0207668_100588762 122
360 3300025972 Ga0207668_10061381 Ga0207668_100613812 122
361 3300025972 Ga0207668_10111674 Ga0207668_101116743 122
362 3300025972 Ga0207668_10627149 Ga0207668_106271492 122
363 3300025972 Ga0207668_10670342 Ga0207668_106703421 122
364 3300025981 Ga0207640_10062294 Ga0207640_100622942 122
365 3300025986 Ga0207658_10085018 Ga0207658_100850182 122
366 3300025986 Ga0207658_10107411 Ga0207658_101074114 122
367 3300025986 Ga0207658_10231407 Ga0207658_102314073 122
368 3300026023 Ga0207677_10058468 Ga0207677_100584682 122
369 3300026023 Ga0207677_10273985 Ga0207677_102739852 122
370 3300026023 Ga0207677_10357099 Ga0207677_103570992 122
371 3300026023 Ga0207677_10402457 Ga0207677_104024572 122
372 3300026035 Ga0207703_10136466 Ga0207703_101364663 122
373 3300026035 Ga0207703_10229849 Ga0207703_102298491 122
374 3300026035 Ga0207703_11128253 Ga0207703_111282532 122
375 3300026041 Ga0207639_10009009 Ga0207639_100090095 122
376 3300026041 Ga0207639_10162544 Ga0207639_101625442 122
377 3300026067 Ga0207678_10012234 Ga0207678_100122344 122
378 3300026067 Ga0207678_10123769 Ga0207678_101237692 122
379 3300026075 Ga0207708_10001627 Ga0207708_100016279 122
380 3300026075 Ga0207708_10004770 Ga0207708_100047709 122
381 3300026075 Ga0207708_10020548 Ga0207708_100205485 122
382 3300026078 Ga0207702_10589534 Ga0207702_105895342 122
383 3300026088 Ga0207641_10014725 Ga0207641_100147255 122
384 3300026088 Ga0207641_10490826 Ga0207641_104908263 122
385 3300026089 Ga0207648_10008258 Ga0207648_100082582 122
386 3300026089 Ga0207648_10029818 Ga0207648_100298182 122
387 3300026089 Ga0207648_10075000 Ga0207648_100750003 122
388 3300026095 Ga0207676_10296636 Ga0207676_102966363 122
389 3300026095 Ga0207676_10676603 Ga0207676_106766032 122
390 3300026095 Ga0207676_11700052 Ga0207676_117000521 122
391 3300026118 Ga0207675_100003328 Ga0207675_10000332815 122
392 3300026118 Ga0207675_100008751 Ga0207675_1000087512 122
393 3300026118 Ga0207675_100120644 Ga0207675_1001206442 122
394 3300026121 Ga0207683_10000571 Ga0207683_1000057112 122
395 3300026121 Ga0207683_10469740 Ga0207683_104697402 122
396 3300026121 Ga0207683_10791062 Ga0207683_107910622 122
397 3300026121 Ga0207683_11467566 Ga0207683_114675661 122
398 3300026142 Ga0207698_10513518 Ga0207698_105135182 122
399 3300027866 Ga0209813_10106451 Ga0209813_101064512 122
400 3300028379 Ga0268266_10014417 Ga0268266_100144178 122
401 3300028379 Ga0268266_10024364 Ga0268266_100243645 122
402 3300028379 Ga0268266_10102957 Ga0268266_101029572 122
403 3300028380 Ga0268265_10017387 Ga0268265_100173874 122
404 3300028380 Ga0268265_10391030 Ga0268265_103910302 122
405 3300028381 Ga0268264_10111151 Ga0268264_101111514 122
406 3300028381 Ga0268264_10417617 Ga0268264_104176173 122
407 3300028381 Ga0268264_11559088 Ga0268264_115590882 122
408 3300028381 Ga0268264_12304912 Ga0268264_123049122 122
409 3300031824 Ga0307413_11699927 Ga0307413_116999271 122
410 3300032002 Ga0307416_100885944 Ga0307416_1008859443 122
411 3300032005 Ga0307411_11591568 Ga0307411_115915681 122
412 3300032126 Ga0307415_102144663 Ga0307415_1021446631 122
413 3300035085 Ga0373929_0046374 Ga0373929_0046374_500_868 122
414 3300035092 Ga0373952_0171962 Ga0373952_0171962_138_506 122
415 3300035114 Ga0373939_0005508 Ga0373939_0005508_396_764 122
416 3300035207 Ga0373942_0141885 Ga0373942_0141885_364_732 122
417 3300035241 Ga0373961_0043568 Ga0373961_0043568_280_648 122
418 3300035691 Ga0373931_0012994 Ga0373931_0012994_804_1172 122
419 3300035691 Ga0373931_0043249 Ga0373931_0043249_1390_1758 122
420 3300035695 Ga0373927_0267921 Ga0373927_0267921_640_1020 122
421 3300041410 Ga0439461_0002815 Ga0439461_0002815_770_1138 122
422 3300041410 Ga0439461_0050530 Ga0439461_0050530_12_380 122
423 3300041411 Ga0439466_0019001 Ga0439466_0019001_634_1002 122
424 3300041413 Ga0439465_0002395 Ga0439465_0002395_1421_1789 122
425 3300041413 Ga0439465_0073610 Ga0439465_0073610_696_1064 122
426 3300041501 Ga0451845_0137376 Ga0451845_0137376_449_817 122
427 3300041505 Ga0451849_1158843 Ga0451849_1158843_64_432 122
428 3300041512 Ga0451853_1626027 Ga0451853_1626027_331_699 122
429 3300041997 Ga0439431_0004858 Ga0439431_0004858_620_988 122
430 3300041997 Ga0439431_0066387 Ga0439431_0066387_307_675 122
431 3300042002 Ga0439442_014859 Ga0439442_014859_1209_1577 122
432 3300042002 Ga0439442_038236 Ga0439442_038236_367_735 122
433 3300042004 Ga0439445_0027307 Ga0439445_0027307_956_1324 122
434 3300042016 Ga0439463_055358 Ga0439463_055358_476_850 122
435 3300042137 Ga0450902_096824 Ga0450902_096824_123_497 122
436 3300042435 Ga0439434_0023835 Ga0439434_0023835_1244_1612 122
437 3300042436 Ga0439435_0182950 Ga0439435_0182950_190_567 122
438 3300042439 Ga0439464_0141001 Ga0439464_0141001_88_462 122
439 3300044658 Ga0466972_0104722 Ga0466972_0104722_467_835 122
440 3300044694 Ga0466963_0550539 Ga0466963_0550539_367_735 122
441 3300044765 Ga0466970_0260156 Ga0466970_0260156_351_719 122
442 3300044901 Ga0466960_0897424 Ga0466960_0897424_159_527 122
443 3300045976 Ga0466967_0213049 Ga0466967_0213049_902_1270 122
444 3300047323 Ga0495683_0222544 Ga0495683_0222544_231_599 122
445 3300048903 Ga0496100_0008800 Ga0496100_0008800_3719_4087 122
446 3300048903 Ga0496100_0585565 Ga0496100_0585565_109_477 122
447 3300048904 Ga0496101_0049335 Ga0496101_0049335_2083_2451 122
448 3300048904 Ga0496101_0771503 Ga0496101_0771503_68_436 122
449 3300048905 Ga0496102_0007262 Ga0496102_0007262_8213_8581 122
450 3300048905 Ga0496102_0007888 Ga0496102_0007888_3563_3931 122
451 3300048905 Ga0496102_0148473 Ga0496102_0148473_1136_1504 122
452 3300048905 Ga0496102_0318840 Ga0496102_0318840_732_1100 122
453 3300048905 Ga0496102_0954322 Ga0496102_0954322_65_433 122
454 3300048906 Ga0496103_0003214 Ga0496103_0003214_872_1240 122
455 3300048906 Ga0496103_0081091 Ga0496103_0081091_301_669 122
456 3300048906 Ga0496103_0358811 Ga0496103_0358811_230_598 122
457 3300048907 Ga0496104_0028273 Ga0496104_0028273_3374_3742 122
458 3300048907 Ga0496104_0354999 Ga0496104_0354999_699_1067 122
459 3300048908 Ga0496105_0087658 Ga0496105_0087658_1017_1385 122
460 3300048908 Ga0496105_0267449 Ga0496105_0267449_487_855 122
461 3300048909 Ga0496106_0002557 Ga0496106_0002557_3907_4275 122
462 3300048909 Ga0496106_0200908 Ga0496106_0200908_1206_1574 122
463 3300048910 Ga0496107_0005329 Ga0496107_0005329_999_1367 122
464 3300048910 Ga0496107_1381850 Ga0496107_1381850_21_389 122
465 3300048911 Ga0496108_0000457 Ga0496108_0000457_25678_26046 122
466 3300048911 Ga0496108_0573778 Ga0496108_0573778_321_689 122
467 3300048912 Ga0496109_0009547 Ga0496109_0009547_939_1307 122
468 3300048912 Ga0496109_0033243 Ga0496109_0033243_3111_3479 122
469 3300048912 Ga0496109_0230257 Ga0496109_0230257_426_794 122
470 3300048913 Ga0496110_0012624 Ga0496110_0012624_913_1281 122
471 3300048913 Ga0496110_0307017 Ga0496110_0307017_316_684 122
472 3300048914 Ga0496111_0023251 Ga0496111_0023251_197_565 122
473 3300048915 Ga0496112_0007283 Ga0496112_0007283_1704_2072 122
474 3300048915 Ga0496112_0053102 Ga0496112_0053102_3055_3423 122
475 3300048915 Ga0496112_0538513 Ga0496112_0538513_575_943 122
476 3300048916 Ga0496113_0045656 Ga0496113_0045656_2562_2930 122
477 3300048916 Ga0496113_0074281 Ga0496113_0074281_995_1363 122
478 3300048916 Ga0496113_0698166 Ga0496113_0698166_426_794 122
479 3300048917 Ga0496114_0002825 Ga0496114_0002825_4240_4608 122
480 3300048917 Ga0496114_0983117 Ga0496114_0983117_301_669 122
481 3300048918 Ga0496115_0000532 Ga0496115_0000532_1434_1802 122
482 3300048918 Ga0496115_0189244 Ga0496115_0189244_416_784 122
483 3300048921 Ga0496118_0201352 Ga0496118_0201352_725_1093 122
484 3300049571 Ga0501034_0352727 Ga0501034_0352727_215_586 122
485 3300049583 Ga0501067_0191273 Ga0501067_0191273_198_566 122
486 3300050489 nmdc:mga03683_135793_c1 nmdc:mga03683_135793_c1_610_978 122
487 3300050489 nmdc:mga03683_43893_c1 nmdc:mga03683_43893_c1_451_819 122
488 3300050490 nmdc:mga03n38_242426_c1 nmdc:mga03n38_242426_c1_14_382 122
489 3300050490 nmdc:mga03n38_264652_c1 nmdc:mga03n38_264652_c1_398_766 122
490 3300050491 nmdc:mga00v17_115897_c1 nmdc:mga00v17_115897_c1_540_908 122
491 3300050491 nmdc:mga00v17_28677_c1 nmdc:mga00v17_28677_c1_1412_1780 122
492 3300050491 nmdc:mga00v17_565105_c1 nmdc:mga00v17_565105_c1_127_495 122
493 3300050492 nmdc:mga0yw44_115188_c1 nmdc:mga0yw44_115188_c1_624_992 122
494 3300050492 nmdc:mga0yw44_43799_c1 nmdc:mga0yw44_43799_c1_480_848 122
495 3300050494 nmdc:mga06z11_139075_c1 nmdc:mga06z11_139075_c1_412_780 122
496 3300050494 nmdc:mga06z11_520115_c1 nmdc:mga06z11_520115_c1_40_408 122
497 3300050496 nmdc:mga07m45_145499_c1 nmdc:mga07m45_145499_c1_786_1154 122
498 3300050509 nmdc:mga0qj67_96709_c1 nmdc:mga0qj67_96709_c1_375_749 122
499 3300050511 nmdc:mga08y16_1093735_c1 nmdc:mga08y16_1093735_c1_90_464 122
500 3300050516 nmdc:mga0sz30_20468_c1 nmdc:mga0sz30_20468_c1_981_1349 122
501 3300050516 nmdc:mga0sz30_205643_c1 nmdc:mga0sz30_205643_c1_32_400 122
502 3300050516 nmdc:mga0sz30_21808_c1 nmdc:mga0sz30_21808_c1_842_1219 122
503 3300050516 nmdc:mga0sz30_2189_c1 nmdc:mga0sz30_2189_c1_5754_6122 122
504 3300053153 Ga0500616_0023893 Ga0500616_0023893_908_1276 122
505 3300053153 Ga0500616_0034291 Ga0500616_0034291_2277_2645 122
506 iso_pu_bacteria 2671180195 2671833876 122
507 iso_pu_bacteria 2773857922 2774852032 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

20

118

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxo-assembly1.cif.gz_A crystal structure of a putative isomerase of the snoal-like family (atu_0744) from agrobacterium tumefaciens str. c58 at 2.70 a resolution 0.9585 1 116
3dxo-assembly1.cif.gz_A crystal structure of a putative isomerase of the snoal-like family (atu_0744) from agrobacterium tumefaciens str. c58 at 2.70 a resolution 0.9426 1 116
6x1i-assembly1.cif.gz_B two-component d3 assembly constructed by fusing symmetric oligomers to coiled coils 0.9325 2 116
6x1i-assembly1.cif.gz_B two-component d3 assembly constructed by fusing symmetric oligomers to coiled coils 0.8747 2 116
4kvh-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase fold protein hmuk_0747 0.862 4 117
ID Description Score Start End Superfamily
3dxoA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9697 4 116 3.10.450.50
3dxoA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9366 4 116 3.10.450.50
4kvhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.862 4 117 3.10.450.50
4u13B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8365 6 113 3.10.450.50
af_K7K592_75_198_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8276 5 116 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A239D9F2-F1-model_v4 SnoaL-like domain-containing protein 0.9953 6 122
AF-A0A2T0TQF5-F1-model_v4 SnoaL-like protein 0.9939 56 120
AF-A0A7J5CJ40-F1-model_v4 Nuclear transport factor 2 family protein 0.9935 6 120
AF-A0A852ZKQ3-F1-model_v4 SnoaL-like domain-containing protein 0.9929 36 120
AF-A0A0A1PQQ6-F1-model_v4 SnoaL-like domain protein 0.9923 1 120

Feature Viewer

pLDDT pTM Quality
95.58 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map