F456642
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 507 | 331 | 483 | 180 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100352820|Ga0070714_1003528202 |
| Length | 213 |
| Sequence | MRFTVAPVNTEVYGCDIMSDQLSVRDWLDQGLKTLAERGFTALKAEPLAKALGVSRGSFYWHFSDVGAYHAAILKYWREVAAERVIADIEAAADNESPLKILLRQAFSGRLALERAVRSWATVDPAAKGAVQAIDRRRLDYIDGQLQALGLPCAVAQARAQILYWAFVGHALSDRPPLKARQDTLIEELLRMAYGDASGAPVLEPRQKPEKKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 3 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 4 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 5 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 6 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 7 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 8 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 9 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 10 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 11 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 12 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 13 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 14 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 15 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 16 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 17 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 18 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 19 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 20 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 21 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 22 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 23 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 24 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 25 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 85 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 116 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 117 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 118 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 119 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 122 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 169 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 170 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 171 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 176 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 177 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 179 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 180 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 188 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 194 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 195 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 196 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 197 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 198 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 199 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 200 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 201 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 202 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 203 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 204 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 205 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 206 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 207 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 208 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 280 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 281 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 282 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 283 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 284 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 286 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 287 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 288 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 289 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 290 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 291 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 292 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 293 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 302 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 304 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 306 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 307 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 308 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 309 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 310 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 311 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 312 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 313 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 314 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 315 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 317 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 318 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 319 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 320 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 321 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 322 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 324 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 325 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 326 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 327 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 328 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 329 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 330 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 331 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.45 |
| Metatranscriptomes | 0 |
| Isolates | 4.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.43 |
| Nodule | 4.54 |
| Rhizoplane | 1.58 |
| Rhizosphere | 75.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10225435 | 3300003320 | Bacteria | 1533 |
| 2 | rootL2_10116603 | 3300003322 | Bacteria | 2481 |
| 3 | rootH1_10215295 | 3300003323 | Bacteria | 2596 |
| 4 | JGI25160J50197_1014932 | 3300003354 | Bacteria | 2572 |
| 5 | JGI25404J52841_10008363 | 3300003659 | Bacteria | 2202 |
| 6 | Ga0055543_1032902 | 3300004625 | Bacteria | 899 |
| 7 | Ga0070683_100819375 | 3300005329 | Bacteria | 892 |
| 8 | Ga0068869_100106951 | 3300005334 | Bacteria | 2123 |
| 9 | Ga0070666_10459608 | 3300005335 | Bacteria | 920 |
| 10 | Ga0070680_100038719 | 3300005336 | Bacteria | 3857 |
| 11 | Ga0070680_100064607 | 3300005336 | Bacteria | 2999 |
| 12 | Ga0070682_100027943 | 3300005337 | Bacteria | 3389 |
| 13 | Ga0070682_100067452 | 3300005337 | Bacteria | 2279 |
| 14 | Ga0070660_100025078 | 3300005339 | Bacteria | 4430 |
| 15 | Ga0070660_100546954 | 3300005339 | Bacteria | 966 |
| 16 | Ga0070668_100151717 | 3300005347 | Bacteria | 1874 |
| 17 | Ga0070668_100676528 | 3300005347 | Bacteria | 908 |
| 18 | Ga0070669_100621420 | 3300005353 | Bacteria | 907 |
| 19 | Ga0070675_100837557 | 3300005354 | Bacteria | 841 |
| 20 | Ga0070671_100136679 | 3300005355 | Bacteria | 2067 |
| 21 | Ga0070659_100418548 | 3300005366 | Bacteria | 1133 |
| 22 | Ga0070709_10001335 | 3300005434 | Bacteria | 13459 |
| 23 | Ga0070709_10018092 | 3300005434 | Bacteria | 4052 |
| 24 | Ga0070709_10132209 | 3300005434 | Unclassified | 1705 |
| 25 | Ga0070709_10147600 | 3300005434 | Bacteria | 1622 |
| 26 | Ga0070709_10174607 | 3300005434 | Bacteria | 1504 |
| 27 | Ga0070709_10234074 | 3300005434 | Bacteria | 1316 |
| 28 | Ga0070714_100016284 | 3300005435 | Bacteria | 5998 |
| 29 | Ga0070714_100352820 | 3300005435 | Bacteria | 1382 |
| 30 | Ga0070714_100472167 | 3300005435 | Bacteria | 1194 |
| 31 | Ga0070713_100004922 | 3300005436 | Bacteria | 9066 |
| 32 | Ga0070713_100122908 | 3300005436 | Bacteria | 2279 |
| 33 | Ga0070713_100136475 | 3300005436 | Bacteria | 2168 |
| 34 | Ga0070713_100344714 | 3300005436 | Bacteria | 1381 |
| 35 | Ga0070713_100577429 | 3300005436 | Bacteria | 1066 |
| 36 | Ga0070710_10082375 | 3300005437 | Bacteria | 1881 |
| 37 | Ga0070710_10150392 | 3300005437 | Bacteria | 1435 |
| 38 | Ga0070710_10261406 | 3300005437 | Bacteria | 1116 |
| 39 | Ga0070710_10348000 | 3300005437 | Bacteria | 980 |
| 40 | Ga0070711_100036048 | 3300005439 | Bacteria | 3312 |
| 41 | Ga0070711_100046199 | 3300005439 | Bacteria | 2965 |
| 42 | Ga0070711_100049485 | 3300005439 | Bacteria | 2878 |
| 43 | Ga0070663_100442631 | 3300005455 | Bacteria | 1070 |
| 44 | Ga0070663_100463427 | 3300005455 | Bacteria | 1047 |
| 45 | Ga0070678_100012480 | 3300005456 | Bacteria | 5284 |
| 46 | Ga0070662_100072072 | 3300005457 | Bacteria | 2549 |
| 47 | Ga0070681_10013576 | 3300005458 | Bacteria | 8103 |
| 48 | Ga0070681_10069568 | 3300005458 | Bacteria | 3486 |
| 49 | Ga0070706_100246318 | 3300005467 | Bacteria | 1669 |
| 50 | Ga0070706_100305629 | 3300005467 | Bacteria | 1484 |
| 51 | Ga0070707_100153903 | 3300005468 | Bacteria | 2239 |
| 52 | Ga0070707_100503350 | 3300005468 | Bacteria | 1173 |
| 53 | Ga0070707_101391196 | 3300005468 | Bacteria | 668 |
| 54 | Ga0070698_100493600 | 3300005471 | Bacteria | 1162 |
| 55 | Ga0070698_100593601 | 3300005471 | Bacteria | 1048 |
| 56 | Ga0070699_100754667 | 3300005518 | Bacteria | 890 |
| 57 | Ga0070679_100135841 | 3300005530 | Bacteria | 2440 |
| 58 | Ga0070679_100192758 | 3300005530 | Bacteria | 2006 |
| 59 | Ga0070697_100160053 | 3300005536 | Bacteria | 1902 |
| 60 | Ga0070697_101257664 | 3300005536 | Bacteria | 660 |
| 61 | Ga0070686_100319201 | 3300005544 | Bacteria | 1158 |
| 62 | Ga0070665_100102858 | 3300005548 | Bacteria | 2860 |
| 63 | Ga0070665_100594619 | 3300005548 | Bacteria | 1119 |
| 64 | Ga0068855_100133256 | 3300005563 | Bacteria | 2836 |
| 65 | Ga0068855_100206221 | 3300005563 | Bacteria | 2211 |
| 66 | Ga0068855_100330575 | 3300005563 | Bacteria | 1683 |
| 67 | Ga0070664_100365949 | 3300005564 | Bacteria | 1314 |
| 68 | Ga0070664_101030205 | 3300005564 | Bacteria | 774 |
| 69 | Ga0068857_100272864 | 3300005577 | Bacteria | 1554 |
| 70 | Ga0068852_100916285 | 3300005616 | Bacteria | 894 |
| 71 | Ga0068859_101031854 | 3300005617 | Bacteria | 904 |
| 72 | Ga0068864_101195696 | 3300005618 | Bacteria | 759 |
| 73 | Ga0068851_10029667 | 3300005834 | Bacteria | 2709 |
| 74 | Ga0068863_100129956 | 3300005841 | Bacteria | 2404 |
| 75 | Ga0068858_100259835 | 3300005842 | Bacteria | 1650 |
| 76 | Ga0068860_100831377 | 3300005843 | Bacteria | 938 |
| 77 | Ga0068862_100084875 | 3300005844 | Bacteria | 2751 |
| 78 | Ga0068862_100210554 | 3300005844 | Bacteria | 1756 |
| 79 | Ga0081455_10016558 | 3300005937 | Bacteria | 7112 |
| 80 | Ga0081455_10039096 | 3300005937 | Bacteria | 4196 |
| 81 | Ga0081540_1002536 | 3300005983 | Bacteria | 14814 |
| 82 | Ga0081540_1004921 | 3300005983 | Bacteria | 10059 |
| 83 | Ga0081540_1006135 | 3300005983 | Bacteria | 8827 |
| 84 | Ga0081540_1007733 | 3300005983 | Bacteria | 7613 |
| 85 | Ga0081540_1029010 | 3300005983 | Bacteria | 3092 |
| 86 | Ga0081540_1030690 | 3300005983 | Bacteria | 2972 |
| 87 | Ga0081540_1042158 | 3300005983 | Bacteria | 2357 |
| 88 | Ga0081540_1081047 | 3300005983 | Bacteria | 1461 |
| 89 | Ga0070717_10007835 | 3300006028 | Bacteria | 7949 |
| 90 | Ga0070717_10094512 | 3300006028 | Bacteria | 2529 |
| 91 | Ga0075365_10305637 | 3300006038 | Bacteria | 1119 |
| 92 | Ga0075365_10354737 | 3300006038 | Bacteria | 1034 |
| 93 | Ga0075365_10458178 | 3300006038 | Bacteria | 900 |
| 94 | Ga0075363_100053139 | 3300006048 | Bacteria | 2164 |
| 95 | Ga0070715_10003126 | 3300006163 | Bacteria | 5202 |
| 96 | Ga0070715_10171846 | 3300006163 | Bacteria | 1080 |
| 97 | Ga0070716_100007047 | 3300006173 | Bacteria | 5516 |
| 98 | Ga0070716_100073602 | 3300006173 | Bacteria | 2016 |
| 99 | Ga0070716_100125486 | 3300006173 | Bacteria | 1614 |
| 100 | Ga0070716_100155261 | 3300006173 | Bacteria | 1477 |
| 101 | Ga0070712_100018869 | 3300006175 | Bacteria | 4488 |
| 102 | Ga0070712_100022114 | 3300006175 | Bacteria | 4184 |
| 103 | Ga0070712_100324680 | 3300006175 | Bacteria | 1252 |
| 104 | Ga0070712_100433218 | 3300006175 | Bacteria | 1092 |
| 105 | Ga0075362_10053861 | 3300006177 | Bacteria | 1807 |
| 106 | Ga0075362_10164161 | 3300006177 | Bacteria | 1070 |
| 107 | Ga0075367_10129915 | 3300006178 | Bacteria | 1557 |
| 108 | Ga0075369_10043584 | 3300006186 | Unclassified | 1926 |
| 109 | Ga0075369_10047092 | 3300006186 | Bacteria | 1859 |
| 110 | Ga0075369_10103336 | 3300006186 | Bacteria | 1280 |
| 111 | Ga0075369_10278318 | 3300006186 | Bacteria | 779 |
| 112 | Ga0097621_101542228 | 3300006237 | Bacteria | 631 |
| 113 | Ga0068871_100122484 | 3300006358 | Bacteria | 2198 |
| 114 | Ga0068871_100132309 | 3300006358 | Bacteria | 2116 |
| 115 | Ga0075430_100069585 | 3300006846 | Bacteria | 2952 |
| 116 | Ga0075431_100006409 | 3300006847 | Bacteria | 11679 |
| 117 | Ga0075434_100616637 | 3300006871 | Bacteria | 1104 |
| 118 | Ga0075429_100007594 | 3300006880 | Bacteria | 9416 |
| 119 | Ga0075436_100091485 | 3300006914 | Bacteria | 2115 |
| 120 | Ga0097620_101031886 | 3300006931 | Bacteria | 904 |
| 121 | Ga0099824_1017750 | 3300006942 | Bacteria | 6059 |
| 122 | Ga0099822_1040583 | 3300006943 | Bacteria | 2577 |
| 123 | Ga0075435_100969296 | 3300007076 | Bacteria | 742 |
| 124 | Ga0105240_10006681 | 3300009093 | Bacteria | 16912 |
| 125 | Ga0105240_10295206 | 3300009093 | Bacteria | 1856 |
| 126 | Ga0105240_10328961 | 3300009093 | Bacteria | 1739 |
| 127 | Ga0111539_10008018 | 3300009094 | Bacteria | 13471 |
| 128 | Ga0111539_11122509 | 3300009094 | Bacteria | 913 |
| 129 | Ga0111539_11593094 | 3300009094 | Bacteria | 757 |
| 130 | Ga0105245_10020480 | 3300009098 | Bacteria | 5801 |
| 131 | Ga0105245_11291332 | 3300009098 | Bacteria | 779 |
| 132 | Ga0105247_10265480 | 3300009101 | Bacteria | 1178 |
| 133 | Ga0105247_10561964 | 3300009101 | Bacteria | 840 |
| 134 | Ga0114129_10000066 | 3300009147 | Bacteria | 93802 |
| 135 | Ga0105243_10539446 | 3300009148 | Bacteria | 1112 |
| 136 | Ga0105243_10871987 | 3300009148 | Bacteria | 893 |
| 137 | Ga0105241_10031944 | 3300009174 | Bacteria | 3943 |
| 138 | Ga0105241_10065200 | 3300009174 | Bacteria | 2814 |
| 139 | Ga0105242_11922289 | 3300009176 | Bacteria | 632 |
| 140 | Ga0105248_10029743 | 3300009177 | Bacteria | 6096 |
| 141 | Ga0105248_10212719 | 3300009177 | Bacteria | 2178 |
| 142 | Ga0105237_10009981 | 3300009545 | Bacteria | 10133 |
| 143 | Ga0105237_10027277 | 3300009545 | Bacteria | 5831 |
| 144 | Ga0105237_10071238 | 3300009545 | Bacteria | 3471 |
| 145 | Ga0105237_10676891 | 3300009545 | Bacteria | 1038 |
| 146 | Ga0105238_10052285 | 3300009551 | Bacteria | 4106 |
| 147 | Ga0105238_10321517 | 3300009551 | Bacteria | 1533 |
| 148 | Ga0105238_10633499 | 3300009551 | Bacteria | 1078 |
| 149 | Ga0105249_10382173 | 3300009553 | Bacteria | 1434 |
| 150 | Ga0105249_10865711 | 3300009553 | Bacteria | 970 |
| 151 | Ga0099796_10011420 | 3300010159 | Bacteria | 2478 |
| 152 | Ga0105239_10021820 | 3300010375 | Bacteria | 7059 |
| 153 | Ga0105239_10172651 | 3300010375 | Bacteria | 2418 |
| 154 | Ga0105239_10464237 | 3300010375 | Bacteria | 1437 |
| 155 | Ga0105239_10729002 | 3300010375 | Bacteria | 1134 |
| 156 | Ga0105239_10924470 | 3300010375 | Bacteria | 1001 |
| 157 | Ga0105246_10108941 | 3300011119 | Bacteria | 2031 |
| 158 | Ga0157371_10157398 | 3300013102 | Bacteria | 1622 |
| 159 | Ga0157370_10066724 | 3300013104 | Bacteria | 3402 |
| 160 | Ga0157369_10022233 | 3300013105 | Bacteria | 7083 |
| 161 | Ga0157374_11411810 | 3300013296 | Bacteria | 719 |
| 162 | Ga0157378_10087963 | 3300013297 | Bacteria | 2819 |
| 163 | Ga0157378_10694451 | 3300013297 | Bacteria | 1036 |
| 164 | Ga0163162_10436371 | 3300013306 | Bacteria | 1442 |
| 165 | Ga0157372_11468592 | 3300013307 | Bacteria | 786 |
| 166 | Ga0157375_10626091 | 3300013308 | Bacteria | 1234 |
| 167 | Ga0163163_11210697 | 3300014325 | Bacteria | 818 |
| 168 | Ga0157380_10820688 | 3300014326 | Bacteria | 949 |
| 169 | Ga0157377_10344122 | 3300014745 | Bacteria | 998 |
| 170 | Ga0157379_10233269 | 3300014968 | Bacteria | 1668 |
| 171 | Ga0157376_10145980 | 3300014969 | Bacteria | 2128 |
| 172 | Ga0157376_10759630 | 3300014969 | Bacteria | 979 |
| 173 | Ga0157376_12082861 | 3300014969 | Bacteria | 606 |
| 174 | Ga0214544_1000016 | 3300021320 | Bacteria | 204278 |
| 175 | Ga0214542_1000016 | 3300021321 | Bacteria | 210332 |
| 176 | Ga0214545_1000008 | 3300021324 | Bacteria | 215190 |
| 177 | Ga0214543_1000043 | 3300021327 | Bacteria | 160517 |
| 178 | Ga0213873_10111885 | 3300021358 | Bacteria | 794 |
| 179 | Ga0213872_10022265 | 3300021361 | Bacteria | 2919 |
| 180 | Ga0213872_10071191 | 3300021361 | Bacteria | 1568 |
| 181 | Ga0228598_1025133 | 3300024227 | Bacteria | 1171 |
| 182 | Ga0207426_1022383 | 3300025302 | Bacteria | 2169 |
| 183 | Ga0207656_10117668 | 3300025321 | Bacteria | 1234 |
| 184 | Ga0207692_10006485 | 3300025898 | Bacteria | 4746 |
| 185 | Ga0207692_10008743 | 3300025898 | Bacteria | 4204 |
| 186 | Ga0207692_10021040 | 3300025898 | Bacteria | 2978 |
| 187 | Ga0207692_10082883 | 3300025898 | Unclassified | 1719 |
| 188 | Ga0207710_10045662 | 3300025900 | Bacteria | 1954 |
| 189 | Ga0207710_10405717 | 3300025900 | Bacteria | 700 |
| 190 | Ga0207688_10250072 | 3300025901 | Bacteria | 1074 |
| 191 | Ga0207685_10011283 | 3300025905 | Bacteria | 2680 |
| 192 | Ga0207699_10004550 | 3300025906 | Bacteria | 6625 |
| 193 | Ga0207699_10007207 | 3300025906 | Bacteria | 5427 |
| 194 | Ga0207699_10090593 | 3300025906 | Bacteria | 1919 |
| 195 | Ga0207699_10122760 | 3300025906 | Unclassified | 1683 |
| 196 | Ga0207684_10380836 | 3300025910 | Bacteria | 1213 |
| 197 | Ga0207654_10025899 | 3300025911 | Bacteria | 3171 |
| 198 | Ga0207654_10131736 | 3300025911 | Bacteria | 1583 |
| 199 | Ga0207707_10000818 | 3300025912 | Bacteria | 30499 |
| 200 | Ga0207707_10026440 | 3300025912 | Bacteria | 5072 |
| 201 | Ga0207695_10191621 | 3300025913 | Bacteria | 1962 |
| 202 | Ga0207671_10388734 | 3300025914 | Bacteria | 1109 |
| 203 | Ga0207671_10845649 | 3300025914 | Bacteria | 725 |
| 204 | Ga0207693_10001772 | 3300025915 | Bacteria | 18926 |
| 205 | Ga0207693_10086594 | 3300025915 | Bacteria | 2455 |
| 206 | Ga0207693_10099970 | 3300025915 | Bacteria | 2274 |
| 207 | Ga0207693_10271760 | 3300025915 | Bacteria | 1328 |
| 208 | Ga0207693_10386825 | 3300025915 | Bacteria | 1094 |
| 209 | Ga0207663_10015860 | 3300025916 | Bacteria | 4167 |
| 210 | Ga0207663_10327632 | 3300025916 | Bacteria | 1153 |
| 211 | Ga0207660_10014327 | 3300025917 | Bacteria | 5211 |
| 212 | Ga0207660_10056654 | 3300025917 | Bacteria | 2805 |
| 213 | Ga0207660_10121123 | 3300025917 | Bacteria | 1981 |
| 214 | Ga0207657_10002310 | 3300025919 | Bacteria | 20669 |
| 215 | Ga0207649_10179863 | 3300025920 | Bacteria | 1479 |
| 216 | Ga0207652_10002033 | 3300025921 | Bacteria | 17427 |
| 217 | Ga0207652_10073002 | 3300025921 | Bacteria | 2984 |
| 218 | Ga0207652_10322640 | 3300025921 | Bacteria | 1394 |
| 219 | Ga0207646_11007888 | 3300025922 | Bacteria | 736 |
| 220 | Ga0207694_10046228 | 3300025924 | Bacteria | 3364 |
| 221 | Ga0207694_10247994 | 3300025924 | Bacteria | 1456 |
| 222 | Ga0207659_10192949 | 3300025926 | Bacteria | 1622 |
| 223 | Ga0207687_10045295 | 3300025927 | Bacteria | 3040 |
| 224 | Ga0207700_10061431 | 3300025928 | Bacteria | 2849 |
| 225 | Ga0207700_10094494 | 3300025928 | Bacteria | 2369 |
| 226 | Ga0207700_10178943 | 3300025928 | Unclassified | 1774 |
| 227 | Ga0207700_10437484 | 3300025928 | Bacteria | 1151 |
| 228 | Ga0207664_10007907 | 3300025929 | Bacteria | 7387 |
| 229 | Ga0207644_11031966 | 3300025931 | Bacteria | 690 |
| 230 | Ga0207706_10702320 | 3300025933 | Bacteria | 864 |
| 231 | Ga0207709_10161865 | 3300025935 | Bacteria | 1561 |
| 232 | Ga0207709_10186241 | 3300025935 | Bacteria | 1470 |
| 233 | Ga0207670_10750185 | 3300025936 | Bacteria | 811 |
| 234 | Ga0207669_11095793 | 3300025937 | Bacteria | 672 |
| 235 | Ga0207665_10001072 | 3300025939 | Bacteria | 18388 |
| 236 | Ga0207665_10008363 | 3300025939 | Bacteria | 6828 |
| 237 | Ga0207665_10050948 | 3300025939 | Bacteria | 2785 |
| 238 | Ga0207665_10147765 | 3300025939 | Bacteria | 1681 |
| 239 | Ga0207665_10505271 | 3300025939 | Bacteria | 934 |
| 240 | Ga0207711_10032980 | 3300025941 | Bacteria | 4380 |
| 241 | Ga0207711_10107474 | 3300025941 | Bacteria | 2477 |
| 242 | Ga0207711_10654195 | 3300025941 | Bacteria | 980 |
| 243 | Ga0207661_10063222 | 3300025944 | Bacteria | 2997 |
| 244 | Ga0207661_10276573 | 3300025944 | Bacteria | 1499 |
| 245 | Ga0207679_10428260 | 3300025945 | Bacteria | 1169 |
| 246 | Ga0207667_10076540 | 3300025949 | Bacteria | 3472 |
| 247 | Ga0207667_10164042 | 3300025949 | Bacteria | 2285 |
| 248 | Ga0207668_10208355 | 3300025972 | Bacteria | 1562 |
| 249 | Ga0207668_10696915 | 3300025972 | Bacteria | 892 |
| 250 | Ga0207640_10063207 | 3300025981 | Bacteria | 2459 |
| 251 | Ga0207677_10066768 | 3300026023 | Bacteria | 2517 |
| 252 | Ga0207703_10058015 | 3300026035 | Bacteria | 3158 |
| 253 | Ga0207639_10064286 | 3300026041 | Bacteria | 2844 |
| 254 | Ga0207639_10370514 | 3300026041 | Bacteria | 1284 |
| 255 | Ga0207678_10080323 | 3300026067 | Bacteria | 2792 |
| 256 | Ga0207678_10249867 | 3300026067 | Bacteria | 1519 |
| 257 | Ga0207702_10455673 | 3300026078 | Bacteria | 1241 |
| 258 | Ga0207702_10785053 | 3300026078 | Bacteria | 941 |
| 259 | Ga0207641_10558223 | 3300026088 | Bacteria | 1117 |
| 260 | Ga0207676_11423048 | 3300026095 | Bacteria | 689 |
| 261 | Ga0207674_10212150 | 3300026116 | Bacteria | 1885 |
| 262 | Ga0207674_10243056 | 3300026116 | Bacteria | 1747 |
| 263 | Ga0207683_10092472 | 3300026121 | Bacteria | 2695 |
| 264 | Ga0207698_10503920 | 3300026142 | Bacteria | 1179 |
| 265 | Ga0207698_10795128 | 3300026142 | Bacteria | 948 |
| 266 | Ga0209389_1000033 | 3300027296 | Bacteria | 131516 |
| 267 | Ga0209589_1000040 | 3300027357 | Bacteria | 126550 |
| 268 | Ga0209489_100045 | 3300027361 | Bacteria | 158225 |
| 269 | Ga0209813_10014454 | 3300027866 | Bacteria | 2125 |
| 270 | Ga0207428_10004434 | 3300027907 | Bacteria | 13351 |
| 271 | Ga0268266_10276738 | 3300028379 | Bacteria | 1559 |
| 272 | Ga0268265_10400026 | 3300028380 | Bacteria | 1269 |
| 273 | Ga0307517_10055822 | 3300028786 | Bacteria | 3868 |
| 274 | Ga0307511_10054131 | 3300030521 | Bacteria | 3169 |
| 275 | Ga0265331_10170204 | 3300031250 | Bacteria | 986 |
| 276 | Ga0307508_10000002 | 3300031616 | Bacteria | 407635 |
| 277 | Ga0307516_10099649 | 3300031730 | Bacteria | 2721 |
| 278 | Ga0373944_0048425 | 3300035089 | Bacteria | 1334 |
| 279 | Ga0373954_0092916 | 3300035118 | Bacteria | 1450 |
| 280 | Ga0373943_0010903 | 3300035170 | Bacteria | 4082 |
| 281 | Ga0373924_0111553 | 3300035410 | Bacteria | 1182 |
| 282 | Ga0373924_0130046 | 3300035410 | Bacteria | 1095 |
| 283 | Ga0373931_0137518 | 3300035691 | Bacteria | 1412 |
| 284 | Ga0373935_0000338 | 3300035692 | Bacteria | 23731 |
| 285 | Ga0373927_0001017 | 3300035695 | Bacteria | 21335 |
| 286 | Ga0373947_0001103 | 3300035725 | Bacteria | 16576 |
| 287 | Ga0373947_0026056 | 3300035725 | Bacteria | 3413 |
| 288 | Ga0373937_0113568 | 3300036401 | Bacteria | 2520 |
| 289 | Ga0373925_0001334 | 3300037068 | Bacteria | 21583 |
| 290 | Ga0395900_0002352 | 3300037418 | Bacteria | 20935 |
| 291 | Ga0395898_0117140 | 3300037466 | Bacteria | 2552 |
| 292 | Ga0395905_0007209 | 3300037471 | Bacteria | 11087 |
| 293 | Ga0395905_0347533 | 3300037471 | Bacteria | 1375 |
| 294 | Ga0436365_1451163 | 3300039437 | Bacteria | 2386 |
| 295 | Ga0436360_0496486 | 3300039438 | Bacteria | 2303 |
| 296 | Ga0436360_0688980 | 3300039438 | Bacteria | 2079 |
| 297 | Ga0436361_0338149 | 3300039447 | Bacteria | 767 |
| 298 | Ga0436361_0771035 | 3300039447 | Bacteria | 5070 |
| 299 | Ga0436361_1050549 | 3300039447 | Bacteria | 4175 |
| 300 | Ga0436363_0200004 | 3300039450 | Bacteria | 2663 |
| 301 | Ga0436362_1161726 | 3300039453 | Bacteria | 2659 |
| 302 | Ga0466969_0014048 | 3300044656 | Bacteria | 4214 |
| 303 | Ga0466969_0063486 | 3300044656 | Bacteria | 1790 |
| 304 | Ga0466972_0002429 | 3300044658 | Bacteria | 9196 |
| 305 | Ga0466972_0297268 | 3300044658 | Bacteria | 754 |
| 306 | Ga0466965_0114609 | 3300044683 | Bacteria | 1388 |
| 307 | Ga0466966_0001443 | 3300044684 | Bacteria | 15269 |
| 308 | Ga0466961_0000074 | 3300044693 | Bacteria | 61968 |
| 309 | Ga0466964_0148826 | 3300044706 | Bacteria | 1083 |
| 310 | Ga0466964_0375464 | 3300044706 | Bacteria | 737 |
| 311 | Ga0466968_0001784 | 3300044735 | Bacteria | 7764 |
| 312 | Ga0466968_0086308 | 3300044735 | Bacteria | 1385 |
| 313 | Ga0466960_0019012 | 3300044901 | Bacteria | 3019 |
| 314 | Ga0466959_0040553 | 3300045049 | Bacteria | 3439 |
| 315 | Ga0466959_0125244 | 3300045049 | Bacteria | 1824 |
| 316 | Ga0466959_0322420 | 3300045049 | Bacteria | 1056 |
| 317 | Ga0466967_0788997 | 3300045976 | Bacteria | 943 |
| 318 | Ga0495592_0008296 | 3300046454 | Bacteria | 7797 |
| 319 | Ga0495592_0165688 | 3300046454 | Bacteria | 1517 |
| 320 | Ga0495592_0529034 | 3300046454 | Bacteria | 728 |
| 321 | Ga0495603_0000420 | 3300046455 | Bacteria | 23500 |
| 322 | Ga0495603_0081268 | 3300046455 | Bacteria | 1899 |
| 323 | Ga0495590_0042392 | 3300046457 | Bacteria | 1586 |
| 324 | Ga0495629_0000412 | 3300046459 | Bacteria | 35827 |
| 325 | Ga0495641_0002262 | 3300046461 | Bacteria | 15345 |
| 326 | Ga0495651_0047144 | 3300046462 | Bacteria | 3334 |
| 327 | Ga0495651_0131248 | 3300046462 | Bacteria | 1828 |
| 328 | Ga0495653_0371439 | 3300046463 | Bacteria | 915 |
| 329 | Ga0495580_0004412 | 3300046472 | Bacteria | 11815 |
| 330 | Ga0495582_0000043 | 3300046473 | Bacteria | 63647 |
| 331 | Ga0495639_0000393 | 3300046475 | Bacteria | 20643 |
| 332 | Ga0495639_0519550 | 3300046475 | Bacteria | 609 |
| 333 | Ga0495662_0000725 | 3300046476 | Bacteria | 15774 |
| 334 | Ga0495664_0022549 | 3300046477 | Bacteria | 3651 |
| 335 | Ga0495594_0005033 | 3300046499 | Bacteria | 6800 |
| 336 | Ga0495606_0281929 | 3300046507 | Bacteria | 908 |
| 337 | Ga0495606_0374470 | 3300046507 | Bacteria | 748 |
| 338 | Ga0495608_0070334 | 3300046511 | Bacteria | 2284 |
| 339 | Ga0495610_0296831 | 3300046512 | Bacteria | 624 |
| 340 | Ga0495616_0087898 | 3300046513 | Bacteria | 1476 |
| 341 | Ga0495618_0049754 | 3300046514 | Bacteria | 2647 |
| 342 | Ga0495628_0079450 | 3300046516 | Bacteria | 2550 |
| 343 | Ga0495628_0156729 | 3300046516 | Bacteria | 1732 |
| 344 | Ga0495628_0246644 | 3300046516 | Bacteria | 1334 |
| 345 | Ga0495630_0000409 | 3300046517 | Bacteria | 33418 |
| 346 | Ga0495644_0066462 | 3300046523 | Bacteria | 1354 |
| 347 | Ga0495648_0000286 | 3300046524 | Bacteria | 57430 |
| 348 | Ga0495648_0086723 | 3300046524 | Bacteria | 1765 |
| 349 | Ga0495666_0031113 | 3300046526 | Bacteria | 2616 |
| 350 | Ga0495642_0227951 | 3300046528 | Bacteria | 814 |
| 351 | Ga0495652_0027823 | 3300046529 | Bacteria | 4981 |
| 352 | Ga0495654_0199870 | 3300046530 | Bacteria | 856 |
| 353 | Ga0495665_0000051 | 3300046531 | Bacteria | 46836 |
| 354 | Ga0495640_0001853 | 3300046533 | Bacteria | 16805 |
| 355 | Ga0495587_0089281 | 3300046536 | Bacteria | 1781 |
| 356 | Ga0495598_0003534 | 3300046537 | Bacteria | 3331 |
| 357 | Ga0495621_0019450 | 3300046539 | Bacteria | 2218 |
| 358 | Ga0495645_0281920 | 3300046543 | Bacteria | 1092 |
| 359 | Ga0495622_0003740 | 3300046557 | Bacteria | 7120 |
| 360 | Ga0495667_0168125 | 3300046559 | Bacteria | 1409 |
| 361 | Ga0495656_0054160 | 3300046615 | Bacteria | 1725 |
| 362 | Ga0495634_0000400 | 3300046642 | Bacteria | 42620 |
| 363 | Ga0495611_0302513 | 3300046648 | Bacteria | 737 |
| 364 | Ga0495635_0000726 | 3300046663 | Bacteria | 21302 |
| 365 | Ga0495635_0270968 | 3300046663 | Bacteria | 1142 |
| 366 | Ga0495659_0002538 | 3300046664 | Bacteria | 5893 |
| 367 | Ga0495659_0037983 | 3300046664 | Bacteria | 1708 |
| 368 | Ga0495661_0188470 | 3300046665 | Bacteria | 1088 |
| 369 | Ga0495588_0053710 | 3300046674 | Bacteria | 2078 |
| 370 | Ga0495623_0016947 | 3300046679 | Bacteria | 4706 |
| 371 | Ga0495646_0013878 | 3300046680 | Bacteria | 5121 |
| 372 | Ga0495647_0000550 | 3300046681 | Bacteria | 11032 |
| 373 | Ga0495658_0002754 | 3300046683 | Bacteria | 8829 |
| 374 | Ga0495669_0030348 | 3300046684 | Bacteria | 2373 |
| 375 | Ga0495669_0051364 | 3300046684 | Bacteria | 1850 |
| 376 | Ga0495624_0001111 | 3300046690 | Bacteria | 21278 |
| 377 | Ga0495624_0280197 | 3300046690 | Bacteria | 1007 |
| 378 | Ga0495624_0333010 | 3300046690 | Bacteria | 914 |
| 379 | Ga0495670_0037313 | 3300046691 | Bacteria | 2422 |
| 380 | Ga0495649_0274850 | 3300046694 | Bacteria | 861 |
| 381 | Ga0495581_0000173 | 3300047315 | Bacteria | 29278 |
| 382 | Ga0495581_0097358 | 3300047315 | Bacteria | 1709 |
| 383 | Ga0495604_0203480 | 3300047317 | Bacteria | 1372 |
| 384 | Ga0495674_0002072 | 3300047319 | Bacteria | 19667 |
| 385 | Ga0495674_0467966 | 3300047319 | Bacteria | 1011 |
| 386 | Ga0495672_0044804 | 3300047320 | Bacteria | 2651 |
| 387 | Ga0495672_0046697 | 3300047320 | Bacteria | 2581 |
| 388 | Ga0495676_0011494 | 3300047321 | Bacteria | 7986 |
| 389 | Ga0495676_0862248 | 3300047321 | Bacteria | 581 |
| 390 | Ga0495687_083764 | 3300047443 | Bacteria | 1241 |
| 391 | Ga0495675_0026516 | 3300047444 | Bacteria | 3695 |
| 392 | Ga0495675_0139370 | 3300047444 | Bacteria | 1504 |
| 393 | Ga0495677_0081470 | 3300047445 | Bacteria | 1213 |
| 394 | Ga0495685_071128 | 3300047447 | Bacteria | 1165 |
| 395 | Ga0495673_0013578 | 3300047469 | Bacteria | 4272 |
| 396 | Ga0495673_0178866 | 3300047469 | Bacteria | 804 |
| 397 | Ga0495684_0017683 | 3300047471 | Bacteria | 5490 |
| 398 | Ga0495593_0000222 | 3300047673 | Bacteria | 30282 |
| 399 | Ga0495593_0114872 | 3300047673 | Bacteria | 1373 |
| 400 | Ga0495602_0316444 | 3300048088 | Bacteria | 1137 |
| 401 | Ga0495614_0005302 | 3300048089 | Bacteria | 5814 |
| 402 | Ga0496102_0080275 | 3300048905 | Bacteria | 3005 |
| 403 | Ga0496103_0761397 | 3300048906 | Bacteria | 612 |
| 404 | Ga0496104_0635994 | 3300048907 | Bacteria | 976 |
| 405 | Ga0496106_0407014 | 3300048909 | Bacteria | 1093 |
| 406 | Ga0496107_0172087 | 3300048910 | Bacteria | 1607 |
| 407 | Ga0496108_0084338 | 3300048911 | Bacteria | 2696 |
| 408 | Ga0496110_0406971 | 3300048913 | Bacteria | 1240 |
| 409 | Ga0496113_0372786 | 3300048916 | Bacteria | 1146 |
| 410 | Ga0496117_0303181 | 3300048920 | Bacteria | 845 |
| 411 | Ga0496121_0000893 | 3300048924 | Bacteria | 53847 |
| 412 | Ga0496121_0175321 | 3300048924 | Bacteria | 1553 |
| 413 | Ga0496121_0204708 | 3300048924 | Bacteria | 1403 |
| 414 | Ga0496121_0263227 | 3300048924 | Bacteria | 1189 |
| 415 | Ga0496121_0611750 | 3300048924 | Bacteria | 670 |
| 416 | Ga0496124_0384137 | 3300048927 | Bacteria | 981 |
| 417 | Ga0496125_0089146 | 3300048928 | Bacteria | 2321 |
| 418 | Ga0496125_0247667 | 3300048928 | Bacteria | 1126 |
| 419 | Ga0496126_0023120 | 3300048929 | Bacteria | 6026 |
| 420 | Ga0496126_0108568 | 3300048929 | Bacteria | 2419 |
| 421 | Ga0496126_0279499 | 3300048929 | Bacteria | 1383 |
| 422 | Ga0496126_0654649 | 3300048929 | Bacteria | 821 |
| 423 | Ga0501071_0693341 | 3300049587 | Bacteria | 784 |
| 424 | nmdc:mga03683_10854_c1 | 3300050489 | Bacteria | 3277 |
| 425 | nmdc:mga03683_222091_c1 | 3300050489 | Bacteria | 872 |
| 426 | nmdc:mga03n38_208874_c1 | 3300050490 | Bacteria | 1014 |
| 427 | nmdc:mga00v17_345213_c1 | 3300050491 | Bacteria | 968 |
| 428 | nmdc:mga00v17_410847_c1 | 3300050491 | Bacteria | 879 |
| 429 | nmdc:mga0yw44_256243_c1 | 3300050492 | Bacteria | 1165 |
| 430 | nmdc:mga0yw44_361840_c1 | 3300050492 | Bacteria | 978 |
| 431 | nmdc:mga0k408_169459_c1 | 3300050493 | Bacteria | 1302 |
| 432 | nmdc:mga0k408_320229_c1 | 3300050493 | Bacteria | 925 |
| 433 | nmdc:mga0k408_53291_c1 | 3300050493 | Bacteria | 2344 |
| 434 | nmdc:mga06z11_116342_c2 | 3300050494 | Bacteria | 1046 |
| 435 | nmdc:mga06z11_176663_c1 | 3300050494 | Bacteria | 1229 |
| 436 | nmdc:mga06z11_432189_c1 | 3300050494 | Unclassified | 794 |
| 437 | nmdc:mga04h51_180165_c1 | 3300050495 | Bacteria | 822 |
| 438 | nmdc:mga07m45_189854_c1 | 3300050496 | Bacteria | 1195 |
| 439 | nmdc:mga07m45_264579_c1 | 3300050496 | Unclassified | 1000 |
| 440 | nmdc:mga07m45_517567_c1 | 3300050496 | Bacteria | 691 |
| 441 | nmdc:mga07m45_595433_c1 | 3300050496 | Bacteria | 639 |
| 442 | nmdc:mga05p37_1072_c1 | 3300050507 | Bacteria | 31317 |
| 443 | nmdc:mga09592_26598_c1 | 3300050508 | Bacteria | 4795 |
| 444 | nmdc:mga0qj67_82209_c2 | 3300050509 | Bacteria | 2181 |
| 445 | nmdc:mga06r32_458_c1 | 3300050510 | Bacteria | 34859 |
| 446 | nmdc:mga08y16_4007_c1 | 3300050511 | Bacteria | 15354 |
| 447 | nmdc:mga0n895_15793_c1 | 3300050512 | Bacteria | 6903 |
| 448 | nmdc:mga0n895_675192_c1 | 3300050512 | Bacteria | 1030 |
| 449 | nmdc:mga0rr50_340498_c1 | 3300050513 | Bacteria | 1260 |
| 450 | nmdc:mga08x19_662988_c1 | 3300050514 | Bacteria | 740 |
| 451 | nmdc:mga0sz30_111254_c1 | 3300050516 | Bacteria | 1200 |
| 452 | nmdc:mga0sz30_217304_c1 | 3300050516 | Bacteria | 850 |
| 453 | nmdc:mga0sz30_249360_c1 | 3300050516 | Bacteria | 790 |
| 454 | Ga0495612_0386236 | 3300053078 | Bacteria | 635 |
| 455 | Ga0500635_0017023 | 3300053080 | Bacteria | 2171 |
| 456 | Ga0495619_0201296 | 3300053085 | Bacteria | 1378 |
| 457 | Ga0500651_0041814 | 3300053093 | Bacteria | 2889 |
| 458 | Ga0500651_0229603 | 3300053093 | Bacteria | 1086 |
| 459 | Ga0500640_130737 | 3300053095 | Bacteria | 990 |
| 460 | Ga0500650_0123157 | 3300053098 | Bacteria | 1208 |
| 461 | Ga0500650_0275726 | 3300053098 | Bacteria | 749 |
| 462 | Ga0500650_0312730 | 3300053098 | Bacteria | 693 |
| 463 | Ga0500556_0005445 | 3300053104 | Bacteria | 3594 |
| 464 | Ga0500562_121636 | 3300053108 | Bacteria | 711 |
| 465 | Ga0500595_016941 | 3300053119 | Bacteria | 2704 |
| 466 | Ga0500607_031113 | 3300053121 | Bacteria | 2937 |
| 467 | Ga0500608_126355 | 3300053122 | Bacteria | 1152 |
| 468 | Ga0500642_0135144 | 3300053130 | Bacteria | 1156 |
| 469 | Ga0500658_0340420 | 3300053134 | Bacteria | 689 |
| 470 | Ga0500564_204967 | 3300053138 | Bacteria | 807 |
| 471 | Ga0500568_0004386 | 3300053139 | Bacteria | 7553 |
| 472 | Ga0500588_0003604 | 3300053146 | Bacteria | 3281 |
| 473 | Ga0500590_094762 | 3300053148 | Bacteria | 1443 |
| 474 | Ga0500616_0004795 | 3300053153 | Bacteria | 9471 |
| 475 | Ga0500619_027685 | 3300053154 | Bacteria | 1699 |
| 476 | Ga0500620_047264 | 3300053155 | Bacteria | 1432 |
| 477 | Ga0500620_133252 | 3300053155 | Bacteria | 869 |
| 478 | Ga0500636_0000197 | 3300053177 | Bacteria | 32448 |
| 479 | Ga0500637_0111428 | 3300053178 | Bacteria | 1587 |
| 480 | Ga0500611_091280 | 3300053727 | Bacteria | 776 |
| 481 | Ga0500552_000469 | 3300053733 | Bacteria | 3730 |
| 482 | Ga0500601_000867 | 3300053737 | Bacteria | 3669 |
| 483 | Ga0530510_0774281 | 3300061734 | Bacteria | 732 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005437 | Ga0070710_10261406 | Ga0070710_102614062 | 162 |
| 2 | 3300050496 | nmdc:mga07m45_264579_c1 | nmdc:mga07m45_264579_c1_472_984 | 168 |
| 3 | 3300053130 | Ga0500642_0135144 | Ga0500642_0135144_20_532 | 168 |
| 4 | 3300005434 | Ga0070709_10132209 | Ga0070709_101322092 | 172 |
| 5 | 3300005435 | Ga0070714_100472167 | Ga0070714_1004721672 | 172 |
| 6 | 3300005436 | Ga0070713_100577429 | Ga0070713_1005774292 | 172 |
| 7 | 3300005439 | Ga0070711_100049485 | Ga0070711_1000494854 | 172 |
| 8 | 3300006175 | Ga0070712_100324680 | Ga0070712_1003246802 | 172 |
| 9 | 3300025898 | Ga0207692_10082883 | Ga0207692_100828832 | 172 |
| 10 | 3300025906 | Ga0207699_10122760 | Ga0207699_101227602 | 172 |
| 11 | 3300025915 | Ga0207693_10271760 | Ga0207693_102717602 | 172 |
| 12 | 3300025928 | Ga0207700_10178943 | Ga0207700_101789432 | 172 |
| 13 | iso_pu_bacteria | 2513237094 | 2513644653 | 172 |
| 14 | iso_pu_bacteria | 2617270741 | 2617373783 | 172 |
| 15 | iso_pu_bacteria | 2824671348 | 2824674415 | 172 |
| 16 | iso_pu_bacteria | 2824679649 | 2824685845 | 172 |
| 17 | iso_pu_bacteria | 2824687955 | 2824691087 | 172 |
| 18 | iso_pu_bacteria | 2824732956 | 2824738846 | 172 |
| 19 | iso_pu_bacteria | 2824746037 | 2824748675 | 172 |
| 20 | iso_pu_bacteria | 2874628541 | 2874628767 | 172 |
| 21 | iso_pu_bacteria | 2881665667 | 2881668158 | 172 |
| 22 | iso_pu_bacteria | 2908775508 | 2908776300 | 172 |
| 23 | iso_pu_bacteria | 2922393267 | 2922394263 | 172 |
| 24 | iso_pu_bacteria | 2941531003 | 2941535485 | 172 |
| 25 | iso_pu_bacteria | 8019648815 | 8019652439 | 172 |
| 26 | iso_pu_bacteria | 2791355196 | 2793062070 | 174 |
| 27 | iso_pu_bacteria | 2874604998 | 2874608039 | 174 |
| 28 | iso_pu_bacteria | 2922361189 | 2922363974 | 174 |
| 29 | iso_pu_bacteria | 8006926726 | 8006928936 | 174 |
| 30 | iso_pu_bacteria | 8006964411 | 8006967482 | 174 |
| 31 | iso_pu_bacteria | 2513237141 | 2513888792 | 175 |
| 32 | 3300003354 | JGI25160J50197_1014932 | JGI25160J50197_10149322 | 176 |
| 33 | 3300004625 | Ga0055543_1032902 | Ga0055543_10329022 | 176 |
| 34 | 3300005455 | Ga0070663_100442631 | Ga0070663_1004426311 | 176 |
| 35 | 3300006846 | Ga0075430_100069585 | Ga0075430_1000695851 | 176 |
| 36 | 3300006847 | Ga0075431_100006409 | Ga0075431_10000640914 | 176 |
| 37 | 3300006880 | Ga0075429_100007594 | Ga0075429_1000075942 | 176 |
| 38 | 3300006942 | Ga0099824_1017750 | Ga0099824_10177504 | 176 |
| 39 | 3300006943 | Ga0099822_1040583 | Ga0099822_10405832 | 176 |
| 40 | 3300009094 | Ga0111539_10008018 | Ga0111539_1000801810 | 176 |
| 41 | 3300009147 | Ga0114129_10000066 | Ga0114129_1000006685 | 176 |
| 42 | 3300021320 | Ga0214544_1000016 | Ga0214544_1000016146 | 176 |
| 43 | 3300021321 | Ga0214542_1000016 | Ga0214542_100001656 | 176 |
| 44 | 3300021324 | Ga0214545_1000008 | Ga0214545_100000862 | 176 |
| 45 | 3300021327 | Ga0214543_1000043 | Ga0214543_100004312 | 176 |
| 46 | 3300025302 | Ga0207426_1022383 | Ga0207426_10223831 | 176 |
| 47 | 3300027296 | Ga0209389_1000033 | Ga0209389_100003357 | 176 |
| 48 | 3300027357 | Ga0209589_1000040 | Ga0209589_100004057 | 176 |
| 49 | 3300027361 | Ga0209489_100045 | Ga0209489_10004569 | 176 |
| 50 | 3300027907 | Ga0207428_10004434 | Ga0207428_100044346 | 176 |
| 51 | 3300031250 | Ga0265331_10170204 | Ga0265331_101702042 | 176 |
| 52 | 3300037471 | Ga0395905_0007209 | Ga0395905_0007209_4577_5131 | 176 |
| 53 | 3300044656 | Ga0466969_0014048 | Ga0466969_0014048_1596_2126 | 176 |
| 54 | 3300044658 | Ga0466972_0002429 | Ga0466972_0002429_95_625 | 176 |
| 55 | 3300044658 | Ga0466972_0297268 | Ga0466972_0297268_51_584 | 176 |
| 56 | 3300044683 | Ga0466965_0114609 | Ga0466965_0114609_613_1143 | 176 |
| 57 | 3300044684 | Ga0466966_0001443 | Ga0466966_0001443_1038_1568 | 176 |
| 58 | 3300044693 | Ga0466961_0000074 | Ga0466961_0000074_60892_61422 | 176 |
| 59 | 3300044706 | Ga0466964_0148826 | Ga0466964_0148826_73_606 | 176 |
| 60 | 3300044735 | Ga0466968_0001784 | Ga0466968_0001784_6073_6603 | 176 |
| 61 | 3300044901 | Ga0466960_0019012 | Ga0466960_0019012_1076_1606 | 176 |
| 62 | 3300045049 | Ga0466959_0040553 | Ga0466959_0040553_1948_2478 | 176 |
| 63 | 3300046454 | Ga0495592_0165688 | Ga0495592_0165688_730_1287 | 176 |
| 64 | 3300046512 | Ga0495610_0296831 | Ga0495610_0296831_16_573 | 176 |
| 65 | 3300046524 | Ga0495648_0000286 | Ga0495648_0000286_53578_54108 | 176 |
| 66 | 3300046524 | Ga0495648_0086723 | Ga0495648_0086723_348_905 | 176 |
| 67 | 3300046528 | Ga0495642_0227951 | Ga0495642_0227951_128_685 | 176 |
| 68 | 3300046665 | Ga0495661_0188470 | Ga0495661_0188470_261_791 | 176 |
| 69 | 3300047320 | Ga0495672_0044804 | Ga0495672_0044804_1954_2511 | 176 |
| 70 | 3300047321 | Ga0495676_0862248 | Ga0495676_0862248_40_570 | 176 |
| 71 | 3300047443 | Ga0495687_083764 | Ga0495687_083764_103_633 | 176 |
| 72 | 3300047469 | Ga0495673_0013578 | Ga0495673_0013578_3333_3890 | 176 |
| 73 | 3300050507 | nmdc:mga05p37_1072_c1 | nmdc:mga05p37_1072_c1_19316_19927 | 176 |
| 74 | 3300050508 | nmdc:mga09592_26598_c1 | nmdc:mga09592_26598_c1_861_1472 | 176 |
| 75 | 3300050509 | nmdc:mga0qj67_82209_c2 | nmdc:mga0qj67_82209_c2_111_722 | 176 |
| 76 | 3300050510 | nmdc:mga06r32_458_c1 | nmdc:mga06r32_458_c1_32225_32836 | 176 |
| 77 | 3300050511 | nmdc:mga08y16_4007_c1 | nmdc:mga08y16_4007_c1_8191_8802 | 176 |
| 78 | 3300053080 | Ga0500635_0017023 | Ga0500635_0017023_935_1465 | 176 |
| 79 | 3300053095 | Ga0500640_130737 | Ga0500640_130737_211_741 | 176 |
| 80 | 3300053098 | Ga0500650_0123157 | Ga0500650_0123157_420_950 | 176 |
| 81 | 3300053121 | Ga0500607_031113 | Ga0500607_031113_1662_2192 | 176 |
| 82 | 3300053122 | Ga0500608_126355 | Ga0500608_126355_267_797 | 176 |
| 83 | 3300053134 | Ga0500658_0340420 | Ga0500658_0340420_143_673 | 176 |
| 84 | 3300053138 | Ga0500564_204967 | Ga0500564_204967_32_562 | 176 |
| 85 | 3300053146 | Ga0500588_0003604 | Ga0500588_0003604_2427_2957 | 176 |
| 86 | 3300053148 | Ga0500590_094762 | Ga0500590_094762_85_615 | 176 |
| 87 | 3300053154 | Ga0500619_027685 | Ga0500619_027685_690_1220 | 176 |
| 88 | 3300053155 | Ga0500620_047264 | Ga0500620_047264_571_1101 | 176 |
| 89 | 3300053177 | Ga0500636_0000197 | Ga0500636_0000197_18446_18976 | 176 |
| 90 | 3300053178 | Ga0500637_0111428 | Ga0500637_0111428_311_841 | 176 |
| 91 | 3300053727 | Ga0500611_091280 | Ga0500611_091280_210_764 | 176 |
| 92 | 3300053737 | Ga0500601_000867 | Ga0500601_000867_2822_3379 | 176 |
| 93 | iso_pu_bacteria | 2507262055 | 2507505273 | 176 |
| 94 | iso_pu_bacteria | 2935819856 | 2935825506 | 176 |
| 95 | iso_pu_bacteria | 8016566248 | 8016569491 | 176 |
| 96 | 3300003322 | rootL2_10116603 | rootL2_101166034 | 177 |
| 97 | 3300003323 | rootH1_10215295 | rootH1_102152954 | 177 |
| 98 | 3300003659 | JGI25404J52841_10008363 | JGI25404J52841_100083632 | 177 |
| 99 | 3300005455 | Ga0070663_100463427 | Ga0070663_1004634271 | 177 |
| 100 | 3300005937 | Ga0081455_10016558 | Ga0081455_100165585 | 177 |
| 101 | 3300005937 | Ga0081455_10039096 | Ga0081455_100390964 | 177 |
| 102 | 3300005983 | Ga0081540_1002536 | Ga0081540_10025363 | 177 |
| 103 | 3300005983 | Ga0081540_1006135 | Ga0081540_10061358 | 177 |
| 104 | 3300005983 | Ga0081540_1007733 | Ga0081540_10077335 | 177 |
| 105 | 3300005983 | Ga0081540_1029010 | Ga0081540_10290104 | 177 |
| 106 | 3300005983 | Ga0081540_1030690 | Ga0081540_10306905 | 177 |
| 107 | 3300005983 | Ga0081540_1081047 | Ga0081540_10810473 | 177 |
| 108 | 3300007076 | Ga0075435_100969296 | Ga0075435_1009692961 | 177 |
| 109 | 3300009553 | Ga0105249_10865711 | Ga0105249_108657112 | 177 |
| 110 | 3300026078 | Ga0207702_10455673 | Ga0207702_104556731 | 177 |
| 111 | 3300035691 | Ga0373931_0137518 | Ga0373931_0137518_738_1271 | 177 |
| 112 | 3300045976 | Ga0466967_0788997 | Ga0466967_0788997_86_649 | 177 |
| 113 | 3300050512 | nmdc:mga0n895_675192_c1 | nmdc:mga0n895_675192_c1_271_804 | 177 |
| 114 | 3300005329 | Ga0070683_100819375 | Ga0070683_1008193751 | 178 |
| 115 | 3300005334 | Ga0068869_100106951 | Ga0068869_1001069513 | 178 |
| 116 | 3300005335 | Ga0070666_10459608 | Ga0070666_104596081 | 178 |
| 117 | 3300005336 | Ga0070680_100038719 | Ga0070680_1000387195 | 178 |
| 118 | 3300005336 | Ga0070680_100064607 | Ga0070680_1000646073 | 178 |
| 119 | 3300005337 | Ga0070682_100027943 | Ga0070682_1000279434 | 178 |
| 120 | 3300005337 | Ga0070682_100067452 | Ga0070682_1000674522 | 178 |
| 121 | 3300005339 | Ga0070660_100025078 | Ga0070660_1000250785 | 178 |
| 122 | 3300005339 | Ga0070660_100546954 | Ga0070660_1005469542 | 178 |
| 123 | 3300005347 | Ga0070668_100151717 | Ga0070668_1001517172 | 178 |
| 124 | 3300005347 | Ga0070668_100676528 | Ga0070668_1006765281 | 178 |
| 125 | 3300005353 | Ga0070669_100621420 | Ga0070669_1006214202 | 178 |
| 126 | 3300005354 | Ga0070675_100837557 | Ga0070675_1008375571 | 178 |
| 127 | 3300005355 | Ga0070671_100136679 | Ga0070671_1001366792 | 178 |
| 128 | 3300005366 | Ga0070659_100418548 | Ga0070659_1004185481 | 178 |
| 129 | 3300005434 | Ga0070709_10147600 | Ga0070709_101476003 | 178 |
| 130 | 3300005434 | Ga0070709_10174607 | Ga0070709_101746072 | 178 |
| 131 | 3300005436 | Ga0070713_100136475 | Ga0070713_1001364752 | 178 |
| 132 | 3300005436 | Ga0070713_100344714 | Ga0070713_1003447142 | 178 |
| 133 | 3300005439 | Ga0070711_100046199 | Ga0070711_1000461994 | 178 |
| 134 | 3300005456 | Ga0070678_100012480 | Ga0070678_1000124806 | 178 |
| 135 | 3300005457 | Ga0070662_100072072 | Ga0070662_1000720721 | 178 |
| 136 | 3300005458 | Ga0070681_10013576 | Ga0070681_100135763 | 178 |
| 137 | 3300005458 | Ga0070681_10069568 | Ga0070681_100695683 | 178 |
| 138 | 3300005467 | Ga0070706_100246318 | Ga0070706_1002463183 | 178 |
| 139 | 3300005467 | Ga0070706_100305629 | Ga0070706_1003056293 | 178 |
| 140 | 3300005468 | Ga0070707_100153903 | Ga0070707_1001539033 | 178 |
| 141 | 3300005468 | Ga0070707_100503350 | Ga0070707_1005033501 | 178 |
| 142 | 3300005468 | Ga0070707_101391196 | Ga0070707_1013911961 | 178 |
| 143 | 3300005471 | Ga0070698_100493600 | Ga0070698_1004936002 | 178 |
| 144 | 3300005471 | Ga0070698_100593601 | Ga0070698_1005936012 | 178 |
| 145 | 3300005518 | Ga0070699_100754667 | Ga0070699_1007546671 | 178 |
| 146 | 3300005530 | Ga0070679_100135841 | Ga0070679_1001358412 | 178 |
| 147 | 3300005530 | Ga0070679_100192758 | Ga0070679_1001927583 | 178 |
| 148 | 3300005536 | Ga0070697_100160053 | Ga0070697_1001600532 | 178 |
| 149 | 3300005544 | Ga0070686_100319201 | Ga0070686_1003192012 | 178 |
| 150 | 3300005548 | Ga0070665_100102858 | Ga0070665_1001028584 | 178 |
| 151 | 3300005548 | Ga0070665_100594619 | Ga0070665_1005946191 | 178 |
| 152 | 3300005563 | Ga0068855_100133256 | Ga0068855_1001332562 | 178 |
| 153 | 3300005563 | Ga0068855_100206221 | Ga0068855_1002062216 | 178 |
| 154 | 3300005563 | Ga0068855_100330575 | Ga0068855_1003305752 | 178 |
| 155 | 3300005564 | Ga0070664_100365949 | Ga0070664_1003659492 | 178 |
| 156 | 3300005564 | Ga0070664_101030205 | Ga0070664_1010302052 | 178 |
| 157 | 3300005577 | Ga0068857_100272864 | Ga0068857_1002728642 | 178 |
| 158 | 3300005616 | Ga0068852_100916285 | Ga0068852_1009162852 | 178 |
| 159 | 3300005617 | Ga0068859_101031854 | Ga0068859_1010318541 | 178 |
| 160 | 3300005618 | Ga0068864_101195696 | Ga0068864_1011956962 | 178 |
| 161 | 3300005834 | Ga0068851_10029667 | Ga0068851_100296673 | 178 |
| 162 | 3300005841 | Ga0068863_100129956 | Ga0068863_1001299564 | 178 |
| 163 | 3300005842 | Ga0068858_100259835 | Ga0068858_1002598354 | 178 |
| 164 | 3300005843 | Ga0068860_100831377 | Ga0068860_1008313771 | 178 |
| 165 | 3300005844 | Ga0068862_100084875 | Ga0068862_1000848753 | 178 |
| 166 | 3300005844 | Ga0068862_100210554 | Ga0068862_1002105542 | 178 |
| 167 | 3300005983 | Ga0081540_1004921 | Ga0081540_10049213 | 178 |
| 168 | 3300006028 | Ga0070717_10094512 | Ga0070717_100945123 | 178 |
| 169 | 3300006038 | Ga0075365_10305637 | Ga0075365_103056373 | 178 |
| 170 | 3300006038 | Ga0075365_10354737 | Ga0075365_103547372 | 178 |
| 171 | 3300006038 | Ga0075365_10458178 | Ga0075365_104581782 | 178 |
| 172 | 3300006048 | Ga0075363_100053139 | Ga0075363_1000531394 | 178 |
| 173 | 3300006163 | Ga0070715_10171846 | Ga0070715_101718462 | 178 |
| 174 | 3300006173 | Ga0070716_100155261 | Ga0070716_1001552613 | 178 |
| 175 | 3300006175 | Ga0070712_100433218 | Ga0070712_1004332182 | 178 |
| 176 | 3300006177 | Ga0075362_10053861 | Ga0075362_100538613 | 178 |
| 177 | 3300006177 | Ga0075362_10164161 | Ga0075362_101641612 | 178 |
| 178 | 3300006178 | Ga0075367_10129915 | Ga0075367_101299152 | 178 |
| 179 | 3300006186 | Ga0075369_10043584 | Ga0075369_100435843 | 178 |
| 180 | 3300006186 | Ga0075369_10047092 | Ga0075369_100470922 | 178 |
| 181 | 3300006186 | Ga0075369_10103336 | Ga0075369_101033362 | 178 |
| 182 | 3300006186 | Ga0075369_10278318 | Ga0075369_102783181 | 178 |
| 183 | 3300006237 | Ga0097621_101542228 | Ga0097621_1015422281 | 178 |
| 184 | 3300006358 | Ga0068871_100122484 | Ga0068871_1001224844 | 178 |
| 185 | 3300006358 | Ga0068871_100132309 | Ga0068871_1001323091 | 178 |
| 186 | 3300006871 | Ga0075434_100616637 | Ga0075434_1006166372 | 178 |
| 187 | 3300006931 | Ga0097620_101031886 | Ga0097620_1010318861 | 178 |
| 188 | 3300009093 | Ga0105240_10006681 | Ga0105240_1000668112 | 178 |
| 189 | 3300009093 | Ga0105240_10295206 | Ga0105240_102952062 | 178 |
| 190 | 3300009093 | Ga0105240_10328961 | Ga0105240_103289612 | 178 |
| 191 | 3300009094 | Ga0111539_11122509 | Ga0111539_111225091 | 178 |
| 192 | 3300009094 | Ga0111539_11593094 | Ga0111539_115930941 | 178 |
| 193 | 3300009098 | Ga0105245_10020480 | Ga0105245_100204806 | 178 |
| 194 | 3300009098 | Ga0105245_11291332 | Ga0105245_112913321 | 178 |
| 195 | 3300009101 | Ga0105247_10265480 | Ga0105247_102654803 | 178 |
| 196 | 3300009101 | Ga0105247_10561964 | Ga0105247_105619641 | 178 |
| 197 | 3300009148 | Ga0105243_10539446 | Ga0105243_105394462 | 178 |
| 198 | 3300009148 | Ga0105243_10871987 | Ga0105243_108719872 | 178 |
| 199 | 3300009174 | Ga0105241_10031944 | Ga0105241_100319444 | 178 |
| 200 | 3300009174 | Ga0105241_10065200 | Ga0105241_100652005 | 178 |
| 201 | 3300009176 | Ga0105242_11922289 | Ga0105242_119222891 | 178 |
| 202 | 3300009177 | Ga0105248_10029743 | Ga0105248_100297435 | 178 |
| 203 | 3300009177 | Ga0105248_10212719 | Ga0105248_102127193 | 178 |
| 204 | 3300009545 | Ga0105237_10009981 | Ga0105237_100099819 | 178 |
| 205 | 3300009545 | Ga0105237_10071238 | Ga0105237_100712383 | 178 |
| 206 | 3300009545 | Ga0105237_10676891 | Ga0105237_106768911 | 178 |
| 207 | 3300009551 | Ga0105238_10052285 | Ga0105238_100522853 | 178 |
| 208 | 3300009551 | Ga0105238_10321517 | Ga0105238_103215173 | 178 |
| 209 | 3300009551 | Ga0105238_10633499 | Ga0105238_106334992 | 178 |
| 210 | 3300009553 | Ga0105249_10382173 | Ga0105249_103821731 | 178 |
| 211 | 3300010159 | Ga0099796_10011420 | Ga0099796_100114202 | 178 |
| 212 | 3300010375 | Ga0105239_10021820 | Ga0105239_100218206 | 178 |
| 213 | 3300010375 | Ga0105239_10464237 | Ga0105239_104642372 | 178 |
| 214 | 3300010375 | Ga0105239_10729002 | Ga0105239_107290021 | 178 |
| 215 | 3300011119 | Ga0105246_10108941 | Ga0105246_101089412 | 178 |
| 216 | 3300013102 | Ga0157371_10157398 | Ga0157371_101573983 | 178 |
| 217 | 3300013104 | Ga0157370_10066724 | Ga0157370_100667244 | 178 |
| 218 | 3300013105 | Ga0157369_10022233 | Ga0157369_100222332 | 178 |
| 219 | 3300013296 | Ga0157374_11411810 | Ga0157374_114118101 | 178 |
| 220 | 3300013297 | Ga0157378_10087963 | Ga0157378_100879635 | 178 |
| 221 | 3300013297 | Ga0157378_10694451 | Ga0157378_106944512 | 178 |
| 222 | 3300013306 | Ga0163162_10436371 | Ga0163162_104363712 | 178 |
| 223 | 3300013307 | Ga0157372_11468592 | Ga0157372_114685921 | 178 |
| 224 | 3300013308 | Ga0157375_10626091 | Ga0157375_106260912 | 178 |
| 225 | 3300014325 | Ga0163163_11210697 | Ga0163163_112106972 | 178 |
| 226 | 3300014326 | Ga0157380_10820688 | Ga0157380_108206881 | 178 |
| 227 | 3300014745 | Ga0157377_10344122 | Ga0157377_103441222 | 178 |
| 228 | 3300014968 | Ga0157379_10233269 | Ga0157379_102332693 | 178 |
| 229 | 3300014969 | Ga0157376_10145980 | Ga0157376_101459802 | 178 |
| 230 | 3300014969 | Ga0157376_10759630 | Ga0157376_107596302 | 178 |
| 231 | 3300014969 | Ga0157376_12082861 | Ga0157376_120828611 | 178 |
| 232 | 3300025321 | Ga0207656_10117668 | Ga0207656_101176682 | 178 |
| 233 | 3300025898 | Ga0207692_10006485 | Ga0207692_100064853 | 178 |
| 234 | 3300025900 | Ga0207710_10045662 | Ga0207710_100456622 | 178 |
| 235 | 3300025900 | Ga0207710_10405717 | Ga0207710_104057172 | 178 |
| 236 | 3300025901 | Ga0207688_10250072 | Ga0207688_102500723 | 178 |
| 237 | 3300025906 | Ga0207699_10090593 | Ga0207699_100905933 | 178 |
| 238 | 3300025910 | Ga0207684_10380836 | Ga0207684_103808362 | 178 |
| 239 | 3300025911 | Ga0207654_10025899 | Ga0207654_100258994 | 178 |
| 240 | 3300025911 | Ga0207654_10131736 | Ga0207654_101317363 | 178 |
| 241 | 3300025912 | Ga0207707_10000818 | Ga0207707_100008189 | 178 |
| 242 | 3300025912 | Ga0207707_10026440 | Ga0207707_100264407 | 178 |
| 243 | 3300025913 | Ga0207695_10191621 | Ga0207695_101916212 | 178 |
| 244 | 3300025914 | Ga0207671_10388734 | Ga0207671_103887342 | 178 |
| 245 | 3300025914 | Ga0207671_10845649 | Ga0207671_108456492 | 178 |
| 246 | 3300025915 | Ga0207693_10086594 | Ga0207693_100865942 | 178 |
| 247 | 3300025915 | Ga0207693_10099970 | Ga0207693_100999704 | 178 |
| 248 | 3300025917 | Ga0207660_10014327 | Ga0207660_100143275 | 178 |
| 249 | 3300025917 | Ga0207660_10056654 | Ga0207660_100566544 | 178 |
| 250 | 3300025917 | Ga0207660_10121123 | Ga0207660_101211234 | 178 |
| 251 | 3300025919 | Ga0207657_10002310 | Ga0207657_1000231017 | 178 |
| 252 | 3300025920 | Ga0207649_10179863 | Ga0207649_101798632 | 178 |
| 253 | 3300025921 | Ga0207652_10002033 | Ga0207652_1000203312 | 178 |
| 254 | 3300025921 | Ga0207652_10073002 | Ga0207652_100730022 | 178 |
| 255 | 3300025921 | Ga0207652_10322640 | Ga0207652_103226403 | 178 |
| 256 | 3300025922 | Ga0207646_11007888 | Ga0207646_110078881 | 178 |
| 257 | 3300025924 | Ga0207694_10046228 | Ga0207694_100462285 | 178 |
| 258 | 3300025924 | Ga0207694_10247994 | Ga0207694_102479941 | 178 |
| 259 | 3300025926 | Ga0207659_10192949 | Ga0207659_101929493 | 178 |
| 260 | 3300025927 | Ga0207687_10045295 | Ga0207687_100452954 | 178 |
| 261 | 3300025928 | Ga0207700_10061431 | Ga0207700_100614314 | 178 |
| 262 | 3300025928 | Ga0207700_10094494 | Ga0207700_100944943 | 178 |
| 263 | 3300025928 | Ga0207700_10437484 | Ga0207700_104374842 | 178 |
| 264 | 3300025931 | Ga0207644_11031966 | Ga0207644_110319661 | 178 |
| 265 | 3300025933 | Ga0207706_10702320 | Ga0207706_107023201 | 178 |
| 266 | 3300025935 | Ga0207709_10161865 | Ga0207709_101618651 | 178 |
| 267 | 3300025935 | Ga0207709_10186241 | Ga0207709_101862413 | 178 |
| 268 | 3300025936 | Ga0207670_10750185 | Ga0207670_107501852 | 178 |
| 269 | 3300025937 | Ga0207669_11095793 | Ga0207669_110957931 | 178 |
| 270 | 3300025939 | Ga0207665_10147765 | Ga0207665_101477652 | 178 |
| 271 | 3300025941 | Ga0207711_10032980 | Ga0207711_100329805 | 178 |
| 272 | 3300025941 | Ga0207711_10107474 | Ga0207711_101074743 | 178 |
| 273 | 3300025941 | Ga0207711_10654195 | Ga0207711_106541952 | 178 |
| 274 | 3300025944 | Ga0207661_10063222 | Ga0207661_100632222 | 178 |
| 275 | 3300025944 | Ga0207661_10276573 | Ga0207661_102765733 | 178 |
| 276 | 3300025945 | Ga0207679_10428260 | Ga0207679_104282602 | 178 |
| 277 | 3300025949 | Ga0207667_10076540 | Ga0207667_100765403 | 178 |
| 278 | 3300025949 | Ga0207667_10164042 | Ga0207667_101640423 | 178 |
| 279 | 3300025972 | Ga0207668_10208355 | Ga0207668_102083553 | 178 |
| 280 | 3300025972 | Ga0207668_10696915 | Ga0207668_106969152 | 178 |
| 281 | 3300025981 | Ga0207640_10063207 | Ga0207640_100632073 | 178 |
| 282 | 3300026023 | Ga0207677_10066768 | Ga0207677_100667683 | 178 |
| 283 | 3300026035 | Ga0207703_10058015 | Ga0207703_100580154 | 178 |
| 284 | 3300026041 | Ga0207639_10064286 | Ga0207639_100642864 | 178 |
| 285 | 3300026041 | Ga0207639_10370514 | Ga0207639_103705142 | 178 |
| 286 | 3300026067 | Ga0207678_10080323 | Ga0207678_100803233 | 178 |
| 287 | 3300026067 | Ga0207678_10249867 | Ga0207678_102498673 | 178 |
| 288 | 3300026078 | Ga0207702_10785053 | Ga0207702_107850531 | 178 |
| 289 | 3300026088 | Ga0207641_10558223 | Ga0207641_105582232 | 178 |
| 290 | 3300026095 | Ga0207676_11423048 | Ga0207676_114230481 | 178 |
| 291 | 3300026116 | Ga0207674_10212150 | Ga0207674_102121501 | 178 |
| 292 | 3300026116 | Ga0207674_10243056 | Ga0207674_102430563 | 178 |
| 293 | 3300026121 | Ga0207683_10092472 | Ga0207683_100924723 | 178 |
| 294 | 3300026142 | Ga0207698_10503920 | Ga0207698_105039203 | 178 |
| 295 | 3300026142 | Ga0207698_10795128 | Ga0207698_107951282 | 178 |
| 296 | 3300027866 | Ga0209813_10014454 | Ga0209813_100144543 | 178 |
| 297 | 3300028379 | Ga0268266_10276738 | Ga0268266_102767383 | 178 |
| 298 | 3300028380 | Ga0268265_10400026 | Ga0268265_104000263 | 178 |
| 299 | 3300028786 | Ga0307517_10055822 | Ga0307517_100558223 | 178 |
| 300 | 3300035089 | Ga0373944_0048425 | Ga0373944_0048425_460_996 | 178 |
| 301 | 3300035118 | Ga0373954_0092916 | Ga0373954_0092916_430_966 | 178 |
| 302 | 3300035170 | Ga0373943_0010903 | Ga0373943_0010903_1519_2055 | 178 |
| 303 | 3300035410 | Ga0373924_0111553 | Ga0373924_0111553_585_1121 | 178 |
| 304 | 3300035692 | Ga0373935_0000338 | Ga0373935_0000338_10141_10677 | 178 |
| 305 | 3300035695 | Ga0373927_0001017 | Ga0373927_0001017_7865_8401 | 178 |
| 306 | 3300035725 | Ga0373947_0001103 | Ga0373947_0001103_8114_8650 | 178 |
| 307 | 3300035725 | Ga0373947_0026056 | Ga0373947_0026056_42_578 | 178 |
| 308 | 3300037068 | Ga0373925_0001334 | Ga0373925_0001334_10609_11145 | 178 |
| 309 | 3300037418 | Ga0395900_0002352 | Ga0395900_0002352_18568_19104 | 178 |
| 310 | 3300037466 | Ga0395898_0117140 | Ga0395898_0117140_312_848 | 178 |
| 311 | 3300037471 | Ga0395905_0347533 | Ga0395905_0347533_704_1240 | 178 |
| 312 | 3300039437 | Ga0436365_1451163 | Ga0436365_1451163_1234_1782 | 178 |
| 313 | 3300039447 | Ga0436361_0338149 | Ga0436361_0338149_34_570 | 178 |
| 314 | 3300044706 | Ga0466964_0375464 | Ga0466964_0375464_31_567 | 178 |
| 315 | 3300045049 | Ga0466959_0322420 | Ga0466959_0322420_299_835 | 178 |
| 316 | 3300046454 | Ga0495592_0008296 | Ga0495592_0008296_7218_7754 | 178 |
| 317 | 3300046454 | Ga0495592_0529034 | Ga0495592_0529034_156_716 | 178 |
| 318 | 3300046455 | Ga0495603_0000420 | Ga0495603_0000420_12165_12701 | 178 |
| 319 | 3300046455 | Ga0495603_0081268 | Ga0495603_0081268_597_1133 | 178 |
| 320 | 3300046457 | Ga0495590_0042392 | Ga0495590_0042392_1006_1542 | 178 |
| 321 | 3300046459 | Ga0495629_0000412 | Ga0495629_0000412_24463_24999 | 178 |
| 322 | 3300046461 | Ga0495641_0002262 | Ga0495641_0002262_10385_10921 | 178 |
| 323 | 3300046462 | Ga0495651_0047144 | Ga0495651_0047144_1237_1773 | 178 |
| 324 | 3300046472 | Ga0495580_0004412 | Ga0495580_0004412_5533_6069 | 178 |
| 325 | 3300046473 | Ga0495582_0000043 | Ga0495582_0000043_10754_11290 | 178 |
| 326 | 3300046475 | Ga0495639_0000393 | Ga0495639_0000393_13337_13873 | 178 |
| 327 | 3300046475 | Ga0495639_0519550 | Ga0495639_0519550_52_588 | 178 |
| 328 | 3300046476 | Ga0495662_0000725 | Ga0495662_0000725_10841_11377 | 178 |
| 329 | 3300046477 | Ga0495664_0022549 | Ga0495664_0022549_2143_2679 | 178 |
| 330 | 3300046499 | Ga0495594_0005033 | Ga0495594_0005033_4028_4564 | 178 |
| 331 | 3300046507 | Ga0495606_0281929 | Ga0495606_0281929_325_861 | 178 |
| 332 | 3300046507 | Ga0495606_0374470 | Ga0495606_0374470_130_666 | 178 |
| 333 | 3300046513 | Ga0495616_0087898 | Ga0495616_0087898_312_848 | 178 |
| 334 | 3300046514 | Ga0495618_0049754 | Ga0495618_0049754_1172_1708 | 178 |
| 335 | 3300046516 | Ga0495628_0079450 | Ga0495628_0079450_338_874 | 178 |
| 336 | 3300046516 | Ga0495628_0156729 | Ga0495628_0156729_441_992 | 178 |
| 337 | 3300046517 | Ga0495630_0000409 | Ga0495630_0000409_27261_27797 | 178 |
| 338 | 3300046523 | Ga0495644_0066462 | Ga0495644_0066462_574_1110 | 178 |
| 339 | 3300046526 | Ga0495666_0031113 | Ga0495666_0031113_294_830 | 178 |
| 340 | 3300046529 | Ga0495652_0027823 | Ga0495652_0027823_3651_4187 | 178 |
| 341 | 3300046530 | Ga0495654_0199870 | Ga0495654_0199870_58_594 | 178 |
| 342 | 3300046531 | Ga0495665_0000051 | Ga0495665_0000051_10812_11348 | 178 |
| 343 | 3300046533 | Ga0495640_0001853 | Ga0495640_0001853_8069_8605 | 178 |
| 344 | 3300046537 | Ga0495598_0003534 | Ga0495598_0003534_1195_1731 | 178 |
| 345 | 3300046539 | Ga0495621_0019450 | Ga0495621_0019450_1334_1870 | 178 |
| 346 | 3300046557 | Ga0495622_0003740 | Ga0495622_0003740_6104_6640 | 178 |
| 347 | 3300046559 | Ga0495667_0168125 | Ga0495667_0168125_812_1348 | 178 |
| 348 | 3300046615 | Ga0495656_0054160 | Ga0495656_0054160_58_594 | 178 |
| 349 | 3300046642 | Ga0495634_0000400 | Ga0495634_0000400_6001_6537 | 178 |
| 350 | 3300046648 | Ga0495611_0302513 | Ga0495611_0302513_141_677 | 178 |
| 351 | 3300046663 | Ga0495635_0000726 | Ga0495635_0000726_7074_7610 | 178 |
| 352 | 3300046664 | Ga0495659_0002538 | Ga0495659_0002538_4541_5077 | 178 |
| 353 | 3300046664 | Ga0495659_0037983 | Ga0495659_0037983_850_1386 | 178 |
| 354 | 3300046674 | Ga0495588_0053710 | Ga0495588_0053710_533_1069 | 178 |
| 355 | 3300046680 | Ga0495646_0013878 | Ga0495646_0013878_4551_5087 | 178 |
| 356 | 3300046681 | Ga0495647_0000550 | Ga0495647_0000550_10140_10676 | 178 |
| 357 | 3300046683 | Ga0495658_0002754 | Ga0495658_0002754_5812_6348 | 178 |
| 358 | 3300046684 | Ga0495669_0030348 | Ga0495669_0030348_946_1482 | 178 |
| 359 | 3300046684 | Ga0495669_0051364 | Ga0495669_0051364_208_744 | 178 |
| 360 | 3300046690 | Ga0495624_0001111 | Ga0495624_0001111_10875_11411 | 178 |
| 361 | 3300046690 | Ga0495624_0333010 | Ga0495624_0333010_157_693 | 178 |
| 362 | 3300046691 | Ga0495670_0037313 | Ga0495670_0037313_1218_1754 | 178 |
| 363 | 3300046694 | Ga0495649_0274850 | Ga0495649_0274850_176_712 | 178 |
| 364 | 3300047315 | Ga0495581_0000173 | Ga0495581_0000173_10830_11366 | 178 |
| 365 | 3300047315 | Ga0495581_0097358 | Ga0495581_0097358_441_977 | 178 |
| 366 | 3300047317 | Ga0495604_0203480 | Ga0495604_0203480_24_560 | 178 |
| 367 | 3300047319 | Ga0495674_0002072 | Ga0495674_0002072_10815_11351 | 178 |
| 368 | 3300047320 | Ga0495672_0046697 | Ga0495672_0046697_632_1171 | 178 |
| 369 | 3300047321 | Ga0495676_0011494 | Ga0495676_0011494_2801_3337 | 178 |
| 370 | 3300047444 | Ga0495675_0139370 | Ga0495675_0139370_831_1394 | 178 |
| 371 | 3300047445 | Ga0495677_0081470 | Ga0495677_0081470_585_1121 | 178 |
| 372 | 3300047447 | Ga0495685_071128 | Ga0495685_071128_459_995 | 178 |
| 373 | 3300047469 | Ga0495673_0178866 | Ga0495673_0178866_68_604 | 178 |
| 374 | 3300047471 | Ga0495684_0017683 | Ga0495684_0017683_2306_2842 | 178 |
| 375 | 3300047673 | Ga0495593_0000222 | Ga0495593_0000222_4594_5130 | 178 |
| 376 | 3300048088 | Ga0495602_0316444 | Ga0495602_0316444_148_684 | 178 |
| 377 | 3300048089 | Ga0495614_0005302 | Ga0495614_0005302_2882_3418 | 178 |
| 378 | 3300048905 | Ga0496102_0080275 | Ga0496102_0080275_550_1086 | 178 |
| 379 | 3300048906 | Ga0496103_0761397 | Ga0496103_0761397_47_583 | 178 |
| 380 | 3300048907 | Ga0496104_0635994 | Ga0496104_0635994_157_693 | 178 |
| 381 | 3300048909 | Ga0496106_0407014 | Ga0496106_0407014_253_789 | 178 |
| 382 | 3300048910 | Ga0496107_0172087 | Ga0496107_0172087_149_685 | 178 |
| 383 | 3300048911 | Ga0496108_0084338 | Ga0496108_0084338_184_720 | 178 |
| 384 | 3300048913 | Ga0496110_0406971 | Ga0496110_0406971_692_1228 | 178 |
| 385 | 3300048916 | Ga0496113_0372786 | Ga0496113_0372786_175_711 | 178 |
| 386 | 3300048920 | Ga0496117_0303181 | Ga0496117_0303181_146_682 | 178 |
| 387 | 3300048924 | Ga0496121_0000893 | Ga0496121_0000893_22085_22624 | 178 |
| 388 | 3300048924 | Ga0496121_0175321 | Ga0496121_0175321_777_1313 | 178 |
| 389 | 3300048924 | Ga0496121_0204708 | Ga0496121_0204708_638_1174 | 178 |
| 390 | 3300048924 | Ga0496121_0263227 | Ga0496121_0263227_447_983 | 178 |
| 391 | 3300048924 | Ga0496121_0611750 | Ga0496121_0611750_12_551 | 178 |
| 392 | 3300048927 | Ga0496124_0384137 | Ga0496124_0384137_156_692 | 178 |
| 393 | 3300048928 | Ga0496125_0089146 | Ga0496125_0089146_467_1003 | 178 |
| 394 | 3300048929 | Ga0496126_0108568 | Ga0496126_0108568_1700_2293 | 178 |
| 395 | 3300048929 | Ga0496126_0279499 | Ga0496126_0279499_800_1354 | 178 |
| 396 | 3300048929 | Ga0496126_0654649 | Ga0496126_0654649_142_678 | 178 |
| 397 | 3300049587 | Ga0501071_0693341 | Ga0501071_0693341_112_648 | 178 |
| 398 | 3300050489 | nmdc:mga03683_10854_c1 | nmdc:mga03683_10854_c1_243_800 | 178 |
| 399 | 3300050489 | nmdc:mga03683_222091_c1 | nmdc:mga03683_222091_c1_114_650 | 178 |
| 400 | 3300050490 | nmdc:mga03n38_208874_c1 | nmdc:mga03n38_208874_c1_276_812 | 178 |
| 401 | 3300050491 | nmdc:mga00v17_345213_c1 | nmdc:mga00v17_345213_c1_369_905 | 178 |
| 402 | 3300050491 | nmdc:mga00v17_410847_c1 | nmdc:mga00v17_410847_c1_265_810 | 178 |
| 403 | 3300050492 | nmdc:mga0yw44_256243_c1 | nmdc:mga0yw44_256243_c1_580_1125 | 178 |
| 404 | 3300050492 | nmdc:mga0yw44_361840_c1 | nmdc:mga0yw44_361840_c1_352_897 | 178 |
| 405 | 3300050493 | nmdc:mga0k408_169459_c1 | nmdc:mga0k408_169459_c1_321_857 | 178 |
| 406 | 3300050493 | nmdc:mga0k408_320229_c1 | nmdc:mga0k408_320229_c1_140_685 | 178 |
| 407 | 3300050493 | nmdc:mga0k408_53291_c1 | nmdc:mga0k408_53291_c1_276_812 | 178 |
| 408 | 3300050494 | nmdc:mga06z11_116342_c2 | nmdc:mga06z11_116342_c2_428_985 | 178 |
| 409 | 3300050494 | nmdc:mga06z11_176663_c1 | nmdc:mga06z11_176663_c1_192_737 | 178 |
| 410 | 3300050494 | nmdc:mga06z11_432189_c1 | nmdc:mga06z11_432189_c1_179_724 | 178 |
| 411 | 3300050495 | nmdc:mga04h51_180165_c1 | nmdc:mga04h51_180165_c1_23_559 | 178 |
| 412 | 3300050496 | nmdc:mga07m45_189854_c1 | nmdc:mga07m45_189854_c1_607_1143 | 178 |
| 413 | 3300050496 | nmdc:mga07m45_517567_c1 | nmdc:mga07m45_517567_c1_38_574 | 178 |
| 414 | 3300050496 | nmdc:mga07m45_595433_c1 | nmdc:mga07m45_595433_c1_76_612 | 178 |
| 415 | 3300050513 | nmdc:mga0rr50_340498_c1 | nmdc:mga0rr50_340498_c1_583_1119 | 178 |
| 416 | 3300050516 | nmdc:mga0sz30_111254_c1 | nmdc:mga0sz30_111254_c1_205_762 | 178 |
| 417 | 3300050516 | nmdc:mga0sz30_217304_c1 | nmdc:mga0sz30_217304_c1_259_804 | 178 |
| 418 | 3300050516 | nmdc:mga0sz30_249360_c1 | nmdc:mga0sz30_249360_c1_199_744 | 178 |
| 419 | 3300053093 | Ga0500651_0041814 | Ga0500651_0041814_1857_2393 | 178 |
| 420 | 3300053093 | Ga0500651_0229603 | Ga0500651_0229603_460_1005 | 178 |
| 421 | 3300053098 | Ga0500650_0275726 | Ga0500650_0275726_132_677 | 178 |
| 422 | 3300053098 | Ga0500650_0312730 | Ga0500650_0312730_87_623 | 178 |
| 423 | 3300053104 | Ga0500556_0005445 | Ga0500556_0005445_1293_1832 | 178 |
| 424 | 3300053108 | Ga0500562_121636 | Ga0500562_121636_122_658 | 178 |
| 425 | 3300053119 | Ga0500595_016941 | Ga0500595_016941_1820_2359 | 178 |
| 426 | 3300053139 | Ga0500568_0004386 | Ga0500568_0004386_5976_6515 | 178 |
| 427 | 3300053153 | Ga0500616_0004795 | Ga0500616_0004795_1228_1773 | 178 |
| 428 | 3300053155 | Ga0500620_133252 | Ga0500620_133252_75_620 | 178 |
| 429 | 3300053733 | Ga0500552_000469 | Ga0500552_000469_1853_2398 | 178 |
| 430 | 3300061734 | Ga0530510_0774281 | Ga0530510_0774281_132_719 | 178 |
| 431 | iso_pu_bacteria | 2791355199 | 2793081050 | 178 |
| 432 | 3300005434 | Ga0070709_10001335 | Ga0070709_100013353 | 179 |
| 433 | 3300005434 | Ga0070709_10018092 | Ga0070709_100180923 | 179 |
| 434 | 3300005434 | Ga0070709_10234074 | Ga0070709_102340742 | 179 |
| 435 | 3300005435 | Ga0070714_100016284 | Ga0070714_1000162845 | 179 |
| 436 | 3300005436 | Ga0070713_100004922 | Ga0070713_1000049224 | 179 |
| 437 | 3300005436 | Ga0070713_100122908 | Ga0070713_1001229083 | 179 |
| 438 | 3300005437 | Ga0070710_10082375 | Ga0070710_100823751 | 179 |
| 439 | 3300005437 | Ga0070710_10150392 | Ga0070710_101503921 | 179 |
| 440 | 3300005439 | Ga0070711_100036048 | Ga0070711_1000360483 | 179 |
| 441 | 3300005536 | Ga0070697_101257664 | Ga0070697_1012576641 | 179 |
| 442 | 3300006028 | Ga0070717_10007835 | Ga0070717_100078359 | 179 |
| 443 | 3300006163 | Ga0070715_10003126 | Ga0070715_100031264 | 179 |
| 444 | 3300006173 | Ga0070716_100007047 | Ga0070716_1000070473 | 179 |
| 445 | 3300006173 | Ga0070716_100073602 | Ga0070716_1000736022 | 179 |
| 446 | 3300006173 | Ga0070716_100125486 | Ga0070716_1001254863 | 179 |
| 447 | 3300006175 | Ga0070712_100018869 | Ga0070712_1000188695 | 179 |
| 448 | 3300006175 | Ga0070712_100022114 | Ga0070712_1000221143 | 179 |
| 449 | 3300006914 | Ga0075436_100091485 | Ga0075436_1000914851 | 179 |
| 450 | 3300010375 | Ga0105239_10172651 | Ga0105239_101726513 | 179 |
| 451 | 3300021358 | Ga0213873_10111885 | Ga0213873_101118851 | 179 |
| 452 | 3300021361 | Ga0213872_10022265 | Ga0213872_100222653 | 179 |
| 453 | 3300021361 | Ga0213872_10071191 | Ga0213872_100711913 | 179 |
| 454 | 3300024227 | Ga0228598_1025133 | Ga0228598_10251332 | 179 |
| 455 | 3300025898 | Ga0207692_10008743 | Ga0207692_100087434 | 179 |
| 456 | 3300025898 | Ga0207692_10021040 | Ga0207692_100210401 | 179 |
| 457 | 3300025905 | Ga0207685_10011283 | Ga0207685_100112832 | 179 |
| 458 | 3300025906 | Ga0207699_10004550 | Ga0207699_100045508 | 179 |
| 459 | 3300025906 | Ga0207699_10007207 | Ga0207699_100072075 | 179 |
| 460 | 3300025915 | Ga0207693_10001772 | Ga0207693_1000177212 | 179 |
| 461 | 3300025915 | Ga0207693_10386825 | Ga0207693_103868252 | 179 |
| 462 | 3300025916 | Ga0207663_10015860 | Ga0207663_100158603 | 179 |
| 463 | 3300025916 | Ga0207663_10327632 | Ga0207663_103276322 | 179 |
| 464 | 3300025929 | Ga0207664_10007907 | Ga0207664_100079074 | 179 |
| 465 | 3300025939 | Ga0207665_10001072 | Ga0207665_1000107213 | 179 |
| 466 | 3300025939 | Ga0207665_10008363 | Ga0207665_100083634 | 179 |
| 467 | 3300025939 | Ga0207665_10050948 | Ga0207665_100509482 | 179 |
| 468 | 3300025939 | Ga0207665_10505271 | Ga0207665_105052712 | 179 |
| 469 | 3300035410 | Ga0373924_0130046 | Ga0373924_0130046_116_655 | 179 |
| 470 | 3300036401 | Ga0373937_0113568 | Ga0373937_0113568_1684_2223 | 179 |
| 471 | 3300039438 | Ga0436360_0496486 | Ga0436360_0496486_1519_2091 | 179 |
| 472 | 3300039438 | Ga0436360_0688980 | Ga0436360_0688980_932_1510 | 179 |
| 473 | 3300039447 | Ga0436361_0771035 | Ga0436361_0771035_3715_4302 | 179 |
| 474 | 3300039447 | Ga0436361_1050549 | Ga0436361_1050549_3180_3758 | 179 |
| 475 | 3300039453 | Ga0436362_1161726 | Ga0436362_1161726_177_749 | 179 |
| 476 | 3300044656 | Ga0466969_0063486 | Ga0466969_0063486_428_1060 | 179 |
| 477 | 3300045049 | Ga0466959_0125244 | Ga0466959_0125244_864_1496 | 179 |
| 478 | 3300046462 | Ga0495651_0131248 | Ga0495651_0131248_1004_1543 | 179 |
| 479 | 3300046463 | Ga0495653_0371439 | Ga0495653_0371439_352_891 | 179 |
| 480 | 3300046511 | Ga0495608_0070334 | Ga0495608_0070334_1012_1551 | 179 |
| 481 | 3300046516 | Ga0495628_0246644 | Ga0495628_0246644_588_1127 | 179 |
| 482 | 3300046536 | Ga0495587_0089281 | Ga0495587_0089281_746_1285 | 179 |
| 483 | 3300046543 | Ga0495645_0281920 | Ga0495645_0281920_227_766 | 179 |
| 484 | 3300046663 | Ga0495635_0270968 | Ga0495635_0270968_425_964 | 179 |
| 485 | 3300046679 | Ga0495623_0016947 | Ga0495623_0016947_1279_1818 | 179 |
| 486 | 3300046690 | Ga0495624_0280197 | Ga0495624_0280197_298_837 | 179 |
| 487 | 3300047319 | Ga0495674_0467966 | Ga0495674_0467966_254_793 | 179 |
| 488 | 3300047444 | Ga0495675_0026516 | Ga0495675_0026516_615_1154 | 179 |
| 489 | 3300047673 | Ga0495593_0114872 | Ga0495593_0114872_550_1089 | 179 |
| 490 | 3300048929 | Ga0496126_0023120 | Ga0496126_0023120_1025_1564 | 179 |
| 491 | 3300050512 | nmdc:mga0n895_15793_c1 | nmdc:mga0n895_15793_c1_1753_2292 | 179 |
| 492 | 3300050514 | nmdc:mga08x19_662988_c1 | nmdc:mga08x19_662988_c1_75_614 | 179 |
| 493 | 3300053078 | Ga0495612_0386236 | Ga0495612_0386236_84_623 | 179 |
| 494 | 3300053085 | Ga0495619_0201296 | Ga0495619_0201296_469_1008 | 179 |
| 495 | 3300003320 | rootH2_10225435 | rootH2_102254351 | 180 |
| 496 | 3300005435 | Ga0070714_100352820 | Ga0070714_1003528202 | 180 |
| 497 | 3300005437 | Ga0070710_10348000 | Ga0070710_103480002 | 180 |
| 498 | 3300005983 | Ga0081540_1042158 | Ga0081540_10421583 | 180 |
| 499 | 3300009545 | Ga0105237_10027277 | Ga0105237_100272775 | 180 |
| 500 | 3300010375 | Ga0105239_10924470 | Ga0105239_109244702 | 180 |
| 501 | 3300030521 | Ga0307511_10054131 | Ga0307511_100541315 | 180 |
| 502 | 3300031616 | Ga0307508_10000002 | Ga0307508_1000000220 | 180 |
| 503 | 3300031730 | Ga0307516_10099649 | Ga0307516_100996494 | 180 |
| 504 | 3300039450 | Ga0436363_0200004 | Ga0436363_0200004_2050_2631 | 180 |
| 505 | 3300044735 | Ga0466968_0086308 | Ga0466968_0086308_13_624 | 180 |
| 506 | 3300048928 | Ga0496125_0247667 | Ga0496125_0247667_186_806 | 180 |
| 507 | iso_pu_bacteria | 2508501128 | 2509153874 | 180 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3g7r-assembly1.cif.gz_B | crystal structure of sco4454, a tetr-family transcriptional regulator from streptomyces coelicolor | 0.7891 | 7 | 178 |
| 3br5-assembly2.cif.gz_E | crystal structure of the complex of rhodamine 6g bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor | 0.7784 | 7 | 177 |
| 1jt0-assembly1.cif.gz_C | crystal structure of a cooperative qacr-dna complex | 0.7753 | 10 | 177 |
| 3br6-assembly2.cif.gz_D | crystal structure of the complex of rhodamine 6g bound to qacr(e120q), a mutant of a multidrug binding transcriptional repressor | 0.7741 | 10 | 177 |
| 3br3-assembly1.cif.gz_B | crystal structure of the complex of ethidium bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor | 0.7677 | 10 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3fiwB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.971 | 6 | 52 | 1.10.10.60 |
| 3fiwD01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9594 | 6 | 52 | 1.10.10.60 |
| 3b6cA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9472 | 4 | 59 | 1.10.10.60 |
| 1zk8B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.945 | 5 | 47 | 1.10.10.60 |
| 2y2zA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9436 | 5 | 59 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-H0TRG6-F1-model_v4 | Putative transcriptional regulator protein | 0.9791 | 1 | 180 |
GO:0003677
|
| AF-A0A2H9VKR7-F1-model_v4 | deleted | 0.9763 | 1 | 178 |
|
| AF-A0A0S6UNV9-F1-model_v4 | HTH tetR-type domain-containing protein | 0.9732 | 1 | 179 |
GO:0003677
|
| AF-A0A1I7EYK7-F1-model_v4 | deleted | 0.9721 | 1 | 176 |
|
| AF-A0A2H9VKR7-F1-model_v4 | deleted | 0.9604 | 1 | 178 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar