F456712
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 507 | 265 | 498 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300041443|Ga0451789_0582140|Ga0451789_0582140_94_495 |
| Length | 133 |
| Sequence | MLVWSEAEQPKETTMFNELAERYIAVWNETDPQARRKAVDELYTEDARYIDPLAVAEGRDAISETIGAVQGQFPGFRFRLAGPVDGHHDQARFSWELGPEGAPAPIAGFDVAITDGQSRLRSVFGFLDRVPAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 3 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 4 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 5 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 6 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 7 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 8 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 9 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 10 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 187 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 188 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 194 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 195 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 196 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 203 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 204 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 205 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 206 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 210 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 213 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 214 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 215 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 216 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 217 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 218 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 219 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 220 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 221 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 222 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 223 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 224 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 225 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 226 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 227 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 228 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 229 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 230 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 231 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 232 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 237 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 238 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 239 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 240 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 241 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 242 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 245 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 246 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 247 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 248 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 249 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 250 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 251 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 254 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 255 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 256 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 257 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 258 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 259 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 263 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 264 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 265 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.03 |
| Metatranscriptomes | 0.2 |
| Isolates | 1.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.1 |
| Nodule | 0.39 |
| Rhizoplane | 8.09 |
| Rhizosphere | 82.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1002483 | 3300000545 | Bacteria | 1281 |
| 2 | JGI24739J22299_10027031 | 3300001989 | Bacteria | 2008 |
| 3 | JGI24750J21931_1003490 | 3300002070 | Bacteria | 1882 |
| 4 | JGI24748J21848_1004632 | 3300002074 | Bacteria | 1582 |
| 5 | JGI24744J21845_10001047 | 3300002077 | Bacteria | 5334 |
| 6 | JGI24744J21845_10006410 | 3300002077 | Bacteria | 2441 |
| 7 | JGI24742J22300_10006862 | 3300002244 | Bacteria | 1877 |
| 8 | Ga0070658_10248629 | 3300005327 | Bacteria | 1508 |
| 9 | Ga0070658_10461863 | 3300005327 | Bacteria | 1095 |
| 10 | Ga0070676_10156320 | 3300005328 | Bacteria | 1464 |
| 11 | Ga0070676_10158004 | 3300005328 | Bacteria | 1457 |
| 12 | Ga0070683_100570873 | 3300005329 | Bacteria | 1082 |
| 13 | Ga0070670_100035787 | 3300005331 | Bacteria | 4275 |
| 14 | Ga0070677_10544462 | 3300005333 | Bacteria | 635 |
| 15 | Ga0068869_100014660 | 3300005334 | Bacteria | 5241 |
| 16 | Ga0068869_100364543 | 3300005334 | Bacteria | 1181 |
| 17 | Ga0070666_10527015 | 3300005335 | Bacteria | 858 |
| 18 | Ga0070680_100099174 | 3300005336 | Bacteria | 2417 |
| 19 | Ga0070680_100203961 | 3300005336 | Bacteria | 1668 |
| 20 | Ga0070680_100321454 | 3300005336 | Bacteria | 1314 |
| 21 | Ga0070682_100072258 | 3300005337 | Bacteria | 2211 |
| 22 | Ga0070682_100110436 | 3300005337 | Bacteria | 1832 |
| 23 | Ga0068868_100013777 | 3300005338 | Bacteria | 5941 |
| 24 | Ga0068868_100371049 | 3300005338 | Bacteria | 1229 |
| 25 | Ga0070660_100129996 | 3300005339 | Bacteria | 2014 |
| 26 | Ga0070660_100546729 | 3300005339 | Bacteria | 966 |
| 27 | Ga0070689_100050217 | 3300005340 | Bacteria | 3222 |
| 28 | Ga0070689_100074679 | 3300005340 | Bacteria | 2653 |
| 29 | Ga0070691_10014555 | 3300005341 | Bacteria | 3610 |
| 30 | Ga0070691_10293687 | 3300005341 | Bacteria | 886 |
| 31 | Ga0070687_100181474 | 3300005343 | Bacteria | 1261 |
| 32 | Ga0070692_10169935 | 3300005345 | Bacteria | 1256 |
| 33 | Ga0070668_100003753 | 3300005347 | Bacteria | 11208 |
| 34 | Ga0070668_100066277 | 3300005347 | Bacteria | 2802 |
| 35 | Ga0070668_100151189 | 3300005347 | Bacteria | 1877 |
| 36 | Ga0070668_100520384 | 3300005347 | Bacteria | 1032 |
| 37 | Ga0070668_100788745 | 3300005347 | Bacteria | 843 |
| 38 | Ga0070668_101367818 | 3300005347 | Bacteria | 645 |
| 39 | Ga0070669_100010231 | 3300005353 | Bacteria | 6664 |
| 40 | Ga0070669_100952037 | 3300005353 | Bacteria | 735 |
| 41 | Ga0070671_100679092 | 3300005355 | Bacteria | 893 |
| 42 | Ga0070671_101072194 | 3300005355 | Bacteria | 707 |
| 43 | Ga0070674_100016151 | 3300005356 | Bacteria | 4678 |
| 44 | Ga0070674_100234565 | 3300005356 | Bacteria | 1434 |
| 45 | Ga0070673_100093163 | 3300005364 | Bacteria | 2467 |
| 46 | Ga0070688_100017460 | 3300005365 | Bacteria | 4119 |
| 47 | Ga0070688_100091666 | 3300005365 | Bacteria | 1986 |
| 48 | Ga0070659_100056881 | 3300005366 | Bacteria | 3084 |
| 49 | Ga0070659_100301867 | 3300005366 | Bacteria | 1336 |
| 50 | Ga0070667_100012373 | 3300005367 | Bacteria | 7058 |
| 51 | Ga0070667_100111614 | 3300005367 | Bacteria | 2372 |
| 52 | Ga0070667_100159921 | 3300005367 | Bacteria | 1983 |
| 53 | Ga0070667_102077825 | 3300005367 | Bacteria | 535 |
| 54 | Ga0070714_100118338 | 3300005435 | Bacteria | 2354 |
| 55 | Ga0070714_100803992 | 3300005435 | Bacteria | 911 |
| 56 | Ga0070714_101311184 | 3300005435 | Bacteria | 707 |
| 57 | Ga0070713_100024986 | 3300005436 | Bacteria | 4663 |
| 58 | Ga0070713_100224135 | 3300005436 | Unclassified | 1706 |
| 59 | Ga0070713_100706094 | 3300005436 | Bacteria | 963 |
| 60 | Ga0070713_100747217 | 3300005436 | Bacteria | 936 |
| 61 | Ga0070710_10001806 | 3300005437 | Bacteria | 10112 |
| 62 | Ga0070710_10007603 | 3300005437 | Bacteria | 5250 |
| 63 | Ga0070710_10055817 | 3300005437 | Bacteria | 2233 |
| 64 | Ga0070701_10002037 | 3300005438 | Bacteria | 7669 |
| 65 | Ga0070701_10043971 | 3300005438 | Bacteria | 2287 |
| 66 | Ga0070711_100001387 | 3300005439 | Bacteria | 13228 |
| 67 | Ga0070711_100055229 | 3300005439 | Bacteria | 2743 |
| 68 | Ga0070705_100033280 | 3300005440 | Bacteria | 2872 |
| 69 | Ga0070700_100064398 | 3300005441 | Bacteria | 2321 |
| 70 | Ga0070700_100229739 | 3300005441 | Bacteria | 1320 |
| 71 | Ga0070694_100024605 | 3300005444 | Bacteria | 3888 |
| 72 | Ga0070694_100084582 | 3300005444 | Bacteria | 2213 |
| 73 | Ga0070663_100075871 | 3300005455 | Bacteria | 2458 |
| 74 | Ga0070678_100002489 | 3300005456 | Bacteria | 10100 |
| 75 | Ga0070678_100473825 | 3300005456 | Bacteria | 1100 |
| 76 | Ga0070662_100557492 | 3300005457 | Bacteria | 961 |
| 77 | Ga0070662_100603905 | 3300005457 | Bacteria | 923 |
| 78 | Ga0070681_10517377 | 3300005458 | Bacteria | 1106 |
| 79 | Ga0070681_11060375 | 3300005458 | Bacteria | 731 |
| 80 | Ga0068867_100176515 | 3300005459 | Bacteria | 1696 |
| 81 | Ga0068867_100719846 | 3300005459 | Bacteria | 882 |
| 82 | Ga0070685_10490393 | 3300005466 | Bacteria | 868 |
| 83 | Ga0070685_10642735 | 3300005466 | Bacteria | 768 |
| 84 | Ga0070706_102078177 | 3300005467 | Bacteria | 514 |
| 85 | Ga0070684_100222955 | 3300005535 | Bacteria | 1720 |
| 86 | Ga0068853_100003371 | 3300005539 | Bacteria | 12227 |
| 87 | Ga0068853_100308455 | 3300005539 | Bacteria | 1464 |
| 88 | Ga0068853_101656140 | 3300005539 | Bacteria | 620 |
| 89 | Ga0070672_100467654 | 3300005543 | Bacteria | 1088 |
| 90 | Ga0070672_100643055 | 3300005543 | Bacteria | 926 |
| 91 | Ga0070686_100079645 | 3300005544 | Bacteria | 2166 |
| 92 | Ga0070686_100339825 | 3300005544 | Bacteria | 1125 |
| 93 | Ga0070686_100430431 | 3300005544 | Bacteria | 1010 |
| 94 | Ga0070695_100113737 | 3300005545 | Bacteria | 1841 |
| 95 | Ga0070696_100002764 | 3300005546 | Bacteria | 11637 |
| 96 | Ga0070696_100054120 | 3300005546 | Bacteria | 2796 |
| 97 | Ga0070693_100111931 | 3300005547 | Bacteria | 1681 |
| 98 | Ga0070665_100011105 | 3300005548 | Bacteria | 9099 |
| 99 | Ga0070665_100032105 | 3300005548 | Bacteria | 5285 |
| 100 | Ga0070665_100326968 | 3300005548 | Bacteria | 1537 |
| 101 | Ga0070704_100005094 | 3300005549 | Bacteria | 7643 |
| 102 | Ga0070704_100256485 | 3300005549 | Bacteria | 1438 |
| 103 | Ga0068855_100104579 | 3300005563 | Bacteria | 3256 |
| 104 | Ga0068854_100004276 | 3300005578 | Bacteria | 8996 |
| 105 | Ga0068856_101655694 | 3300005614 | Bacteria | 653 |
| 106 | Ga0070702_100056184 | 3300005615 | Bacteria | 2272 |
| 107 | Ga0070702_100640420 | 3300005615 | Bacteria | 802 |
| 108 | Ga0068852_100050509 | 3300005616 | Bacteria | 3564 |
| 109 | Ga0068852_100180503 | 3300005616 | Bacteria | 1985 |
| 110 | Ga0068852_101515544 | 3300005616 | Unclassified | 693 |
| 111 | Ga0068859_100143502 | 3300005617 | Bacteria | 2461 |
| 112 | Ga0068859_100160030 | 3300005617 | Bacteria | 2331 |
| 113 | Ga0068859_100776007 | 3300005617 | Bacteria | 1047 |
| 114 | Ga0068864_100279096 | 3300005618 | Bacteria | 1559 |
| 115 | Ga0068864_100803449 | 3300005618 | Bacteria | 924 |
| 116 | Ga0068864_100900150 | 3300005618 | Bacteria | 874 |
| 117 | Ga0068866_10000565 | 3300005718 | Bacteria | 16831 |
| 118 | Ga0068866_10058383 | 3300005718 | Bacteria | 1992 |
| 119 | Ga0068861_100000973 | 3300005719 | Bacteria | 17463 |
| 120 | Ga0068861_100219051 | 3300005719 | Bacteria | 1608 |
| 121 | Ga0068861_100233425 | 3300005719 | Bacteria | 1561 |
| 122 | Ga0068861_100316074 | 3300005719 | Bacteria | 1359 |
| 123 | Ga0068870_10737220 | 3300005840 | Bacteria | 683 |
| 124 | Ga0068863_100118298 | 3300005841 | Bacteria | 2525 |
| 125 | Ga0068863_100412843 | 3300005841 | Bacteria | 1322 |
| 126 | Ga0068863_102703852 | 3300005841 | Bacteria | 505 |
| 127 | Ga0068858_100004674 | 3300005842 | Bacteria | 13421 |
| 128 | Ga0068858_100020072 | 3300005842 | Bacteria | 6249 |
| 129 | Ga0068858_101041497 | 3300005842 | Bacteria | 802 |
| 130 | Ga0068860_100005325 | 3300005843 | Bacteria | 13059 |
| 131 | Ga0068860_100040810 | 3300005843 | Bacteria | 4434 |
| 132 | Ga0068860_100089247 | 3300005843 | Bacteria | 2935 |
| 133 | Ga0068862_100182054 | 3300005844 | Bacteria | 1886 |
| 134 | Ga0068862_100286832 | 3300005844 | Bacteria | 1510 |
| 135 | Ga0081455_10168946 | 3300005937 | Bacteria | 1668 |
| 136 | Ga0081540_1315215 | 3300005983 | Bacteria | 537 |
| 137 | Ga0075365_10082689 | 3300006038 | Bacteria | 2177 |
| 138 | Ga0075365_10109111 | 3300006038 | Bacteria | 1901 |
| 139 | Ga0075368_10045192 | 3300006042 | Bacteria | 1739 |
| 140 | Ga0075363_100003949 | 3300006048 | Bacteria | 6403 |
| 141 | Ga0075363_100069442 | 3300006048 | Bacteria | 1911 |
| 142 | Ga0075363_100072998 | 3300006048 | Bacteria | 1866 |
| 143 | Ga0075364_10023430 | 3300006051 | Bacteria | 3909 |
| 144 | Ga0075364_10037736 | 3300006051 | Bacteria | 3130 |
| 145 | Ga0070715_10007514 | 3300006163 | Bacteria | 3756 |
| 146 | Ga0070715_10011082 | 3300006163 | Bacteria | 3235 |
| 147 | Ga0070716_100003132 | 3300006173 | Bacteria | 7730 |
| 148 | Ga0070716_100016850 | 3300006173 | Bacteria | 3778 |
| 149 | Ga0070716_100195107 | 3300006173 | Bacteria | 1341 |
| 150 | Ga0070712_100000911 | 3300006175 | Bacteria | 17732 |
| 151 | Ga0070712_100018936 | 3300006175 | Bacteria | 4481 |
| 152 | Ga0070712_100149413 | 3300006175 | Unclassified | 1792 |
| 153 | Ga0070712_101061140 | 3300006175 | Bacteria | 702 |
| 154 | Ga0075362_10035094 | 3300006177 | Bacteria | 2188 |
| 155 | Ga0075362_10096644 | 3300006177 | Bacteria | 1377 |
| 156 | Ga0075367_10125359 | 3300006178 | Bacteria | 1585 |
| 157 | Ga0075369_10001174 | 3300006186 | Bacteria | 8855 |
| 158 | Ga0075369_10039010 | 3300006186 | Bacteria | 2027 |
| 159 | Ga0075369_10068518 | 3300006186 | Bacteria | 1559 |
| 160 | Ga0097621_100184725 | 3300006237 | Bacteria | 1803 |
| 161 | Ga0097621_100221209 | 3300006237 | Bacteria | 1650 |
| 162 | Ga0075370_10034799 | 3300006353 | Bacteria | 2824 |
| 163 | Ga0075370_10052652 | 3300006353 | Bacteria | 2310 |
| 164 | Ga0068871_100119139 | 3300006358 | Bacteria | 2228 |
| 165 | Ga0068871_100154803 | 3300006358 | Bacteria | 1957 |
| 166 | Ga0075428_100067536 | 3300006844 | Bacteria | 3912 |
| 167 | Ga0075430_100038984 | 3300006846 | Bacteria | 4024 |
| 168 | Ga0068865_100004101 | 3300006881 | Bacteria | 8754 |
| 169 | Ga0068865_100829085 | 3300006881 | Bacteria | 800 |
| 170 | Ga0097620_100143492 | 3300006931 | Bacteria | 2461 |
| 171 | Ga0097620_100160026 | 3300006931 | Bacteria | 2331 |
| 172 | Ga0097620_100775979 | 3300006931 | Bacteria | 1047 |
| 173 | Ga0099795_10036096 | 3300007788 | Bacteria | 1732 |
| 174 | Ga0105250_10015700 | 3300009092 | Bacteria | 3100 |
| 175 | Ga0105250_10050262 | 3300009092 | Bacteria | 1673 |
| 176 | Ga0105245_10006864 | 3300009098 | Bacteria | 9985 |
| 177 | Ga0105245_10457541 | 3300009098 | Bacteria | 1286 |
| 178 | Ga0105245_10906181 | 3300009098 | Bacteria | 923 |
| 179 | Ga0105247_10017392 | 3300009101 | Bacteria | 4317 |
| 180 | Ga0105247_10168307 | 3300009101 | Bacteria | 1455 |
| 181 | Ga0114129_10036631 | 3300009147 | Bacteria | 6926 |
| 182 | Ga0105243_10001473 | 3300009148 | Bacteria | 20645 |
| 183 | Ga0105243_10064288 | 3300009148 | Bacteria | 2944 |
| 184 | Ga0105243_10367406 | 3300009148 | Bacteria | 1326 |
| 185 | Ga0105243_10436657 | 3300009148 | Bacteria | 1225 |
| 186 | Ga0105241_10028680 | 3300009174 | Bacteria | 4148 |
| 187 | Ga0105241_10716910 | 3300009174 | Bacteria | 914 |
| 188 | Ga0105242_10008103 | 3300009176 | Bacteria | 8083 |
| 189 | Ga0105242_10227962 | 3300009176 | Bacteria | 1668 |
| 190 | Ga0105248_10021235 | 3300009177 | Bacteria | 7193 |
| 191 | Ga0105248_10715821 | 3300009177 | Bacteria | 1130 |
| 192 | Ga0105237_10519665 | 3300009545 | Bacteria | 1197 |
| 193 | Ga0105238_10824177 | 3300009551 | Bacteria | 944 |
| 194 | Ga0105249_10004275 | 3300009553 | Bacteria | 12344 |
| 195 | Ga0105249_10048582 | 3300009553 | Bacteria | 3868 |
| 196 | Ga0105249_10148814 | 3300009553 | Bacteria | 2252 |
| 197 | Ga0105249_11250656 | 3300009553 | Bacteria | 814 |
| 198 | Ga0105249_11528216 | 3300009553 | Bacteria | 740 |
| 199 | Ga0105249_12010518 | 3300009553 | Bacteria | 651 |
| 200 | Ga0099796_10000940 | 3300010159 | Bacteria | 5430 |
| 201 | Ga0105239_10032691 | 3300010375 | Bacteria | 5716 |
| 202 | Ga0105239_10324880 | 3300010375 | Bacteria | 1735 |
| 203 | Ga0105239_13331037 | 3300010375 | Unclassified | 523 |
| 204 | Ga0105246_11294507 | 3300011119 | Bacteria | 675 |
| 205 | Ga0157370_10357386 | 3300013104 | Bacteria | 1346 |
| 206 | Ga0157369_11249420 | 3300013105 | Bacteria | 758 |
| 207 | Ga0157374_10164327 | 3300013296 | Bacteria | 2163 |
| 208 | Ga0157374_10330145 | 3300013296 | Bacteria | 1513 |
| 209 | Ga0157378_10007170 | 3300013297 | Bacteria | 9736 |
| 210 | Ga0163162_10006580 | 3300013306 | Bacteria | 11260 |
| 211 | Ga0163162_10066711 | 3300013306 | Bacteria | 3647 |
| 212 | Ga0163162_10067581 | 3300013306 | Bacteria | 3624 |
| 213 | Ga0163162_10332995 | 3300013306 | Bacteria | 1650 |
| 214 | Ga0163162_13083170 | 3300013306 | Bacteria | 535 |
| 215 | Ga0157372_10046932 | 3300013307 | Bacteria | 4797 |
| 216 | Ga0157372_10521000 | 3300013307 | Bacteria | 1386 |
| 217 | Ga0157375_10006350 | 3300013308 | Bacteria | 10302 |
| 218 | Ga0157375_11064196 | 3300013308 | Bacteria | 946 |
| 219 | Ga0157375_13046947 | 3300013308 | Bacteria | 559 |
| 220 | Ga0163163_12453686 | 3300014325 | Bacteria | 580 |
| 221 | Ga0157380_10004957 | 3300014326 | Bacteria | 9278 |
| 222 | Ga0157380_10802222 | 3300014326 | Bacteria | 958 |
| 223 | Ga0157377_10052721 | 3300014745 | Bacteria | 2297 |
| 224 | Ga0157377_10325675 | 3300014745 | Bacteria | 1022 |
| 225 | Ga0157379_10015673 | 3300014968 | Bacteria | 6660 |
| 226 | Ga0157379_10125390 | 3300014968 | Bacteria | 2310 |
| 227 | Ga0157379_11084894 | 3300014968 | Bacteria | 766 |
| 228 | Ga0157376_10120907 | 3300014969 | Bacteria | 2321 |
| 229 | Ga0163161_10002621 | 3300017792 | Bacteria | 12806 |
| 230 | Ga0163161_10148639 | 3300017792 | Bacteria | 1779 |
| 231 | Ga0163161_10683258 | 3300017792 | Bacteria | 853 |
| 232 | Ga0163161_11073270 | 3300017792 | Bacteria | 691 |
| 233 | Ga0206353_10210750 | 3300020082 | Bacteria | 610 |
| 234 | Ga0207696_1038243 | 3300025711 | Bacteria | 1417 |
| 235 | Ga0207696_1124729 | 3300025711 | Bacteria | 693 |
| 236 | Ga0207653_10160600 | 3300025885 | Bacteria | 832 |
| 237 | Ga0207682_10440796 | 3300025893 | Bacteria | 616 |
| 238 | Ga0207692_10015837 | 3300025898 | Bacteria | 3326 |
| 239 | Ga0207692_10099555 | 3300025898 | Bacteria | 1593 |
| 240 | Ga0207692_10191789 | 3300025898 | Bacteria | 1196 |
| 241 | Ga0207642_10000708 | 3300025899 | Bacteria | 10319 |
| 242 | Ga0207710_10030989 | 3300025900 | Bacteria | 2336 |
| 243 | Ga0207710_10049935 | 3300025900 | Bacteria | 1876 |
| 244 | Ga0207688_10001972 | 3300025901 | Bacteria | 11002 |
| 245 | Ga0207647_10034071 | 3300025904 | Bacteria | 3254 |
| 246 | Ga0207647_10064065 | 3300025904 | Bacteria | 2234 |
| 247 | Ga0207685_10004420 | 3300025905 | Bacteria | 3571 |
| 248 | Ga0207699_10044726 | 3300025906 | Bacteria | 2579 |
| 249 | Ga0207699_10747851 | 3300025906 | Bacteria | 717 |
| 250 | Ga0207645_10028238 | 3300025907 | Bacteria | 3623 |
| 251 | Ga0207645_10073944 | 3300025907 | Bacteria | 2182 |
| 252 | Ga0207705_10547511 | 3300025909 | Bacteria | 899 |
| 253 | Ga0207654_10065695 | 3300025911 | Bacteria | 2137 |
| 254 | Ga0207654_10775102 | 3300025911 | Bacteria | 692 |
| 255 | Ga0207707_10968476 | 3300025912 | Bacteria | 700 |
| 256 | Ga0207671_10050657 | 3300025914 | Bacteria | 3075 |
| 257 | Ga0207693_10000971 | 3300025915 | Bacteria | 25771 |
| 258 | Ga0207693_10021145 | 3300025915 | Bacteria | 5171 |
| 259 | Ga0207693_10023926 | 3300025915 | Bacteria | 4848 |
| 260 | Ga0207693_10740401 | 3300025915 | Bacteria | 760 |
| 261 | Ga0207663_10002738 | 3300025916 | Bacteria | 8502 |
| 262 | Ga0207663_10036460 | 3300025916 | Bacteria | 2959 |
| 263 | Ga0207663_10133452 | 3300025916 | Bacteria | 1719 |
| 264 | Ga0207660_10247175 | 3300025917 | Bacteria | 1407 |
| 265 | Ga0207662_10216687 | 3300025918 | Bacteria | 1245 |
| 266 | Ga0207657_10056543 | 3300025919 | Bacteria | 3384 |
| 267 | Ga0207657_10096327 | 3300025919 | Bacteria | 2461 |
| 268 | Ga0207681_10010133 | 3300025923 | Bacteria | 5769 |
| 269 | Ga0207694_10973189 | 3300025924 | Bacteria | 718 |
| 270 | Ga0207650_10083797 | 3300025925 | Bacteria | 2422 |
| 271 | Ga0207659_11137461 | 3300025926 | Bacteria | 671 |
| 272 | Ga0207687_10011446 | 3300025927 | Bacteria | 5798 |
| 273 | Ga0207687_10461972 | 3300025927 | Bacteria | 1054 |
| 274 | Ga0207700_10002648 | 3300025928 | Bacteria | 10310 |
| 275 | Ga0207700_10134012 | 3300025928 | Bacteria | 2027 |
| 276 | Ga0207700_10900692 | 3300025928 | Bacteria | 792 |
| 277 | Ga0207664_10090113 | 3300025929 | Bacteria | 2513 |
| 278 | Ga0207664_10794195 | 3300025929 | Bacteria | 851 |
| 279 | Ga0207644_10008448 | 3300025931 | Bacteria | 6738 |
| 280 | Ga0207690_10071666 | 3300025932 | Bacteria | 2391 |
| 281 | Ga0207690_10691341 | 3300025932 | Bacteria | 838 |
| 282 | Ga0207690_10793134 | 3300025932 | Bacteria | 782 |
| 283 | Ga0207706_10011396 | 3300025933 | Bacteria | 8099 |
| 284 | Ga0207706_10272190 | 3300025933 | Bacteria | 1478 |
| 285 | Ga0207706_10799016 | 3300025933 | Bacteria | 801 |
| 286 | Ga0207686_10003058 | 3300025934 | Bacteria | 9004 |
| 287 | Ga0207686_10153587 | 3300025934 | Bacteria | 1605 |
| 288 | Ga0207709_10005736 | 3300025935 | Bacteria | 7013 |
| 289 | Ga0207709_10357460 | 3300025935 | Bacteria | 1105 |
| 290 | Ga0207709_10437715 | 3300025935 | Bacteria | 1008 |
| 291 | Ga0207670_10176335 | 3300025936 | Bacteria | 1607 |
| 292 | Ga0207670_10535380 | 3300025936 | Bacteria | 955 |
| 293 | Ga0207669_10123560 | 3300025937 | Bacteria | 1762 |
| 294 | Ga0207669_10221237 | 3300025937 | Bacteria | 1390 |
| 295 | Ga0207669_10305217 | 3300025937 | Bacteria | 1211 |
| 296 | Ga0207669_10448876 | 3300025937 | Bacteria | 1021 |
| 297 | Ga0207704_10006477 | 3300025938 | Bacteria | 5463 |
| 298 | Ga0207704_10042580 | 3300025938 | Bacteria | 2674 |
| 299 | Ga0207665_10042509 | 3300025939 | Bacteria | 3038 |
| 300 | Ga0207665_10056168 | 3300025939 | Bacteria | 2657 |
| 301 | Ga0207691_10297056 | 3300025940 | Bacteria | 1388 |
| 302 | Ga0207711_10043700 | 3300025941 | Bacteria | 3824 |
| 303 | Ga0207711_10168750 | 3300025941 | Bacteria | 1985 |
| 304 | Ga0207689_10001719 | 3300025942 | Bacteria | 20724 |
| 305 | Ga0207689_10181326 | 3300025942 | Bacteria | 1736 |
| 306 | Ga0207661_10401605 | 3300025944 | Bacteria | 1243 |
| 307 | Ga0207667_10204238 | 3300025949 | Bacteria | 2027 |
| 308 | Ga0207667_10595281 | 3300025949 | Bacteria | 1115 |
| 309 | Ga0207651_10029750 | 3300025960 | Bacteria | 3467 |
| 310 | Ga0207712_10018400 | 3300025961 | Bacteria | 4550 |
| 311 | Ga0207712_10199771 | 3300025961 | Bacteria | 1585 |
| 312 | Ga0207712_10447210 | 3300025961 | Bacteria | 1095 |
| 313 | Ga0207712_10714284 | 3300025961 | Bacteria | 876 |
| 314 | Ga0207712_10940847 | 3300025961 | Bacteria | 765 |
| 315 | Ga0207668_10058876 | 3300025972 | Bacteria | 2688 |
| 316 | Ga0207668_10061381 | 3300025972 | Bacteria | 2643 |
| 317 | Ga0207668_10111674 | 3300025972 | Bacteria | 2052 |
| 318 | Ga0207668_10627149 | 3300025972 | Bacteria | 939 |
| 319 | Ga0207668_10670342 | 3300025972 | Bacteria | 909 |
| 320 | Ga0207668_10739423 | 3300025972 | Bacteria | 867 |
| 321 | Ga0207668_10884178 | 3300025972 | Bacteria | 794 |
| 322 | Ga0207640_10062294 | 3300025981 | Bacteria | 2474 |
| 323 | Ga0207658_10085018 | 3300025986 | Bacteria | 2436 |
| 324 | Ga0207658_10107411 | 3300025986 | Bacteria | 2199 |
| 325 | Ga0207658_10231407 | 3300025986 | Bacteria | 1560 |
| 326 | Ga0207677_10058468 | 3300026023 | Bacteria | 2655 |
| 327 | Ga0207677_10273985 | 3300026023 | Bacteria | 1382 |
| 328 | Ga0207677_10357099 | 3300026023 | Bacteria | 1226 |
| 329 | Ga0207677_10402457 | 3300026023 | Bacteria | 1161 |
| 330 | Ga0207703_10136466 | 3300026035 | Bacteria | 2124 |
| 331 | Ga0207703_10229849 | 3300026035 | Bacteria | 1662 |
| 332 | Ga0207703_11128253 | 3300026035 | Bacteria | 753 |
| 333 | Ga0207639_10009009 | 3300026041 | Bacteria | 6872 |
| 334 | Ga0207639_10162544 | 3300026041 | Bacteria | 1883 |
| 335 | Ga0207678_10012234 | 3300026067 | Bacteria | 7535 |
| 336 | Ga0207678_10123769 | 3300026067 | Bacteria | 2207 |
| 337 | Ga0207678_10442485 | 3300026067 | Bacteria | 1129 |
| 338 | Ga0207708_10001627 | 3300026075 | Bacteria | 16714 |
| 339 | Ga0207708_10004770 | 3300026075 | Bacteria | 9980 |
| 340 | Ga0207708_10020548 | 3300026075 | Bacteria | 4980 |
| 341 | Ga0207702_10589534 | 3300026078 | Bacteria | 1090 |
| 342 | Ga0207641_10014725 | 3300026088 | Bacteria | 6411 |
| 343 | Ga0207641_10490826 | 3300026088 | Bacteria | 1191 |
| 344 | Ga0207641_10508286 | 3300026088 | Unclassified | 1171 |
| 345 | Ga0207648_10008258 | 3300026089 | Bacteria | 10107 |
| 346 | Ga0207648_10029818 | 3300026089 | Bacteria | 4837 |
| 347 | Ga0207648_10075000 | 3300026089 | Bacteria | 2949 |
| 348 | Ga0207676_10296636 | 3300026095 | Bacteria | 1474 |
| 349 | Ga0207676_10676603 | 3300026095 | Bacteria | 998 |
| 350 | Ga0207676_11700052 | 3300026095 | Bacteria | 629 |
| 351 | Ga0207675_100003328 | 3300026118 | Bacteria | 15736 |
| 352 | Ga0207675_100008751 | 3300026118 | Bacteria | 9508 |
| 353 | Ga0207675_100028291 | 3300026118 | Bacteria | 5219 |
| 354 | Ga0207675_100120644 | 3300026118 | Bacteria | 2480 |
| 355 | Ga0207683_10000571 | 3300026121 | Bacteria | 34106 |
| 356 | Ga0207683_10469740 | 3300026121 | Bacteria | 1160 |
| 357 | Ga0207683_10791062 | 3300026121 | Bacteria | 880 |
| 358 | Ga0207683_11467566 | 3300026121 | Bacteria | 630 |
| 359 | Ga0207698_10513518 | 3300026142 | Bacteria | 1168 |
| 360 | Ga0209813_10106451 | 3300027866 | Bacteria | 961 |
| 361 | Ga0268266_10014417 | 3300028379 | Bacteria | 6795 |
| 362 | Ga0268266_10024364 | 3300028379 | Bacteria | 5147 |
| 363 | Ga0268266_10102957 | 3300028379 | Bacteria | 2519 |
| 364 | Ga0268265_10017387 | 3300028380 | Bacteria | 4961 |
| 365 | Ga0268265_10391030 | 3300028380 | Bacteria | 1282 |
| 366 | Ga0268264_10111151 | 3300028381 | Bacteria | 2400 |
| 367 | Ga0268264_10417617 | 3300028381 | Bacteria | 1293 |
| 368 | Ga0268264_11559088 | 3300028381 | Bacteria | 671 |
| 369 | Ga0268264_12304912 | 3300028381 | Bacteria | 545 |
| 370 | Ga0307515_10114399 | 3300028794 | Bacteria | 3119 |
| 371 | Ga0307513_10000354 | 3300031456 | Bacteria | 66910 |
| 372 | Ga0307508_10342751 | 3300031616 | Bacteria | 1086 |
| 373 | Ga0307413_10855224 | 3300031824 | Bacteria | 769 |
| 374 | Ga0307413_11699927 | 3300031824 | Bacteria | 563 |
| 375 | Ga0307413_11822437 | 3300031824 | Unclassified | 545 |
| 376 | Ga0307416_100885944 | 3300032002 | Bacteria | 992 |
| 377 | Ga0307411_11591568 | 3300032005 | Bacteria | 603 |
| 378 | Ga0307415_102144663 | 3300032126 | Bacteria | 546 |
| 379 | Ga0373929_0046374 | 3300035085 | Bacteria | 982 |
| 380 | Ga0373952_0171962 | 3300035092 | Bacteria | 620 |
| 381 | Ga0373939_0005508 | 3300035114 | Bacteria | 3019 |
| 382 | Ga0373942_0141885 | 3300035207 | Bacteria | 765 |
| 383 | Ga0373961_0043568 | 3300035241 | Bacteria | 1306 |
| 384 | Ga0373931_0012994 | 3300035691 | Bacteria | 4045 |
| 385 | Ga0373931_0043249 | 3300035691 | Bacteria | 2371 |
| 386 | Ga0373927_0267921 | 3300035695 | Bacteria | 1123 |
| 387 | Ga0395900_0909367 | 3300037418 | Bacteria | 803 |
| 388 | Ga0395898_0949684 | 3300037466 | Bacteria | 797 |
| 389 | Ga0395901_0005856 | 3300038443 | Bacteria | 12433 |
| 390 | Ga0439461_0002815 | 3300041410 | Bacteria | 2815 |
| 391 | Ga0439461_0050530 | 3300041410 | Bacteria | 921 |
| 392 | Ga0439466_0019001 | 3300041411 | Bacteria | 2461 |
| 393 | Ga0439465_0002395 | 3300041413 | Bacteria | 6136 |
| 394 | Ga0439465_0073610 | 3300041413 | Bacteria | 1148 |
| 395 | Ga0451789_0582140 | 3300041443 | Bacteria | 763 |
| 396 | Ga0451791_0022331 | 3300041451 | Bacteria | 1019 |
| 397 | Ga0451797_0325563 | 3300041453 | Bacteria | 1275 |
| 398 | Ga0451845_0137376 | 3300041501 | Bacteria | 890 |
| 399 | Ga0451849_1158843 | 3300041505 | Bacteria | 794 |
| 400 | Ga0451853_1626027 | 3300041512 | Bacteria | 792 |
| 401 | Ga0439431_0004858 | 3300041997 | Bacteria | 2963 |
| 402 | Ga0439431_0066387 | 3300041997 | Bacteria | 956 |
| 403 | Ga0439442_014859 | 3300042002 | Bacteria | 1603 |
| 404 | Ga0439442_038236 | 3300042002 | Bacteria | 1006 |
| 405 | Ga0439445_0027307 | 3300042004 | Bacteria | 1465 |
| 406 | Ga0439463_055358 | 3300042016 | Bacteria | 1013 |
| 407 | Ga0450902_096824 | 3300042137 | Bacteria | 523 |
| 408 | Ga0439434_0023835 | 3300042435 | Bacteria | 1843 |
| 409 | Ga0439435_0182950 | 3300042436 | Bacteria | 685 |
| 410 | Ga0439464_0141001 | 3300042439 | Bacteria | 750 |
| 411 | Ga0466972_0050280 | 3300044658 | Bacteria | 2012 |
| 412 | Ga0466972_0104722 | 3300044658 | Bacteria | 1338 |
| 413 | Ga0466965_0081076 | 3300044683 | Bacteria | 1640 |
| 414 | Ga0466965_0407873 | 3300044683 | Bacteria | 752 |
| 415 | Ga0466966_0206740 | 3300044684 | Bacteria | 1187 |
| 416 | Ga0466961_0083977 | 3300044693 | Bacteria | 2014 |
| 417 | Ga0466963_0550539 | 3300044694 | Bacteria | 815 |
| 418 | Ga0466963_0598913 | 3300044694 | Bacteria | 778 |
| 419 | Ga0466964_0727946 | 3300044706 | Bacteria | 555 |
| 420 | Ga0466968_0069410 | 3300044735 | Bacteria | 1532 |
| 421 | Ga0466970_0260156 | 3300044765 | Bacteria | 973 |
| 422 | Ga0466970_0632831 | 3300044765 | Bacteria | 622 |
| 423 | Ga0466970_0775097 | 3300044765 | Bacteria | 561 |
| 424 | Ga0466957_0112079 | 3300044842 | Bacteria | 1731 |
| 425 | Ga0466960_0200160 | 3300044901 | Bacteria | 1091 |
| 426 | Ga0466960_0897424 | 3300044901 | Bacteria | 540 |
| 427 | Ga0466959_0073304 | 3300045049 | Bacteria | 2477 |
| 428 | Ga0466959_0103208 | 3300045049 | Bacteria | 2040 |
| 429 | Ga0466967_0156171 | 3300045976 | Bacteria | 2137 |
| 430 | Ga0466967_0213049 | 3300045976 | Bacteria | 1833 |
| 431 | Ga0466967_0594308 | 3300045976 | Bacteria | 1092 |
| 432 | Ga0495650_0021630 | 3300046471 | Bacteria | 3102 |
| 433 | Ga0495683_0222544 | 3300047323 | Bacteria | 841 |
| 434 | Ga0496100_0008800 | 3300048903 | Bacteria | 5645 |
| 435 | Ga0496100_0585565 | 3300048903 | Bacteria | 865 |
| 436 | Ga0496101_0049335 | 3300048904 | Bacteria | 3028 |
| 437 | Ga0496101_0771503 | 3300048904 | Bacteria | 758 |
| 438 | Ga0496102_0007262 | 3300048905 | Bacteria | 9458 |
| 439 | Ga0496102_0007888 | 3300048905 | Bacteria | 9096 |
| 440 | Ga0496102_0148473 | 3300048905 | Bacteria | 2201 |
| 441 | Ga0496102_0318840 | 3300048905 | Bacteria | 1464 |
| 442 | Ga0496102_0954322 | 3300048905 | Bacteria | 778 |
| 443 | Ga0496103_0003214 | 3300048906 | Bacteria | 10020 |
| 444 | Ga0496103_0081091 | 3300048906 | Bacteria | 2041 |
| 445 | Ga0496103_0358811 | 3300048906 | Bacteria | 937 |
| 446 | Ga0496104_0028273 | 3300048907 | Bacteria | 5197 |
| 447 | Ga0496104_0354999 | 3300048907 | Bacteria | 1379 |
| 448 | Ga0496105_0087658 | 3300048908 | Bacteria | 2572 |
| 449 | Ga0496105_0267449 | 3300048908 | Bacteria | 1381 |
| 450 | Ga0496106_0002557 | 3300048909 | Bacteria | 13524 |
| 451 | Ga0496106_0200908 | 3300048909 | Bacteria | 1586 |
| 452 | Ga0496107_0005329 | 3300048910 | Bacteria | 8792 |
| 453 | Ga0496107_1381850 | 3300048910 | Bacteria | 502 |
| 454 | Ga0496108_0000457 | 3300048911 | Bacteria | 32650 |
| 455 | Ga0496108_0573778 | 3300048911 | Bacteria | 983 |
| 456 | Ga0496109_0009547 | 3300048912 | Bacteria | 8269 |
| 457 | Ga0496109_0033243 | 3300048912 | Bacteria | 4639 |
| 458 | Ga0496109_0230257 | 3300048912 | Bacteria | 1743 |
| 459 | Ga0496110_0012624 | 3300048913 | Bacteria | 6949 |
| 460 | Ga0496110_0307017 | 3300048913 | Bacteria | 1445 |
| 461 | Ga0496111_0023251 | 3300048914 | Bacteria | 4351 |
| 462 | Ga0496112_0007283 | 3300048915 | Bacteria | 9806 |
| 463 | Ga0496112_0053102 | 3300048915 | Bacteria | 3979 |
| 464 | Ga0496112_0538513 | 3300048915 | Bacteria | 1102 |
| 465 | Ga0496113_0045656 | 3300048916 | Bacteria | 3250 |
| 466 | Ga0496113_0074281 | 3300048916 | Bacteria | 2592 |
| 467 | Ga0496113_0698166 | 3300048916 | Bacteria | 810 |
| 468 | Ga0496114_0002825 | 3300048917 | Bacteria | 13311 |
| 469 | Ga0496114_0983117 | 3300048917 | Bacteria | 727 |
| 470 | Ga0496115_0000532 | 3300048918 | Bacteria | 29685 |
| 471 | Ga0496115_0189244 | 3300048918 | Bacteria | 1700 |
| 472 | Ga0496118_0201352 | 3300048921 | Bacteria | 1179 |
| 473 | Ga0501034_0352727 | 3300049571 | Bacteria | 1399 |
| 474 | Ga0501067_0191273 | 3300049583 | Bacteria | 1140 |
| 475 | nmdc:mga03683_135793_c1 | 3300050489 | Bacteria | 1103 |
| 476 | nmdc:mga03683_43893_c1 | 3300050489 | Bacteria | 1846 |
| 477 | nmdc:mga03n38_242426_c1 | 3300050490 | Bacteria | 949 |
| 478 | nmdc:mga03n38_259135_c1 | 3300050490 | Bacteria | 921 |
| 479 | nmdc:mga03n38_264652_c1 | 3300050490 | Bacteria | 913 |
| 480 | nmdc:mga00v17_115897_c1 | 3300050491 | Bacteria | 1703 |
| 481 | nmdc:mga00v17_28677_c1 | 3300050491 | Bacteria | 3262 |
| 482 | nmdc:mga00v17_565105_c1 | 3300050491 | Bacteria | 735 |
| 483 | nmdc:mga0yw44_115188_c1 | 3300050492 | Bacteria | 1726 |
| 484 | nmdc:mga0yw44_43799_c1 | 3300050492 | Bacteria | 2674 |
| 485 | nmdc:mga06z11_139075_c1 | 3300050494 | Bacteria | 1371 |
| 486 | nmdc:mga06z11_520115_c1 | 3300050494 | Bacteria | 721 |
| 487 | nmdc:mga07m45_145499_c1 | 3300050496 | Bacteria | 1374 |
| 488 | nmdc:mga05p37_8977_c1 | 3300050507 | Bacteria | 11822 |
| 489 | nmdc:mga0qj67_36059_c1 | 3300050509 | Bacteria | 3868 |
| 490 | nmdc:mga0qj67_96709_c1 | 3300050509 | Bacteria | 2377 |
| 491 | nmdc:mga08y16_1093735_c1 | 3300050511 | Bacteria | 772 |
| 492 | nmdc:mga0sz30_20468_c1 | 3300050516 | Bacteria | 2669 |
| 493 | nmdc:mga0sz30_205643_c1 | 3300050516 | Bacteria | 874 |
| 494 | nmdc:mga0sz30_21808_c1 | 3300050516 | Bacteria | 2595 |
| 495 | nmdc:mga0sz30_2189_c1 | 3300050516 | Bacteria | 6987 |
| 496 | Ga0500616_0023893 | 3300053153 | Bacteria | 3401 |
| 497 | Ga0500616_0034291 | 3300053153 | Bacteria | 2765 |
| 498 | Ga0466962_0273408 | 3300061719 | Bacteria | 833 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041453 | Ga0451797_0325563 | Ga0451797_0325563_576_935 | 114 |
| 2 | 3300050490 | nmdc:mga03n38_259135_c1 | nmdc:mga03n38_259135_c1_555_905 | 116 |
| 3 | iso_pu_bacteria | 2738543011 | 2739239461 | 116 |
| 4 | iso_pu_bacteria | 2889300758 | 2889301879 | 116 |
| 5 | iso_pu_bacteria | 2939743619 | 2939747121 | 116 |
| 6 | 3300005336 | Ga0070680_100099174 | Ga0070680_1000991742 | 117 |
| 7 | 3300005458 | Ga0070681_10517377 | Ga0070681_105173771 | 117 |
| 8 | 3300005535 | Ga0070684_100222955 | Ga0070684_1002229552 | 117 |
| 9 | 3300020082 | Ga0206353_10210750 | Ga0206353_102107501 | 117 |
| 10 | iso_pu_bacteria | 2515154155 | 2515856917 | 118 |
| 11 | iso_pu_bacteria | 2929219909 | 2929224094 | 118 |
| 12 | 3300005347 | Ga0070668_100788745 | Ga0070668_1007887452 | 119 |
| 13 | 3300025972 | Ga0207668_10739423 | Ga0207668_107394231 | 119 |
| 14 | 3300031456 | Ga0307513_10000354 | Ga0307513_100003541 | 119 |
| 15 | iso_pu_bacteria | 2675903059 | 2676485211 | 119 |
| 16 | 3300005327 | Ga0070658_10461863 | Ga0070658_104618632 | 120 |
| 17 | 3300005329 | Ga0070683_100570873 | Ga0070683_1005708731 | 120 |
| 18 | 3300005336 | Ga0070680_100321454 | Ga0070680_1003214542 | 120 |
| 19 | 3300005337 | Ga0070682_100072258 | Ga0070682_1000722582 | 120 |
| 20 | 3300005339 | Ga0070660_100546729 | Ga0070660_1005467292 | 120 |
| 21 | 3300005539 | Ga0068853_101656140 | Ga0068853_1016561401 | 120 |
| 22 | 3300005614 | Ga0068856_101655694 | Ga0068856_1016556941 | 120 |
| 23 | 3300005618 | Ga0068864_100900150 | Ga0068864_1009001502 | 120 |
| 24 | 3300009148 | Ga0105243_10001473 | Ga0105243_1000147316 | 120 |
| 25 | 3300009551 | Ga0105238_10824177 | Ga0105238_108241772 | 120 |
| 26 | 3300025909 | Ga0207705_10547511 | Ga0207705_105475112 | 120 |
| 27 | 3300025924 | Ga0207694_10973189 | Ga0207694_109731891 | 120 |
| 28 | 3300025935 | Ga0207709_10005736 | Ga0207709_100057364 | 120 |
| 29 | 3300025944 | Ga0207661_10401605 | Ga0207661_104016052 | 120 |
| 30 | 3300026067 | Ga0207678_10442485 | Ga0207678_104424851 | 120 |
| 31 | 3300031824 | Ga0307413_10855224 | Ga0307413_108552241 | 120 |
| 32 | 3300037418 | Ga0395900_0909367 | Ga0395900_0909367_82_444 | 120 |
| 33 | 3300037466 | Ga0395898_0949684 | Ga0395898_0949684_301_663 | 120 |
| 34 | 3300038443 | Ga0395901_0005856 | Ga0395901_0005856_4879_5241 | 120 |
| 35 | 3300044683 | Ga0466965_0081076 | Ga0466965_0081076_836_1198 | 120 |
| 36 | 3300044683 | Ga0466965_0407873 | Ga0466965_0407873_276_638 | 120 |
| 37 | 3300044684 | Ga0466966_0206740 | Ga0466966_0206740_70_432 | 120 |
| 38 | 3300044693 | Ga0466961_0083977 | Ga0466961_0083977_893_1255 | 120 |
| 39 | 3300044694 | Ga0466963_0598913 | Ga0466963_0598913_390_752 | 120 |
| 40 | 3300044706 | Ga0466964_0727946 | Ga0466964_0727946_150_512 | 120 |
| 41 | 3300044765 | Ga0466970_0632831 | Ga0466970_0632831_238_600 | 120 |
| 42 | 3300044842 | Ga0466957_0112079 | Ga0466957_0112079_484_846 | 120 |
| 43 | 3300044901 | Ga0466960_0200160 | Ga0466960_0200160_189_560 | 120 |
| 44 | 3300045049 | Ga0466959_0103208 | Ga0466959_0103208_341_703 | 120 |
| 45 | 3300045976 | Ga0466967_0156171 | Ga0466967_0156171_157_519 | 120 |
| 46 | 3300045976 | Ga0466967_0594308 | Ga0466967_0594308_528_890 | 120 |
| 47 | 3300005327 | Ga0070658_10248629 | Ga0070658_102486292 | 121 |
| 48 | 3300005347 | Ga0070668_100066277 | Ga0070668_1000662773 | 121 |
| 49 | 3300005435 | Ga0070714_101311184 | Ga0070714_1013111841 | 121 |
| 50 | 3300005436 | Ga0070713_100224135 | Ga0070713_1002241353 | 121 |
| 51 | 3300005436 | Ga0070713_100706094 | Ga0070713_1007060943 | 121 |
| 52 | 3300005437 | Ga0070710_10007603 | Ga0070710_100076034 | 121 |
| 53 | 3300005616 | Ga0068852_101515544 | Ga0068852_1015155442 | 121 |
| 54 | 3300005719 | Ga0068861_100219051 | Ga0068861_1002190512 | 121 |
| 55 | 3300005840 | Ga0068870_10737220 | Ga0068870_107372201 | 121 |
| 56 | 3300005983 | Ga0081540_1315215 | Ga0081540_13152151 | 121 |
| 57 | 3300006173 | Ga0070716_100195107 | Ga0070716_1001951073 | 121 |
| 58 | 3300006175 | Ga0070712_100149413 | Ga0070712_1001494132 | 121 |
| 59 | 3300006358 | Ga0068871_100154803 | Ga0068871_1001548032 | 121 |
| 60 | 3300006844 | Ga0075428_100067536 | Ga0075428_1000675364 | 121 |
| 61 | 3300006846 | Ga0075430_100038984 | Ga0075430_1000389842 | 121 |
| 62 | 3300007788 | Ga0099795_10036096 | Ga0099795_100360963 | 121 |
| 63 | 3300009098 | Ga0105245_10906181 | Ga0105245_109061812 | 121 |
| 64 | 3300009147 | Ga0114129_10036631 | Ga0114129_100366314 | 121 |
| 65 | 3300009553 | Ga0105249_11250656 | Ga0105249_112506562 | 121 |
| 66 | 3300010159 | Ga0099796_10000940 | Ga0099796_100009406 | 121 |
| 67 | 3300010375 | Ga0105239_13331037 | Ga0105239_133310371 | 121 |
| 68 | 3300013105 | Ga0157369_11249420 | Ga0157369_112494201 | 121 |
| 69 | 3300013306 | Ga0163162_10066711 | Ga0163162_100667113 | 121 |
| 70 | 3300017792 | Ga0163161_10148639 | Ga0163161_101486395 | 121 |
| 71 | 3300025898 | Ga0207692_10099555 | Ga0207692_100995552 | 121 |
| 72 | 3300025915 | Ga0207693_10021145 | Ga0207693_100211456 | 121 |
| 73 | 3300025919 | Ga0207657_10056543 | Ga0207657_100565434 | 121 |
| 74 | 3300025928 | Ga0207700_10002648 | Ga0207700_100026487 | 121 |
| 75 | 3300025929 | Ga0207664_10090113 | Ga0207664_100901133 | 121 |
| 76 | 3300025933 | Ga0207706_10799016 | Ga0207706_107990161 | 121 |
| 77 | 3300025961 | Ga0207712_10447210 | Ga0207712_104472101 | 121 |
| 78 | 3300025972 | Ga0207668_10884178 | Ga0207668_108841781 | 121 |
| 79 | 3300026088 | Ga0207641_10508286 | Ga0207641_105082862 | 121 |
| 80 | 3300026118 | Ga0207675_100028291 | Ga0207675_1000282913 | 121 |
| 81 | 3300028794 | Ga0307515_10114399 | Ga0307515_101143992 | 121 |
| 82 | 3300031616 | Ga0307508_10342751 | Ga0307508_103427512 | 121 |
| 83 | 3300031824 | Ga0307413_11822437 | Ga0307413_118224372 | 121 |
| 84 | 3300041443 | Ga0451789_0582140 | Ga0451789_0582140_94_495 | 121 |
| 85 | 3300041451 | Ga0451791_0022331 | Ga0451791_0022331_458_829 | 121 |
| 86 | 3300044658 | Ga0466972_0050280 | Ga0466972_0050280_87_452 | 121 |
| 87 | 3300044735 | Ga0466968_0069410 | Ga0466968_0069410_898_1263 | 121 |
| 88 | 3300044765 | Ga0466970_0775097 | Ga0466970_0775097_118_492 | 121 |
| 89 | 3300045049 | Ga0466959_0073304 | Ga0466959_0073304_1905_2270 | 121 |
| 90 | 3300046471 | Ga0495650_0021630 | Ga0495650_0021630_882_1247 | 121 |
| 91 | 3300050507 | nmdc:mga05p37_8977_c1 | nmdc:mga05p37_8977_c1_7961_8326 | 121 |
| 92 | 3300050509 | nmdc:mga0qj67_36059_c1 | nmdc:mga0qj67_36059_c1_2457_2822 | 121 |
| 93 | 3300061719 | Ga0466962_0273408 | Ga0466962_0273408_160_534 | 121 |
| 94 | iso_pu_bacteria | 8023623736 | 8023624566 | 121 |
| 95 | 3300000545 | CNXas_1002483 | CNXas_10024832 | 122 |
| 96 | 3300001989 | JGI24739J22299_10027031 | JGI24739J22299_100270312 | 122 |
| 97 | 3300002070 | JGI24750J21931_1003490 | JGI24750J21931_10034904 | 122 |
| 98 | 3300002074 | JGI24748J21848_1004632 | JGI24748J21848_10046321 | 122 |
| 99 | 3300002077 | JGI24744J21845_10001047 | JGI24744J21845_100010472 | 122 |
| 100 | 3300002077 | JGI24744J21845_10006410 | JGI24744J21845_100064102 | 122 |
| 101 | 3300002244 | JGI24742J22300_10006862 | JGI24742J22300_100068622 | 122 |
| 102 | 3300005328 | Ga0070676_10156320 | Ga0070676_101563202 | 122 |
| 103 | 3300005328 | Ga0070676_10158004 | Ga0070676_101580042 | 122 |
| 104 | 3300005331 | Ga0070670_100035787 | Ga0070670_1000357873 | 122 |
| 105 | 3300005333 | Ga0070677_10544462 | Ga0070677_105444621 | 122 |
| 106 | 3300005334 | Ga0068869_100014660 | Ga0068869_1000146604 | 122 |
| 107 | 3300005334 | Ga0068869_100364543 | Ga0068869_1003645433 | 122 |
| 108 | 3300005335 | Ga0070666_10527015 | Ga0070666_105270151 | 122 |
| 109 | 3300005336 | Ga0070680_100203961 | Ga0070680_1002039613 | 122 |
| 110 | 3300005337 | Ga0070682_100110436 | Ga0070682_1001104361 | 122 |
| 111 | 3300005338 | Ga0068868_100013777 | Ga0068868_1000137774 | 122 |
| 112 | 3300005338 | Ga0068868_100371049 | Ga0068868_1003710492 | 122 |
| 113 | 3300005339 | Ga0070660_100129996 | Ga0070660_1001299963 | 122 |
| 114 | 3300005340 | Ga0070689_100050217 | Ga0070689_1000502175 | 122 |
| 115 | 3300005340 | Ga0070689_100074679 | Ga0070689_1000746793 | 122 |
| 116 | 3300005341 | Ga0070691_10014555 | Ga0070691_100145555 | 122 |
| 117 | 3300005341 | Ga0070691_10293687 | Ga0070691_102936872 | 122 |
| 118 | 3300005343 | Ga0070687_100181474 | Ga0070687_1001814743 | 122 |
| 119 | 3300005345 | Ga0070692_10169935 | Ga0070692_101699351 | 122 |
| 120 | 3300005347 | Ga0070668_100003753 | Ga0070668_10000375310 | 122 |
| 121 | 3300005347 | Ga0070668_100151189 | Ga0070668_1001511893 | 122 |
| 122 | 3300005347 | Ga0070668_100520384 | Ga0070668_1005203841 | 122 |
| 123 | 3300005347 | Ga0070668_101367818 | Ga0070668_1013678182 | 122 |
| 124 | 3300005353 | Ga0070669_100010231 | Ga0070669_1000102319 | 122 |
| 125 | 3300005353 | Ga0070669_100952037 | Ga0070669_1009520371 | 122 |
| 126 | 3300005355 | Ga0070671_100679092 | Ga0070671_1006790922 | 122 |
| 127 | 3300005355 | Ga0070671_101072194 | Ga0070671_1010721941 | 122 |
| 128 | 3300005356 | Ga0070674_100016151 | Ga0070674_1000161512 | 122 |
| 129 | 3300005356 | Ga0070674_100234565 | Ga0070674_1002345652 | 122 |
| 130 | 3300005364 | Ga0070673_100093163 | Ga0070673_1000931633 | 122 |
| 131 | 3300005365 | Ga0070688_100017460 | Ga0070688_1000174602 | 122 |
| 132 | 3300005365 | Ga0070688_100091666 | Ga0070688_1000916664 | 122 |
| 133 | 3300005366 | Ga0070659_100056881 | Ga0070659_1000568812 | 122 |
| 134 | 3300005366 | Ga0070659_100301867 | Ga0070659_1003018673 | 122 |
| 135 | 3300005367 | Ga0070667_100012373 | Ga0070667_1000123733 | 122 |
| 136 | 3300005367 | Ga0070667_100111614 | Ga0070667_1001116142 | 122 |
| 137 | 3300005367 | Ga0070667_100159921 | Ga0070667_1001599214 | 122 |
| 138 | 3300005367 | Ga0070667_102077825 | Ga0070667_1020778251 | 122 |
| 139 | 3300005435 | Ga0070714_100118338 | Ga0070714_1001183383 | 122 |
| 140 | 3300005435 | Ga0070714_100803992 | Ga0070714_1008039922 | 122 |
| 141 | 3300005436 | Ga0070713_100024986 | Ga0070713_1000249863 | 122 |
| 142 | 3300005436 | Ga0070713_100747217 | Ga0070713_1007472172 | 122 |
| 143 | 3300005437 | Ga0070710_10001806 | Ga0070710_100018062 | 122 |
| 144 | 3300005437 | Ga0070710_10055817 | Ga0070710_100558172 | 122 |
| 145 | 3300005438 | Ga0070701_10002037 | Ga0070701_100020376 | 122 |
| 146 | 3300005438 | Ga0070701_10043971 | Ga0070701_100439713 | 122 |
| 147 | 3300005439 | Ga0070711_100001387 | Ga0070711_1000013874 | 122 |
| 148 | 3300005439 | Ga0070711_100055229 | Ga0070711_1000552293 | 122 |
| 149 | 3300005440 | Ga0070705_100033280 | Ga0070705_1000332803 | 122 |
| 150 | 3300005441 | Ga0070700_100064398 | Ga0070700_1000643983 | 122 |
| 151 | 3300005441 | Ga0070700_100229739 | Ga0070700_1002297392 | 122 |
| 152 | 3300005444 | Ga0070694_100024605 | Ga0070694_1000246055 | 122 |
| 153 | 3300005444 | Ga0070694_100084582 | Ga0070694_1000845823 | 122 |
| 154 | 3300005455 | Ga0070663_100075871 | Ga0070663_1000758713 | 122 |
| 155 | 3300005456 | Ga0070678_100002489 | Ga0070678_1000024892 | 122 |
| 156 | 3300005456 | Ga0070678_100473825 | Ga0070678_1004738252 | 122 |
| 157 | 3300005457 | Ga0070662_100557492 | Ga0070662_1005574922 | 122 |
| 158 | 3300005457 | Ga0070662_100603905 | Ga0070662_1006039052 | 122 |
| 159 | 3300005458 | Ga0070681_11060375 | Ga0070681_110603752 | 122 |
| 160 | 3300005459 | Ga0068867_100176515 | Ga0068867_1001765152 | 122 |
| 161 | 3300005459 | Ga0068867_100719846 | Ga0068867_1007198462 | 122 |
| 162 | 3300005466 | Ga0070685_10490393 | Ga0070685_104903932 | 122 |
| 163 | 3300005466 | Ga0070685_10642735 | Ga0070685_106427352 | 122 |
| 164 | 3300005467 | Ga0070706_102078177 | Ga0070706_1020781771 | 122 |
| 165 | 3300005539 | Ga0068853_100003371 | Ga0068853_1000033715 | 122 |
| 166 | 3300005539 | Ga0068853_100308455 | Ga0068853_1003084553 | 122 |
| 167 | 3300005543 | Ga0070672_100467654 | Ga0070672_1004676542 | 122 |
| 168 | 3300005543 | Ga0070672_100643055 | Ga0070672_1006430551 | 122 |
| 169 | 3300005544 | Ga0070686_100079645 | Ga0070686_1000796452 | 122 |
| 170 | 3300005544 | Ga0070686_100339825 | Ga0070686_1003398251 | 122 |
| 171 | 3300005544 | Ga0070686_100430431 | Ga0070686_1004304312 | 122 |
| 172 | 3300005545 | Ga0070695_100113737 | Ga0070695_1001137372 | 122 |
| 173 | 3300005546 | Ga0070696_100002764 | Ga0070696_1000027642 | 122 |
| 174 | 3300005546 | Ga0070696_100054120 | Ga0070696_1000541203 | 122 |
| 175 | 3300005547 | Ga0070693_100111931 | Ga0070693_1001119312 | 122 |
| 176 | 3300005548 | Ga0070665_100011105 | Ga0070665_1000111059 | 122 |
| 177 | 3300005548 | Ga0070665_100032105 | Ga0070665_1000321056 | 122 |
| 178 | 3300005548 | Ga0070665_100326968 | Ga0070665_1003269683 | 122 |
| 179 | 3300005549 | Ga0070704_100005094 | Ga0070704_1000050944 | 122 |
| 180 | 3300005549 | Ga0070704_100256485 | Ga0070704_1002564853 | 122 |
| 181 | 3300005563 | Ga0068855_100104579 | Ga0068855_1001045792 | 122 |
| 182 | 3300005578 | Ga0068854_100004276 | Ga0068854_1000042762 | 122 |
| 183 | 3300005615 | Ga0070702_100056184 | Ga0070702_1000561843 | 122 |
| 184 | 3300005615 | Ga0070702_100640420 | Ga0070702_1006404201 | 122 |
| 185 | 3300005616 | Ga0068852_100050509 | Ga0068852_1000505092 | 122 |
| 186 | 3300005616 | Ga0068852_100180503 | Ga0068852_1001805032 | 122 |
| 187 | 3300005617 | Ga0068859_100143502 | Ga0068859_1001435022 | 122 |
| 188 | 3300005617 | Ga0068859_100160030 | Ga0068859_1001600302 | 122 |
| 189 | 3300005617 | Ga0068859_100776007 | Ga0068859_1007760071 | 122 |
| 190 | 3300005618 | Ga0068864_100279096 | Ga0068864_1002790962 | 122 |
| 191 | 3300005618 | Ga0068864_100803449 | Ga0068864_1008034491 | 122 |
| 192 | 3300005718 | Ga0068866_10000565 | Ga0068866_100005652 | 122 |
| 193 | 3300005718 | Ga0068866_10058383 | Ga0068866_100583833 | 122 |
| 194 | 3300005719 | Ga0068861_100000973 | Ga0068861_1000009739 | 122 |
| 195 | 3300005719 | Ga0068861_100233425 | Ga0068861_1002334252 | 122 |
| 196 | 3300005719 | Ga0068861_100316074 | Ga0068861_1003160742 | 122 |
| 197 | 3300005841 | Ga0068863_100118298 | Ga0068863_1001182984 | 122 |
| 198 | 3300005841 | Ga0068863_100412843 | Ga0068863_1004128431 | 122 |
| 199 | 3300005841 | Ga0068863_102703852 | Ga0068863_1027038521 | 122 |
| 200 | 3300005842 | Ga0068858_100004674 | Ga0068858_10000467410 | 122 |
| 201 | 3300005842 | Ga0068858_100020072 | Ga0068858_1000200725 | 122 |
| 202 | 3300005842 | Ga0068858_101041497 | Ga0068858_1010414972 | 122 |
| 203 | 3300005843 | Ga0068860_100005325 | Ga0068860_10000532512 | 122 |
| 204 | 3300005843 | Ga0068860_100040810 | Ga0068860_1000408102 | 122 |
| 205 | 3300005843 | Ga0068860_100089247 | Ga0068860_1000892472 | 122 |
| 206 | 3300005844 | Ga0068862_100182054 | Ga0068862_1001820544 | 122 |
| 207 | 3300005844 | Ga0068862_100286832 | Ga0068862_1002868321 | 122 |
| 208 | 3300005937 | Ga0081455_10168946 | Ga0081455_101689462 | 122 |
| 209 | 3300006038 | Ga0075365_10082689 | Ga0075365_100826892 | 122 |
| 210 | 3300006038 | Ga0075365_10109111 | Ga0075365_101091113 | 122 |
| 211 | 3300006042 | Ga0075368_10045192 | Ga0075368_100451922 | 122 |
| 212 | 3300006048 | Ga0075363_100003949 | Ga0075363_1000039495 | 122 |
| 213 | 3300006048 | Ga0075363_100069442 | Ga0075363_1000694424 | 122 |
| 214 | 3300006048 | Ga0075363_100072998 | Ga0075363_1000729983 | 122 |
| 215 | 3300006051 | Ga0075364_10023430 | Ga0075364_100234304 | 122 |
| 216 | 3300006051 | Ga0075364_10037736 | Ga0075364_100377365 | 122 |
| 217 | 3300006163 | Ga0070715_10007514 | Ga0070715_100075144 | 122 |
| 218 | 3300006163 | Ga0070715_10011082 | Ga0070715_100110823 | 122 |
| 219 | 3300006173 | Ga0070716_100003132 | Ga0070716_1000031324 | 122 |
| 220 | 3300006173 | Ga0070716_100016850 | Ga0070716_1000168505 | 122 |
| 221 | 3300006175 | Ga0070712_100000911 | Ga0070712_10000091110 | 122 |
| 222 | 3300006175 | Ga0070712_100018936 | Ga0070712_1000189362 | 122 |
| 223 | 3300006175 | Ga0070712_101061140 | Ga0070712_1010611401 | 122 |
| 224 | 3300006177 | Ga0075362_10035094 | Ga0075362_100350944 | 122 |
| 225 | 3300006177 | Ga0075362_10096644 | Ga0075362_100966442 | 122 |
| 226 | 3300006178 | Ga0075367_10125359 | Ga0075367_101253592 | 122 |
| 227 | 3300006186 | Ga0075369_10001174 | Ga0075369_1000117410 | 122 |
| 228 | 3300006186 | Ga0075369_10039010 | Ga0075369_100390104 | 122 |
| 229 | 3300006186 | Ga0075369_10068518 | Ga0075369_100685183 | 122 |
| 230 | 3300006237 | Ga0097621_100184725 | Ga0097621_1001847253 | 122 |
| 231 | 3300006237 | Ga0097621_100221209 | Ga0097621_1002212093 | 122 |
| 232 | 3300006353 | Ga0075370_10034799 | Ga0075370_100347992 | 122 |
| 233 | 3300006353 | Ga0075370_10052652 | Ga0075370_100526521 | 122 |
| 234 | 3300006358 | Ga0068871_100119139 | Ga0068871_1001191393 | 122 |
| 235 | 3300006881 | Ga0068865_100004101 | Ga0068865_1000041012 | 122 |
| 236 | 3300006881 | Ga0068865_100829085 | Ga0068865_1008290852 | 122 |
| 237 | 3300006931 | Ga0097620_100143492 | Ga0097620_1001434922 | 122 |
| 238 | 3300006931 | Ga0097620_100160026 | Ga0097620_1001600262 | 122 |
| 239 | 3300006931 | Ga0097620_100775979 | Ga0097620_1007759792 | 122 |
| 240 | 3300009092 | Ga0105250_10015700 | Ga0105250_100157005 | 122 |
| 241 | 3300009092 | Ga0105250_10050262 | Ga0105250_100502622 | 122 |
| 242 | 3300009098 | Ga0105245_10006864 | Ga0105245_1000686412 | 122 |
| 243 | 3300009098 | Ga0105245_10457541 | Ga0105245_104575412 | 122 |
| 244 | 3300009101 | Ga0105247_10017392 | Ga0105247_100173924 | 122 |
| 245 | 3300009101 | Ga0105247_10168307 | Ga0105247_101683072 | 122 |
| 246 | 3300009148 | Ga0105243_10064288 | Ga0105243_100642884 | 122 |
| 247 | 3300009148 | Ga0105243_10367406 | Ga0105243_103674062 | 122 |
| 248 | 3300009148 | Ga0105243_10436657 | Ga0105243_104366571 | 122 |
| 249 | 3300009174 | Ga0105241_10028680 | Ga0105241_100286802 | 122 |
| 250 | 3300009174 | Ga0105241_10716910 | Ga0105241_107169102 | 122 |
| 251 | 3300009176 | Ga0105242_10008103 | Ga0105242_1000810311 | 122 |
| 252 | 3300009176 | Ga0105242_10227962 | Ga0105242_102279624 | 122 |
| 253 | 3300009177 | Ga0105248_10021235 | Ga0105248_100212356 | 122 |
| 254 | 3300009177 | Ga0105248_10715821 | Ga0105248_107158212 | 122 |
| 255 | 3300009545 | Ga0105237_10519665 | Ga0105237_105196653 | 122 |
| 256 | 3300009553 | Ga0105249_10004275 | Ga0105249_100042754 | 122 |
| 257 | 3300009553 | Ga0105249_10048582 | Ga0105249_100485822 | 122 |
| 258 | 3300009553 | Ga0105249_10148814 | Ga0105249_101488143 | 122 |
| 259 | 3300009553 | Ga0105249_11528216 | Ga0105249_115282162 | 122 |
| 260 | 3300009553 | Ga0105249_12010518 | Ga0105249_120105181 | 122 |
| 261 | 3300010375 | Ga0105239_10032691 | Ga0105239_100326915 | 122 |
| 262 | 3300010375 | Ga0105239_10324880 | Ga0105239_103248802 | 122 |
| 263 | 3300011119 | Ga0105246_11294507 | Ga0105246_112945072 | 122 |
| 264 | 3300013104 | Ga0157370_10357386 | Ga0157370_103573863 | 122 |
| 265 | 3300013296 | Ga0157374_10164327 | Ga0157374_101643273 | 122 |
| 266 | 3300013296 | Ga0157374_10330145 | Ga0157374_103301452 | 122 |
| 267 | 3300013297 | Ga0157378_10007170 | Ga0157378_100071702 | 122 |
| 268 | 3300013306 | Ga0163162_10006580 | Ga0163162_1000658010 | 122 |
| 269 | 3300013306 | Ga0163162_10067581 | Ga0163162_100675814 | 122 |
| 270 | 3300013306 | Ga0163162_10332995 | Ga0163162_103329952 | 122 |
| 271 | 3300013306 | Ga0163162_13083170 | Ga0163162_130831701 | 122 |
| 272 | 3300013307 | Ga0157372_10046932 | Ga0157372_100469322 | 122 |
| 273 | 3300013307 | Ga0157372_10521000 | Ga0157372_105210003 | 122 |
| 274 | 3300013308 | Ga0157375_10006350 | Ga0157375_1000635012 | 122 |
| 275 | 3300013308 | Ga0157375_11064196 | Ga0157375_110641962 | 122 |
| 276 | 3300013308 | Ga0157375_13046947 | Ga0157375_130469471 | 122 |
| 277 | 3300014325 | Ga0163163_12453686 | Ga0163163_124536862 | 122 |
| 278 | 3300014326 | Ga0157380_10004957 | Ga0157380_100049573 | 122 |
| 279 | 3300014326 | Ga0157380_10802222 | Ga0157380_108022221 | 122 |
| 280 | 3300014745 | Ga0157377_10052721 | Ga0157377_100527212 | 122 |
| 281 | 3300014745 | Ga0157377_10325675 | Ga0157377_103256752 | 122 |
| 282 | 3300014968 | Ga0157379_10015673 | Ga0157379_100156738 | 122 |
| 283 | 3300014968 | Ga0157379_10125390 | Ga0157379_101253904 | 122 |
| 284 | 3300014968 | Ga0157379_11084894 | Ga0157379_110848942 | 122 |
| 285 | 3300014969 | Ga0157376_10120907 | Ga0157376_101209072 | 122 |
| 286 | 3300017792 | Ga0163161_10002621 | Ga0163161_1000262112 | 122 |
| 287 | 3300017792 | Ga0163161_10683258 | Ga0163161_106832582 | 122 |
| 288 | 3300017792 | Ga0163161_11073270 | Ga0163161_110732702 | 122 |
| 289 | 3300025711 | Ga0207696_1038243 | Ga0207696_10382433 | 122 |
| 290 | 3300025711 | Ga0207696_1124729 | Ga0207696_11247292 | 122 |
| 291 | 3300025885 | Ga0207653_10160600 | Ga0207653_101606002 | 122 |
| 292 | 3300025893 | Ga0207682_10440796 | Ga0207682_104407962 | 122 |
| 293 | 3300025898 | Ga0207692_10015837 | Ga0207692_100158374 | 122 |
| 294 | 3300025898 | Ga0207692_10191789 | Ga0207692_101917892 | 122 |
| 295 | 3300025899 | Ga0207642_10000708 | Ga0207642_100007084 | 122 |
| 296 | 3300025900 | Ga0207710_10030989 | Ga0207710_100309893 | 122 |
| 297 | 3300025900 | Ga0207710_10049935 | Ga0207710_100499352 | 122 |
| 298 | 3300025901 | Ga0207688_10001972 | Ga0207688_100019724 | 122 |
| 299 | 3300025904 | Ga0207647_10034071 | Ga0207647_100340712 | 122 |
| 300 | 3300025904 | Ga0207647_10064065 | Ga0207647_100640652 | 122 |
| 301 | 3300025905 | Ga0207685_10004420 | Ga0207685_100044202 | 122 |
| 302 | 3300025906 | Ga0207699_10044726 | Ga0207699_100447262 | 122 |
| 303 | 3300025906 | Ga0207699_10747851 | Ga0207699_107478512 | 122 |
| 304 | 3300025907 | Ga0207645_10028238 | Ga0207645_100282382 | 122 |
| 305 | 3300025907 | Ga0207645_10073944 | Ga0207645_100739443 | 122 |
| 306 | 3300025911 | Ga0207654_10065695 | Ga0207654_100656952 | 122 |
| 307 | 3300025911 | Ga0207654_10775102 | Ga0207654_107751022 | 122 |
| 308 | 3300025912 | Ga0207707_10968476 | Ga0207707_109684762 | 122 |
| 309 | 3300025914 | Ga0207671_10050657 | Ga0207671_100506575 | 122 |
| 310 | 3300025915 | Ga0207693_10000971 | Ga0207693_1000097112 | 122 |
| 311 | 3300025915 | Ga0207693_10023926 | Ga0207693_100239265 | 122 |
| 312 | 3300025915 | Ga0207693_10740401 | Ga0207693_107404011 | 122 |
| 313 | 3300025916 | Ga0207663_10002738 | Ga0207663_100027386 | 122 |
| 314 | 3300025916 | Ga0207663_10036460 | Ga0207663_100364603 | 122 |
| 315 | 3300025916 | Ga0207663_10133452 | Ga0207663_101334522 | 122 |
| 316 | 3300025917 | Ga0207660_10247175 | Ga0207660_102471753 | 122 |
| 317 | 3300025918 | Ga0207662_10216687 | Ga0207662_102166873 | 122 |
| 318 | 3300025919 | Ga0207657_10096327 | Ga0207657_100963272 | 122 |
| 319 | 3300025923 | Ga0207681_10010133 | Ga0207681_100101332 | 122 |
| 320 | 3300025925 | Ga0207650_10083797 | Ga0207650_100837972 | 122 |
| 321 | 3300025926 | Ga0207659_11137461 | Ga0207659_111374611 | 122 |
| 322 | 3300025927 | Ga0207687_10011446 | Ga0207687_100114464 | 122 |
| 323 | 3300025927 | Ga0207687_10461972 | Ga0207687_104619722 | 122 |
| 324 | 3300025928 | Ga0207700_10134012 | Ga0207700_101340121 | 122 |
| 325 | 3300025928 | Ga0207700_10900692 | Ga0207700_109006922 | 122 |
| 326 | 3300025929 | Ga0207664_10794195 | Ga0207664_107941952 | 122 |
| 327 | 3300025931 | Ga0207644_10008448 | Ga0207644_100084485 | 122 |
| 328 | 3300025932 | Ga0207690_10071666 | Ga0207690_100716665 | 122 |
| 329 | 3300025932 | Ga0207690_10691341 | Ga0207690_106913412 | 122 |
| 330 | 3300025932 | Ga0207690_10793134 | Ga0207690_107931341 | 122 |
| 331 | 3300025933 | Ga0207706_10011396 | Ga0207706_100113963 | 122 |
| 332 | 3300025933 | Ga0207706_10272190 | Ga0207706_102721903 | 122 |
| 333 | 3300025934 | Ga0207686_10003058 | Ga0207686_100030588 | 122 |
| 334 | 3300025934 | Ga0207686_10153587 | Ga0207686_101535871 | 122 |
| 335 | 3300025935 | Ga0207709_10357460 | Ga0207709_103574602 | 122 |
| 336 | 3300025935 | Ga0207709_10437715 | Ga0207709_104377152 | 122 |
| 337 | 3300025936 | Ga0207670_10176335 | Ga0207670_101763352 | 122 |
| 338 | 3300025936 | Ga0207670_10535380 | Ga0207670_105353802 | 122 |
| 339 | 3300025937 | Ga0207669_10123560 | Ga0207669_101235602 | 122 |
| 340 | 3300025937 | Ga0207669_10221237 | Ga0207669_102212372 | 122 |
| 341 | 3300025937 | Ga0207669_10305217 | Ga0207669_103052171 | 122 |
| 342 | 3300025937 | Ga0207669_10448876 | Ga0207669_104488762 | 122 |
| 343 | 3300025938 | Ga0207704_10006477 | Ga0207704_100064777 | 122 |
| 344 | 3300025938 | Ga0207704_10042580 | Ga0207704_100425803 | 122 |
| 345 | 3300025939 | Ga0207665_10042509 | Ga0207665_100425093 | 122 |
| 346 | 3300025939 | Ga0207665_10056168 | Ga0207665_100561682 | 122 |
| 347 | 3300025940 | Ga0207691_10297056 | Ga0207691_102970563 | 122 |
| 348 | 3300025941 | Ga0207711_10043700 | Ga0207711_100437001 | 122 |
| 349 | 3300025941 | Ga0207711_10168750 | Ga0207711_101687503 | 122 |
| 350 | 3300025942 | Ga0207689_10001719 | Ga0207689_1000171912 | 122 |
| 351 | 3300025942 | Ga0207689_10181326 | Ga0207689_101813263 | 122 |
| 352 | 3300025949 | Ga0207667_10204238 | Ga0207667_102042383 | 122 |
| 353 | 3300025949 | Ga0207667_10595281 | Ga0207667_105952812 | 122 |
| 354 | 3300025960 | Ga0207651_10029750 | Ga0207651_100297503 | 122 |
| 355 | 3300025961 | Ga0207712_10018400 | Ga0207712_100184005 | 122 |
| 356 | 3300025961 | Ga0207712_10199771 | Ga0207712_101997712 | 122 |
| 357 | 3300025961 | Ga0207712_10714284 | Ga0207712_107142841 | 122 |
| 358 | 3300025961 | Ga0207712_10940847 | Ga0207712_109408471 | 122 |
| 359 | 3300025972 | Ga0207668_10058876 | Ga0207668_100588762 | 122 |
| 360 | 3300025972 | Ga0207668_10061381 | Ga0207668_100613812 | 122 |
| 361 | 3300025972 | Ga0207668_10111674 | Ga0207668_101116743 | 122 |
| 362 | 3300025972 | Ga0207668_10627149 | Ga0207668_106271492 | 122 |
| 363 | 3300025972 | Ga0207668_10670342 | Ga0207668_106703421 | 122 |
| 364 | 3300025981 | Ga0207640_10062294 | Ga0207640_100622942 | 122 |
| 365 | 3300025986 | Ga0207658_10085018 | Ga0207658_100850182 | 122 |
| 366 | 3300025986 | Ga0207658_10107411 | Ga0207658_101074114 | 122 |
| 367 | 3300025986 | Ga0207658_10231407 | Ga0207658_102314073 | 122 |
| 368 | 3300026023 | Ga0207677_10058468 | Ga0207677_100584682 | 122 |
| 369 | 3300026023 | Ga0207677_10273985 | Ga0207677_102739852 | 122 |
| 370 | 3300026023 | Ga0207677_10357099 | Ga0207677_103570992 | 122 |
| 371 | 3300026023 | Ga0207677_10402457 | Ga0207677_104024572 | 122 |
| 372 | 3300026035 | Ga0207703_10136466 | Ga0207703_101364663 | 122 |
| 373 | 3300026035 | Ga0207703_10229849 | Ga0207703_102298491 | 122 |
| 374 | 3300026035 | Ga0207703_11128253 | Ga0207703_111282532 | 122 |
| 375 | 3300026041 | Ga0207639_10009009 | Ga0207639_100090095 | 122 |
| 376 | 3300026041 | Ga0207639_10162544 | Ga0207639_101625442 | 122 |
| 377 | 3300026067 | Ga0207678_10012234 | Ga0207678_100122344 | 122 |
| 378 | 3300026067 | Ga0207678_10123769 | Ga0207678_101237692 | 122 |
| 379 | 3300026075 | Ga0207708_10001627 | Ga0207708_100016279 | 122 |
| 380 | 3300026075 | Ga0207708_10004770 | Ga0207708_100047709 | 122 |
| 381 | 3300026075 | Ga0207708_10020548 | Ga0207708_100205485 | 122 |
| 382 | 3300026078 | Ga0207702_10589534 | Ga0207702_105895342 | 122 |
| 383 | 3300026088 | Ga0207641_10014725 | Ga0207641_100147255 | 122 |
| 384 | 3300026088 | Ga0207641_10490826 | Ga0207641_104908263 | 122 |
| 385 | 3300026089 | Ga0207648_10008258 | Ga0207648_100082582 | 122 |
| 386 | 3300026089 | Ga0207648_10029818 | Ga0207648_100298182 | 122 |
| 387 | 3300026089 | Ga0207648_10075000 | Ga0207648_100750003 | 122 |
| 388 | 3300026095 | Ga0207676_10296636 | Ga0207676_102966363 | 122 |
| 389 | 3300026095 | Ga0207676_10676603 | Ga0207676_106766032 | 122 |
| 390 | 3300026095 | Ga0207676_11700052 | Ga0207676_117000521 | 122 |
| 391 | 3300026118 | Ga0207675_100003328 | Ga0207675_10000332815 | 122 |
| 392 | 3300026118 | Ga0207675_100008751 | Ga0207675_1000087512 | 122 |
| 393 | 3300026118 | Ga0207675_100120644 | Ga0207675_1001206442 | 122 |
| 394 | 3300026121 | Ga0207683_10000571 | Ga0207683_1000057112 | 122 |
| 395 | 3300026121 | Ga0207683_10469740 | Ga0207683_104697402 | 122 |
| 396 | 3300026121 | Ga0207683_10791062 | Ga0207683_107910622 | 122 |
| 397 | 3300026121 | Ga0207683_11467566 | Ga0207683_114675661 | 122 |
| 398 | 3300026142 | Ga0207698_10513518 | Ga0207698_105135182 | 122 |
| 399 | 3300027866 | Ga0209813_10106451 | Ga0209813_101064512 | 122 |
| 400 | 3300028379 | Ga0268266_10014417 | Ga0268266_100144178 | 122 |
| 401 | 3300028379 | Ga0268266_10024364 | Ga0268266_100243645 | 122 |
| 402 | 3300028379 | Ga0268266_10102957 | Ga0268266_101029572 | 122 |
| 403 | 3300028380 | Ga0268265_10017387 | Ga0268265_100173874 | 122 |
| 404 | 3300028380 | Ga0268265_10391030 | Ga0268265_103910302 | 122 |
| 405 | 3300028381 | Ga0268264_10111151 | Ga0268264_101111514 | 122 |
| 406 | 3300028381 | Ga0268264_10417617 | Ga0268264_104176173 | 122 |
| 407 | 3300028381 | Ga0268264_11559088 | Ga0268264_115590882 | 122 |
| 408 | 3300028381 | Ga0268264_12304912 | Ga0268264_123049122 | 122 |
| 409 | 3300031824 | Ga0307413_11699927 | Ga0307413_116999271 | 122 |
| 410 | 3300032002 | Ga0307416_100885944 | Ga0307416_1008859443 | 122 |
| 411 | 3300032005 | Ga0307411_11591568 | Ga0307411_115915681 | 122 |
| 412 | 3300032126 | Ga0307415_102144663 | Ga0307415_1021446631 | 122 |
| 413 | 3300035085 | Ga0373929_0046374 | Ga0373929_0046374_500_868 | 122 |
| 414 | 3300035092 | Ga0373952_0171962 | Ga0373952_0171962_138_506 | 122 |
| 415 | 3300035114 | Ga0373939_0005508 | Ga0373939_0005508_396_764 | 122 |
| 416 | 3300035207 | Ga0373942_0141885 | Ga0373942_0141885_364_732 | 122 |
| 417 | 3300035241 | Ga0373961_0043568 | Ga0373961_0043568_280_648 | 122 |
| 418 | 3300035691 | Ga0373931_0012994 | Ga0373931_0012994_804_1172 | 122 |
| 419 | 3300035691 | Ga0373931_0043249 | Ga0373931_0043249_1390_1758 | 122 |
| 420 | 3300035695 | Ga0373927_0267921 | Ga0373927_0267921_640_1020 | 122 |
| 421 | 3300041410 | Ga0439461_0002815 | Ga0439461_0002815_770_1138 | 122 |
| 422 | 3300041410 | Ga0439461_0050530 | Ga0439461_0050530_12_380 | 122 |
| 423 | 3300041411 | Ga0439466_0019001 | Ga0439466_0019001_634_1002 | 122 |
| 424 | 3300041413 | Ga0439465_0002395 | Ga0439465_0002395_1421_1789 | 122 |
| 425 | 3300041413 | Ga0439465_0073610 | Ga0439465_0073610_696_1064 | 122 |
| 426 | 3300041501 | Ga0451845_0137376 | Ga0451845_0137376_449_817 | 122 |
| 427 | 3300041505 | Ga0451849_1158843 | Ga0451849_1158843_64_432 | 122 |
| 428 | 3300041512 | Ga0451853_1626027 | Ga0451853_1626027_331_699 | 122 |
| 429 | 3300041997 | Ga0439431_0004858 | Ga0439431_0004858_620_988 | 122 |
| 430 | 3300041997 | Ga0439431_0066387 | Ga0439431_0066387_307_675 | 122 |
| 431 | 3300042002 | Ga0439442_014859 | Ga0439442_014859_1209_1577 | 122 |
| 432 | 3300042002 | Ga0439442_038236 | Ga0439442_038236_367_735 | 122 |
| 433 | 3300042004 | Ga0439445_0027307 | Ga0439445_0027307_956_1324 | 122 |
| 434 | 3300042016 | Ga0439463_055358 | Ga0439463_055358_476_850 | 122 |
| 435 | 3300042137 | Ga0450902_096824 | Ga0450902_096824_123_497 | 122 |
| 436 | 3300042435 | Ga0439434_0023835 | Ga0439434_0023835_1244_1612 | 122 |
| 437 | 3300042436 | Ga0439435_0182950 | Ga0439435_0182950_190_567 | 122 |
| 438 | 3300042439 | Ga0439464_0141001 | Ga0439464_0141001_88_462 | 122 |
| 439 | 3300044658 | Ga0466972_0104722 | Ga0466972_0104722_467_835 | 122 |
| 440 | 3300044694 | Ga0466963_0550539 | Ga0466963_0550539_367_735 | 122 |
| 441 | 3300044765 | Ga0466970_0260156 | Ga0466970_0260156_351_719 | 122 |
| 442 | 3300044901 | Ga0466960_0897424 | Ga0466960_0897424_159_527 | 122 |
| 443 | 3300045976 | Ga0466967_0213049 | Ga0466967_0213049_902_1270 | 122 |
| 444 | 3300047323 | Ga0495683_0222544 | Ga0495683_0222544_231_599 | 122 |
| 445 | 3300048903 | Ga0496100_0008800 | Ga0496100_0008800_3719_4087 | 122 |
| 446 | 3300048903 | Ga0496100_0585565 | Ga0496100_0585565_109_477 | 122 |
| 447 | 3300048904 | Ga0496101_0049335 | Ga0496101_0049335_2083_2451 | 122 |
| 448 | 3300048904 | Ga0496101_0771503 | Ga0496101_0771503_68_436 | 122 |
| 449 | 3300048905 | Ga0496102_0007262 | Ga0496102_0007262_8213_8581 | 122 |
| 450 | 3300048905 | Ga0496102_0007888 | Ga0496102_0007888_3563_3931 | 122 |
| 451 | 3300048905 | Ga0496102_0148473 | Ga0496102_0148473_1136_1504 | 122 |
| 452 | 3300048905 | Ga0496102_0318840 | Ga0496102_0318840_732_1100 | 122 |
| 453 | 3300048905 | Ga0496102_0954322 | Ga0496102_0954322_65_433 | 122 |
| 454 | 3300048906 | Ga0496103_0003214 | Ga0496103_0003214_872_1240 | 122 |
| 455 | 3300048906 | Ga0496103_0081091 | Ga0496103_0081091_301_669 | 122 |
| 456 | 3300048906 | Ga0496103_0358811 | Ga0496103_0358811_230_598 | 122 |
| 457 | 3300048907 | Ga0496104_0028273 | Ga0496104_0028273_3374_3742 | 122 |
| 458 | 3300048907 | Ga0496104_0354999 | Ga0496104_0354999_699_1067 | 122 |
| 459 | 3300048908 | Ga0496105_0087658 | Ga0496105_0087658_1017_1385 | 122 |
| 460 | 3300048908 | Ga0496105_0267449 | Ga0496105_0267449_487_855 | 122 |
| 461 | 3300048909 | Ga0496106_0002557 | Ga0496106_0002557_3907_4275 | 122 |
| 462 | 3300048909 | Ga0496106_0200908 | Ga0496106_0200908_1206_1574 | 122 |
| 463 | 3300048910 | Ga0496107_0005329 | Ga0496107_0005329_999_1367 | 122 |
| 464 | 3300048910 | Ga0496107_1381850 | Ga0496107_1381850_21_389 | 122 |
| 465 | 3300048911 | Ga0496108_0000457 | Ga0496108_0000457_25678_26046 | 122 |
| 466 | 3300048911 | Ga0496108_0573778 | Ga0496108_0573778_321_689 | 122 |
| 467 | 3300048912 | Ga0496109_0009547 | Ga0496109_0009547_939_1307 | 122 |
| 468 | 3300048912 | Ga0496109_0033243 | Ga0496109_0033243_3111_3479 | 122 |
| 469 | 3300048912 | Ga0496109_0230257 | Ga0496109_0230257_426_794 | 122 |
| 470 | 3300048913 | Ga0496110_0012624 | Ga0496110_0012624_913_1281 | 122 |
| 471 | 3300048913 | Ga0496110_0307017 | Ga0496110_0307017_316_684 | 122 |
| 472 | 3300048914 | Ga0496111_0023251 | Ga0496111_0023251_197_565 | 122 |
| 473 | 3300048915 | Ga0496112_0007283 | Ga0496112_0007283_1704_2072 | 122 |
| 474 | 3300048915 | Ga0496112_0053102 | Ga0496112_0053102_3055_3423 | 122 |
| 475 | 3300048915 | Ga0496112_0538513 | Ga0496112_0538513_575_943 | 122 |
| 476 | 3300048916 | Ga0496113_0045656 | Ga0496113_0045656_2562_2930 | 122 |
| 477 | 3300048916 | Ga0496113_0074281 | Ga0496113_0074281_995_1363 | 122 |
| 478 | 3300048916 | Ga0496113_0698166 | Ga0496113_0698166_426_794 | 122 |
| 479 | 3300048917 | Ga0496114_0002825 | Ga0496114_0002825_4240_4608 | 122 |
| 480 | 3300048917 | Ga0496114_0983117 | Ga0496114_0983117_301_669 | 122 |
| 481 | 3300048918 | Ga0496115_0000532 | Ga0496115_0000532_1434_1802 | 122 |
| 482 | 3300048918 | Ga0496115_0189244 | Ga0496115_0189244_416_784 | 122 |
| 483 | 3300048921 | Ga0496118_0201352 | Ga0496118_0201352_725_1093 | 122 |
| 484 | 3300049571 | Ga0501034_0352727 | Ga0501034_0352727_215_586 | 122 |
| 485 | 3300049583 | Ga0501067_0191273 | Ga0501067_0191273_198_566 | 122 |
| 486 | 3300050489 | nmdc:mga03683_135793_c1 | nmdc:mga03683_135793_c1_610_978 | 122 |
| 487 | 3300050489 | nmdc:mga03683_43893_c1 | nmdc:mga03683_43893_c1_451_819 | 122 |
| 488 | 3300050490 | nmdc:mga03n38_242426_c1 | nmdc:mga03n38_242426_c1_14_382 | 122 |
| 489 | 3300050490 | nmdc:mga03n38_264652_c1 | nmdc:mga03n38_264652_c1_398_766 | 122 |
| 490 | 3300050491 | nmdc:mga00v17_115897_c1 | nmdc:mga00v17_115897_c1_540_908 | 122 |
| 491 | 3300050491 | nmdc:mga00v17_28677_c1 | nmdc:mga00v17_28677_c1_1412_1780 | 122 |
| 492 | 3300050491 | nmdc:mga00v17_565105_c1 | nmdc:mga00v17_565105_c1_127_495 | 122 |
| 493 | 3300050492 | nmdc:mga0yw44_115188_c1 | nmdc:mga0yw44_115188_c1_624_992 | 122 |
| 494 | 3300050492 | nmdc:mga0yw44_43799_c1 | nmdc:mga0yw44_43799_c1_480_848 | 122 |
| 495 | 3300050494 | nmdc:mga06z11_139075_c1 | nmdc:mga06z11_139075_c1_412_780 | 122 |
| 496 | 3300050494 | nmdc:mga06z11_520115_c1 | nmdc:mga06z11_520115_c1_40_408 | 122 |
| 497 | 3300050496 | nmdc:mga07m45_145499_c1 | nmdc:mga07m45_145499_c1_786_1154 | 122 |
| 498 | 3300050509 | nmdc:mga0qj67_96709_c1 | nmdc:mga0qj67_96709_c1_375_749 | 122 |
| 499 | 3300050511 | nmdc:mga08y16_1093735_c1 | nmdc:mga08y16_1093735_c1_90_464 | 122 |
| 500 | 3300050516 | nmdc:mga0sz30_20468_c1 | nmdc:mga0sz30_20468_c1_981_1349 | 122 |
| 501 | 3300050516 | nmdc:mga0sz30_205643_c1 | nmdc:mga0sz30_205643_c1_32_400 | 122 |
| 502 | 3300050516 | nmdc:mga0sz30_21808_c1 | nmdc:mga0sz30_21808_c1_842_1219 | 122 |
| 503 | 3300050516 | nmdc:mga0sz30_2189_c1 | nmdc:mga0sz30_2189_c1_5754_6122 | 122 |
| 504 | 3300053153 | Ga0500616_0023893 | Ga0500616_0023893_908_1276 | 122 |
| 505 | 3300053153 | Ga0500616_0034291 | Ga0500616_0034291_2277_2645 | 122 |
| 506 | iso_pu_bacteria | 2671180195 | 2671833876 | 122 |
| 507 | iso_pu_bacteria | 2773857922 | 2774852032 | 122 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dxo-assembly1.cif.gz_A | crystal structure of a putative isomerase of the snoal-like family (atu_0744) from agrobacterium tumefaciens str. c58 at 2.70 a resolution | 0.9585 | 1 | 116 |
| 3dxo-assembly1.cif.gz_A | crystal structure of a putative isomerase of the snoal-like family (atu_0744) from agrobacterium tumefaciens str. c58 at 2.70 a resolution | 0.9426 | 1 | 116 |
| 6x1i-assembly1.cif.gz_B | two-component d3 assembly constructed by fusing symmetric oligomers to coiled coils | 0.9325 | 2 | 116 |
| 6x1i-assembly1.cif.gz_B | two-component d3 assembly constructed by fusing symmetric oligomers to coiled coils | 0.8747 | 2 | 116 |
| 4kvh-assembly1.cif.gz_A-2 | crystal structure of ketosteroid isomerase fold protein hmuk_0747 | 0.862 | 4 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dxoA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9697 | 4 | 116 | 3.10.450.50 |
| 3dxoA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9366 | 4 | 116 | 3.10.450.50 |
| 4kvhA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.862 | 4 | 117 | 3.10.450.50 |
| 4u13B00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8365 | 6 | 113 | 3.10.450.50 |
| af_K7K592_75_198_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8276 | 5 | 116 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A239D9F2-F1-model_v4 | SnoaL-like domain-containing protein | 0.9953 | 6 | 122 |
|
| AF-A0A2T0TQF5-F1-model_v4 | SnoaL-like protein | 0.9939 | 56 | 120 |
|
| AF-A0A7J5CJ40-F1-model_v4 | Nuclear transport factor 2 family protein | 0.9935 | 6 | 120 |
|
| AF-A0A852ZKQ3-F1-model_v4 | SnoaL-like domain-containing protein | 0.9929 | 36 | 120 |
|
| AF-A0A0A1PQQ6-F1-model_v4 | SnoaL-like domain protein | 0.9923 | 1 | 120 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar