F456642

General Info

Members Datasets Scaffolds Average Seq Length
507 331 483 180

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100352820|Ga0070714_1003528202
Length 213
Sequence MRFTVAPVNTEVYGCDIMSDQLSVRDWLDQGLKTLAERGFTALKAEPLAKALGVSRGSFYWHFSDVGAYHAAILKYWREVAAERVIADIEAAADNESPLKILLRQAFSGRLALERAVRSWATVDPAAKGAVQAIDRRRLDYIDGQLQALGLPCAVAQARAQILYWAFVGHALSDRPPLKARQDTLIEELLRMAYGDASGAPVLEPRQKPEKKP

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
4 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
5 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
6 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
7 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
8 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
9 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
10 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
11 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
12 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
13 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
14 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
15 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
16 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
17 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
18 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
19 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
85 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
116 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
117 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
118 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
119 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
169 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
170 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
171 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
195 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
200 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
205 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
213 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
229 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
230 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
231 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
234 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
238 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
247 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
254 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
261 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
262 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
265 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
266 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
282 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
285 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
292 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
302 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
303 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
304 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
305 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
306 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
307 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
308 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
309 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
310 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
311 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
312 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
313 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
314 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
315 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
316 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
317 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
318 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
321 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
322 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
323 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
324 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
325 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
326 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
327 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
328 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
329 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
330 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
331 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.45
Metatranscriptomes 0
Isolates 4.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.43
Nodule 4.54
Rhizoplane 1.58
Rhizosphere 75.15
Stem 0
Stem Tuber 0
Unclassified 6.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10225435 3300003320 Bacteria 1533
2 rootL2_10116603 3300003322 Bacteria 2481
3 rootH1_10215295 3300003323 Bacteria 2596
4 JGI25160J50197_1014932 3300003354 Bacteria 2572
5 JGI25404J52841_10008363 3300003659 Bacteria 2202
6 Ga0055543_1032902 3300004625 Bacteria 899
7 Ga0070683_100819375 3300005329 Bacteria 892
8 Ga0068869_100106951 3300005334 Bacteria 2123
9 Ga0070666_10459608 3300005335 Bacteria 920
10 Ga0070680_100038719 3300005336 Bacteria 3857
11 Ga0070680_100064607 3300005336 Bacteria 2999
12 Ga0070682_100027943 3300005337 Bacteria 3389
13 Ga0070682_100067452 3300005337 Bacteria 2279
14 Ga0070660_100025078 3300005339 Bacteria 4430
15 Ga0070660_100546954 3300005339 Bacteria 966
16 Ga0070668_100151717 3300005347 Bacteria 1874
17 Ga0070668_100676528 3300005347 Bacteria 908
18 Ga0070669_100621420 3300005353 Bacteria 907
19 Ga0070675_100837557 3300005354 Bacteria 841
20 Ga0070671_100136679 3300005355 Bacteria 2067
21 Ga0070659_100418548 3300005366 Bacteria 1133
22 Ga0070709_10001335 3300005434 Bacteria 13459
23 Ga0070709_10018092 3300005434 Bacteria 4052
24 Ga0070709_10132209 3300005434 Unclassified 1705
25 Ga0070709_10147600 3300005434 Bacteria 1622
26 Ga0070709_10174607 3300005434 Bacteria 1504
27 Ga0070709_10234074 3300005434 Bacteria 1316
28 Ga0070714_100016284 3300005435 Bacteria 5998
29 Ga0070714_100352820 3300005435 Bacteria 1382
30 Ga0070714_100472167 3300005435 Bacteria 1194
31 Ga0070713_100004922 3300005436 Bacteria 9066
32 Ga0070713_100122908 3300005436 Bacteria 2279
33 Ga0070713_100136475 3300005436 Bacteria 2168
34 Ga0070713_100344714 3300005436 Bacteria 1381
35 Ga0070713_100577429 3300005436 Bacteria 1066
36 Ga0070710_10082375 3300005437 Bacteria 1881
37 Ga0070710_10150392 3300005437 Bacteria 1435
38 Ga0070710_10261406 3300005437 Bacteria 1116
39 Ga0070710_10348000 3300005437 Bacteria 980
40 Ga0070711_100036048 3300005439 Bacteria 3312
41 Ga0070711_100046199 3300005439 Bacteria 2965
42 Ga0070711_100049485 3300005439 Bacteria 2878
43 Ga0070663_100442631 3300005455 Bacteria 1070
44 Ga0070663_100463427 3300005455 Bacteria 1047
45 Ga0070678_100012480 3300005456 Bacteria 5284
46 Ga0070662_100072072 3300005457 Bacteria 2549
47 Ga0070681_10013576 3300005458 Bacteria 8103
48 Ga0070681_10069568 3300005458 Bacteria 3486
49 Ga0070706_100246318 3300005467 Bacteria 1669
50 Ga0070706_100305629 3300005467 Bacteria 1484
51 Ga0070707_100153903 3300005468 Bacteria 2239
52 Ga0070707_100503350 3300005468 Bacteria 1173
53 Ga0070707_101391196 3300005468 Bacteria 668
54 Ga0070698_100493600 3300005471 Bacteria 1162
55 Ga0070698_100593601 3300005471 Bacteria 1048
56 Ga0070699_100754667 3300005518 Bacteria 890
57 Ga0070679_100135841 3300005530 Bacteria 2440
58 Ga0070679_100192758 3300005530 Bacteria 2006
59 Ga0070697_100160053 3300005536 Bacteria 1902
60 Ga0070697_101257664 3300005536 Bacteria 660
61 Ga0070686_100319201 3300005544 Bacteria 1158
62 Ga0070665_100102858 3300005548 Bacteria 2860
63 Ga0070665_100594619 3300005548 Bacteria 1119
64 Ga0068855_100133256 3300005563 Bacteria 2836
65 Ga0068855_100206221 3300005563 Bacteria 2211
66 Ga0068855_100330575 3300005563 Bacteria 1683
67 Ga0070664_100365949 3300005564 Bacteria 1314
68 Ga0070664_101030205 3300005564 Bacteria 774
69 Ga0068857_100272864 3300005577 Bacteria 1554
70 Ga0068852_100916285 3300005616 Bacteria 894
71 Ga0068859_101031854 3300005617 Bacteria 904
72 Ga0068864_101195696 3300005618 Bacteria 759
73 Ga0068851_10029667 3300005834 Bacteria 2709
74 Ga0068863_100129956 3300005841 Bacteria 2404
75 Ga0068858_100259835 3300005842 Bacteria 1650
76 Ga0068860_100831377 3300005843 Bacteria 938
77 Ga0068862_100084875 3300005844 Bacteria 2751
78 Ga0068862_100210554 3300005844 Bacteria 1756
79 Ga0081455_10016558 3300005937 Bacteria 7112
80 Ga0081455_10039096 3300005937 Bacteria 4196
81 Ga0081540_1002536 3300005983 Bacteria 14814
82 Ga0081540_1004921 3300005983 Bacteria 10059
83 Ga0081540_1006135 3300005983 Bacteria 8827
84 Ga0081540_1007733 3300005983 Bacteria 7613
85 Ga0081540_1029010 3300005983 Bacteria 3092
86 Ga0081540_1030690 3300005983 Bacteria 2972
87 Ga0081540_1042158 3300005983 Bacteria 2357
88 Ga0081540_1081047 3300005983 Bacteria 1461
89 Ga0070717_10007835 3300006028 Bacteria 7949
90 Ga0070717_10094512 3300006028 Bacteria 2529
91 Ga0075365_10305637 3300006038 Bacteria 1119
92 Ga0075365_10354737 3300006038 Bacteria 1034
93 Ga0075365_10458178 3300006038 Bacteria 900
94 Ga0075363_100053139 3300006048 Bacteria 2164
95 Ga0070715_10003126 3300006163 Bacteria 5202
96 Ga0070715_10171846 3300006163 Bacteria 1080
97 Ga0070716_100007047 3300006173 Bacteria 5516
98 Ga0070716_100073602 3300006173 Bacteria 2016
99 Ga0070716_100125486 3300006173 Bacteria 1614
100 Ga0070716_100155261 3300006173 Bacteria 1477
101 Ga0070712_100018869 3300006175 Bacteria 4488
102 Ga0070712_100022114 3300006175 Bacteria 4184
103 Ga0070712_100324680 3300006175 Bacteria 1252
104 Ga0070712_100433218 3300006175 Bacteria 1092
105 Ga0075362_10053861 3300006177 Bacteria 1807
106 Ga0075362_10164161 3300006177 Bacteria 1070
107 Ga0075367_10129915 3300006178 Bacteria 1557
108 Ga0075369_10043584 3300006186 Unclassified 1926
109 Ga0075369_10047092 3300006186 Bacteria 1859
110 Ga0075369_10103336 3300006186 Bacteria 1280
111 Ga0075369_10278318 3300006186 Bacteria 779
112 Ga0097621_101542228 3300006237 Bacteria 631
113 Ga0068871_100122484 3300006358 Bacteria 2198
114 Ga0068871_100132309 3300006358 Bacteria 2116
115 Ga0075430_100069585 3300006846 Bacteria 2952
116 Ga0075431_100006409 3300006847 Bacteria 11679
117 Ga0075434_100616637 3300006871 Bacteria 1104
118 Ga0075429_100007594 3300006880 Bacteria 9416
119 Ga0075436_100091485 3300006914 Bacteria 2115
120 Ga0097620_101031886 3300006931 Bacteria 904
121 Ga0099824_1017750 3300006942 Bacteria 6059
122 Ga0099822_1040583 3300006943 Bacteria 2577
123 Ga0075435_100969296 3300007076 Bacteria 742
124 Ga0105240_10006681 3300009093 Bacteria 16912
125 Ga0105240_10295206 3300009093 Bacteria 1856
126 Ga0105240_10328961 3300009093 Bacteria 1739
127 Ga0111539_10008018 3300009094 Bacteria 13471
128 Ga0111539_11122509 3300009094 Bacteria 913
129 Ga0111539_11593094 3300009094 Bacteria 757
130 Ga0105245_10020480 3300009098 Bacteria 5801
131 Ga0105245_11291332 3300009098 Bacteria 779
132 Ga0105247_10265480 3300009101 Bacteria 1178
133 Ga0105247_10561964 3300009101 Bacteria 840
134 Ga0114129_10000066 3300009147 Bacteria 93802
135 Ga0105243_10539446 3300009148 Bacteria 1112
136 Ga0105243_10871987 3300009148 Bacteria 893
137 Ga0105241_10031944 3300009174 Bacteria 3943
138 Ga0105241_10065200 3300009174 Bacteria 2814
139 Ga0105242_11922289 3300009176 Bacteria 632
140 Ga0105248_10029743 3300009177 Bacteria 6096
141 Ga0105248_10212719 3300009177 Bacteria 2178
142 Ga0105237_10009981 3300009545 Bacteria 10133
143 Ga0105237_10027277 3300009545 Bacteria 5831
144 Ga0105237_10071238 3300009545 Bacteria 3471
145 Ga0105237_10676891 3300009545 Bacteria 1038
146 Ga0105238_10052285 3300009551 Bacteria 4106
147 Ga0105238_10321517 3300009551 Bacteria 1533
148 Ga0105238_10633499 3300009551 Bacteria 1078
149 Ga0105249_10382173 3300009553 Bacteria 1434
150 Ga0105249_10865711 3300009553 Bacteria 970
151 Ga0099796_10011420 3300010159 Bacteria 2478
152 Ga0105239_10021820 3300010375 Bacteria 7059
153 Ga0105239_10172651 3300010375 Bacteria 2418
154 Ga0105239_10464237 3300010375 Bacteria 1437
155 Ga0105239_10729002 3300010375 Bacteria 1134
156 Ga0105239_10924470 3300010375 Bacteria 1001
157 Ga0105246_10108941 3300011119 Bacteria 2031
158 Ga0157371_10157398 3300013102 Bacteria 1622
159 Ga0157370_10066724 3300013104 Bacteria 3402
160 Ga0157369_10022233 3300013105 Bacteria 7083
161 Ga0157374_11411810 3300013296 Bacteria 719
162 Ga0157378_10087963 3300013297 Bacteria 2819
163 Ga0157378_10694451 3300013297 Bacteria 1036
164 Ga0163162_10436371 3300013306 Bacteria 1442
165 Ga0157372_11468592 3300013307 Bacteria 786
166 Ga0157375_10626091 3300013308 Bacteria 1234
167 Ga0163163_11210697 3300014325 Bacteria 818
168 Ga0157380_10820688 3300014326 Bacteria 949
169 Ga0157377_10344122 3300014745 Bacteria 998
170 Ga0157379_10233269 3300014968 Bacteria 1668
171 Ga0157376_10145980 3300014969 Bacteria 2128
172 Ga0157376_10759630 3300014969 Bacteria 979
173 Ga0157376_12082861 3300014969 Bacteria 606
174 Ga0214544_1000016 3300021320 Bacteria 204278
175 Ga0214542_1000016 3300021321 Bacteria 210332
176 Ga0214545_1000008 3300021324 Bacteria 215190
177 Ga0214543_1000043 3300021327 Bacteria 160517
178 Ga0213873_10111885 3300021358 Bacteria 794
179 Ga0213872_10022265 3300021361 Bacteria 2919
180 Ga0213872_10071191 3300021361 Bacteria 1568
181 Ga0228598_1025133 3300024227 Bacteria 1171
182 Ga0207426_1022383 3300025302 Bacteria 2169
183 Ga0207656_10117668 3300025321 Bacteria 1234
184 Ga0207692_10006485 3300025898 Bacteria 4746
185 Ga0207692_10008743 3300025898 Bacteria 4204
186 Ga0207692_10021040 3300025898 Bacteria 2978
187 Ga0207692_10082883 3300025898 Unclassified 1719
188 Ga0207710_10045662 3300025900 Bacteria 1954
189 Ga0207710_10405717 3300025900 Bacteria 700
190 Ga0207688_10250072 3300025901 Bacteria 1074
191 Ga0207685_10011283 3300025905 Bacteria 2680
192 Ga0207699_10004550 3300025906 Bacteria 6625
193 Ga0207699_10007207 3300025906 Bacteria 5427
194 Ga0207699_10090593 3300025906 Bacteria 1919
195 Ga0207699_10122760 3300025906 Unclassified 1683
196 Ga0207684_10380836 3300025910 Bacteria 1213
197 Ga0207654_10025899 3300025911 Bacteria 3171
198 Ga0207654_10131736 3300025911 Bacteria 1583
199 Ga0207707_10000818 3300025912 Bacteria 30499
200 Ga0207707_10026440 3300025912 Bacteria 5072
201 Ga0207695_10191621 3300025913 Bacteria 1962
202 Ga0207671_10388734 3300025914 Bacteria 1109
203 Ga0207671_10845649 3300025914 Bacteria 725
204 Ga0207693_10001772 3300025915 Bacteria 18926
205 Ga0207693_10086594 3300025915 Bacteria 2455
206 Ga0207693_10099970 3300025915 Bacteria 2274
207 Ga0207693_10271760 3300025915 Bacteria 1328
208 Ga0207693_10386825 3300025915 Bacteria 1094
209 Ga0207663_10015860 3300025916 Bacteria 4167
210 Ga0207663_10327632 3300025916 Bacteria 1153
211 Ga0207660_10014327 3300025917 Bacteria 5211
212 Ga0207660_10056654 3300025917 Bacteria 2805
213 Ga0207660_10121123 3300025917 Bacteria 1981
214 Ga0207657_10002310 3300025919 Bacteria 20669
215 Ga0207649_10179863 3300025920 Bacteria 1479
216 Ga0207652_10002033 3300025921 Bacteria 17427
217 Ga0207652_10073002 3300025921 Bacteria 2984
218 Ga0207652_10322640 3300025921 Bacteria 1394
219 Ga0207646_11007888 3300025922 Bacteria 736
220 Ga0207694_10046228 3300025924 Bacteria 3364
221 Ga0207694_10247994 3300025924 Bacteria 1456
222 Ga0207659_10192949 3300025926 Bacteria 1622
223 Ga0207687_10045295 3300025927 Bacteria 3040
224 Ga0207700_10061431 3300025928 Bacteria 2849
225 Ga0207700_10094494 3300025928 Bacteria 2369
226 Ga0207700_10178943 3300025928 Unclassified 1774
227 Ga0207700_10437484 3300025928 Bacteria 1151
228 Ga0207664_10007907 3300025929 Bacteria 7387
229 Ga0207644_11031966 3300025931 Bacteria 690
230 Ga0207706_10702320 3300025933 Bacteria 864
231 Ga0207709_10161865 3300025935 Bacteria 1561
232 Ga0207709_10186241 3300025935 Bacteria 1470
233 Ga0207670_10750185 3300025936 Bacteria 811
234 Ga0207669_11095793 3300025937 Bacteria 672
235 Ga0207665_10001072 3300025939 Bacteria 18388
236 Ga0207665_10008363 3300025939 Bacteria 6828
237 Ga0207665_10050948 3300025939 Bacteria 2785
238 Ga0207665_10147765 3300025939 Bacteria 1681
239 Ga0207665_10505271 3300025939 Bacteria 934
240 Ga0207711_10032980 3300025941 Bacteria 4380
241 Ga0207711_10107474 3300025941 Bacteria 2477
242 Ga0207711_10654195 3300025941 Bacteria 980
243 Ga0207661_10063222 3300025944 Bacteria 2997
244 Ga0207661_10276573 3300025944 Bacteria 1499
245 Ga0207679_10428260 3300025945 Bacteria 1169
246 Ga0207667_10076540 3300025949 Bacteria 3472
247 Ga0207667_10164042 3300025949 Bacteria 2285
248 Ga0207668_10208355 3300025972 Bacteria 1562
249 Ga0207668_10696915 3300025972 Bacteria 892
250 Ga0207640_10063207 3300025981 Bacteria 2459
251 Ga0207677_10066768 3300026023 Bacteria 2517
252 Ga0207703_10058015 3300026035 Bacteria 3158
253 Ga0207639_10064286 3300026041 Bacteria 2844
254 Ga0207639_10370514 3300026041 Bacteria 1284
255 Ga0207678_10080323 3300026067 Bacteria 2792
256 Ga0207678_10249867 3300026067 Bacteria 1519
257 Ga0207702_10455673 3300026078 Bacteria 1241
258 Ga0207702_10785053 3300026078 Bacteria 941
259 Ga0207641_10558223 3300026088 Bacteria 1117
260 Ga0207676_11423048 3300026095 Bacteria 689
261 Ga0207674_10212150 3300026116 Bacteria 1885
262 Ga0207674_10243056 3300026116 Bacteria 1747
263 Ga0207683_10092472 3300026121 Bacteria 2695
264 Ga0207698_10503920 3300026142 Bacteria 1179
265 Ga0207698_10795128 3300026142 Bacteria 948
266 Ga0209389_1000033 3300027296 Bacteria 131516
267 Ga0209589_1000040 3300027357 Bacteria 126550
268 Ga0209489_100045 3300027361 Bacteria 158225
269 Ga0209813_10014454 3300027866 Bacteria 2125
270 Ga0207428_10004434 3300027907 Bacteria 13351
271 Ga0268266_10276738 3300028379 Bacteria 1559
272 Ga0268265_10400026 3300028380 Bacteria 1269
273 Ga0307517_10055822 3300028786 Bacteria 3868
274 Ga0307511_10054131 3300030521 Bacteria 3169
275 Ga0265331_10170204 3300031250 Bacteria 986
276 Ga0307508_10000002 3300031616 Bacteria 407635
277 Ga0307516_10099649 3300031730 Bacteria 2721
278 Ga0373944_0048425 3300035089 Bacteria 1334
279 Ga0373954_0092916 3300035118 Bacteria 1450
280 Ga0373943_0010903 3300035170 Bacteria 4082
281 Ga0373924_0111553 3300035410 Bacteria 1182
282 Ga0373924_0130046 3300035410 Bacteria 1095
283 Ga0373931_0137518 3300035691 Bacteria 1412
284 Ga0373935_0000338 3300035692 Bacteria 23731
285 Ga0373927_0001017 3300035695 Bacteria 21335
286 Ga0373947_0001103 3300035725 Bacteria 16576
287 Ga0373947_0026056 3300035725 Bacteria 3413
288 Ga0373937_0113568 3300036401 Bacteria 2520
289 Ga0373925_0001334 3300037068 Bacteria 21583
290 Ga0395900_0002352 3300037418 Bacteria 20935
291 Ga0395898_0117140 3300037466 Bacteria 2552
292 Ga0395905_0007209 3300037471 Bacteria 11087
293 Ga0395905_0347533 3300037471 Bacteria 1375
294 Ga0436365_1451163 3300039437 Bacteria 2386
295 Ga0436360_0496486 3300039438 Bacteria 2303
296 Ga0436360_0688980 3300039438 Bacteria 2079
297 Ga0436361_0338149 3300039447 Bacteria 767
298 Ga0436361_0771035 3300039447 Bacteria 5070
299 Ga0436361_1050549 3300039447 Bacteria 4175
300 Ga0436363_0200004 3300039450 Bacteria 2663
301 Ga0436362_1161726 3300039453 Bacteria 2659
302 Ga0466969_0014048 3300044656 Bacteria 4214
303 Ga0466969_0063486 3300044656 Bacteria 1790
304 Ga0466972_0002429 3300044658 Bacteria 9196
305 Ga0466972_0297268 3300044658 Bacteria 754
306 Ga0466965_0114609 3300044683 Bacteria 1388
307 Ga0466966_0001443 3300044684 Bacteria 15269
308 Ga0466961_0000074 3300044693 Bacteria 61968
309 Ga0466964_0148826 3300044706 Bacteria 1083
310 Ga0466964_0375464 3300044706 Bacteria 737
311 Ga0466968_0001784 3300044735 Bacteria 7764
312 Ga0466968_0086308 3300044735 Bacteria 1385
313 Ga0466960_0019012 3300044901 Bacteria 3019
314 Ga0466959_0040553 3300045049 Bacteria 3439
315 Ga0466959_0125244 3300045049 Bacteria 1824
316 Ga0466959_0322420 3300045049 Bacteria 1056
317 Ga0466967_0788997 3300045976 Bacteria 943
318 Ga0495592_0008296 3300046454 Bacteria 7797
319 Ga0495592_0165688 3300046454 Bacteria 1517
320 Ga0495592_0529034 3300046454 Bacteria 728
321 Ga0495603_0000420 3300046455 Bacteria 23500
322 Ga0495603_0081268 3300046455 Bacteria 1899
323 Ga0495590_0042392 3300046457 Bacteria 1586
324 Ga0495629_0000412 3300046459 Bacteria 35827
325 Ga0495641_0002262 3300046461 Bacteria 15345
326 Ga0495651_0047144 3300046462 Bacteria 3334
327 Ga0495651_0131248 3300046462 Bacteria 1828
328 Ga0495653_0371439 3300046463 Bacteria 915
329 Ga0495580_0004412 3300046472 Bacteria 11815
330 Ga0495582_0000043 3300046473 Bacteria 63647
331 Ga0495639_0000393 3300046475 Bacteria 20643
332 Ga0495639_0519550 3300046475 Bacteria 609
333 Ga0495662_0000725 3300046476 Bacteria 15774
334 Ga0495664_0022549 3300046477 Bacteria 3651
335 Ga0495594_0005033 3300046499 Bacteria 6800
336 Ga0495606_0281929 3300046507 Bacteria 908
337 Ga0495606_0374470 3300046507 Bacteria 748
338 Ga0495608_0070334 3300046511 Bacteria 2284
339 Ga0495610_0296831 3300046512 Bacteria 624
340 Ga0495616_0087898 3300046513 Bacteria 1476
341 Ga0495618_0049754 3300046514 Bacteria 2647
342 Ga0495628_0079450 3300046516 Bacteria 2550
343 Ga0495628_0156729 3300046516 Bacteria 1732
344 Ga0495628_0246644 3300046516 Bacteria 1334
345 Ga0495630_0000409 3300046517 Bacteria 33418
346 Ga0495644_0066462 3300046523 Bacteria 1354
347 Ga0495648_0000286 3300046524 Bacteria 57430
348 Ga0495648_0086723 3300046524 Bacteria 1765
349 Ga0495666_0031113 3300046526 Bacteria 2616
350 Ga0495642_0227951 3300046528 Bacteria 814
351 Ga0495652_0027823 3300046529 Bacteria 4981
352 Ga0495654_0199870 3300046530 Bacteria 856
353 Ga0495665_0000051 3300046531 Bacteria 46836
354 Ga0495640_0001853 3300046533 Bacteria 16805
355 Ga0495587_0089281 3300046536 Bacteria 1781
356 Ga0495598_0003534 3300046537 Bacteria 3331
357 Ga0495621_0019450 3300046539 Bacteria 2218
358 Ga0495645_0281920 3300046543 Bacteria 1092
359 Ga0495622_0003740 3300046557 Bacteria 7120
360 Ga0495667_0168125 3300046559 Bacteria 1409
361 Ga0495656_0054160 3300046615 Bacteria 1725
362 Ga0495634_0000400 3300046642 Bacteria 42620
363 Ga0495611_0302513 3300046648 Bacteria 737
364 Ga0495635_0000726 3300046663 Bacteria 21302
365 Ga0495635_0270968 3300046663 Bacteria 1142
366 Ga0495659_0002538 3300046664 Bacteria 5893
367 Ga0495659_0037983 3300046664 Bacteria 1708
368 Ga0495661_0188470 3300046665 Bacteria 1088
369 Ga0495588_0053710 3300046674 Bacteria 2078
370 Ga0495623_0016947 3300046679 Bacteria 4706
371 Ga0495646_0013878 3300046680 Bacteria 5121
372 Ga0495647_0000550 3300046681 Bacteria 11032
373 Ga0495658_0002754 3300046683 Bacteria 8829
374 Ga0495669_0030348 3300046684 Bacteria 2373
375 Ga0495669_0051364 3300046684 Bacteria 1850
376 Ga0495624_0001111 3300046690 Bacteria 21278
377 Ga0495624_0280197 3300046690 Bacteria 1007
378 Ga0495624_0333010 3300046690 Bacteria 914
379 Ga0495670_0037313 3300046691 Bacteria 2422
380 Ga0495649_0274850 3300046694 Bacteria 861
381 Ga0495581_0000173 3300047315 Bacteria 29278
382 Ga0495581_0097358 3300047315 Bacteria 1709
383 Ga0495604_0203480 3300047317 Bacteria 1372
384 Ga0495674_0002072 3300047319 Bacteria 19667
385 Ga0495674_0467966 3300047319 Bacteria 1011
386 Ga0495672_0044804 3300047320 Bacteria 2651
387 Ga0495672_0046697 3300047320 Bacteria 2581
388 Ga0495676_0011494 3300047321 Bacteria 7986
389 Ga0495676_0862248 3300047321 Bacteria 581
390 Ga0495687_083764 3300047443 Bacteria 1241
391 Ga0495675_0026516 3300047444 Bacteria 3695
392 Ga0495675_0139370 3300047444 Bacteria 1504
393 Ga0495677_0081470 3300047445 Bacteria 1213
394 Ga0495685_071128 3300047447 Bacteria 1165
395 Ga0495673_0013578 3300047469 Bacteria 4272
396 Ga0495673_0178866 3300047469 Bacteria 804
397 Ga0495684_0017683 3300047471 Bacteria 5490
398 Ga0495593_0000222 3300047673 Bacteria 30282
399 Ga0495593_0114872 3300047673 Bacteria 1373
400 Ga0495602_0316444 3300048088 Bacteria 1137
401 Ga0495614_0005302 3300048089 Bacteria 5814
402 Ga0496102_0080275 3300048905 Bacteria 3005
403 Ga0496103_0761397 3300048906 Bacteria 612
404 Ga0496104_0635994 3300048907 Bacteria 976
405 Ga0496106_0407014 3300048909 Bacteria 1093
406 Ga0496107_0172087 3300048910 Bacteria 1607
407 Ga0496108_0084338 3300048911 Bacteria 2696
408 Ga0496110_0406971 3300048913 Bacteria 1240
409 Ga0496113_0372786 3300048916 Bacteria 1146
410 Ga0496117_0303181 3300048920 Bacteria 845
411 Ga0496121_0000893 3300048924 Bacteria 53847
412 Ga0496121_0175321 3300048924 Bacteria 1553
413 Ga0496121_0204708 3300048924 Bacteria 1403
414 Ga0496121_0263227 3300048924 Bacteria 1189
415 Ga0496121_0611750 3300048924 Bacteria 670
416 Ga0496124_0384137 3300048927 Bacteria 981
417 Ga0496125_0089146 3300048928 Bacteria 2321
418 Ga0496125_0247667 3300048928 Bacteria 1126
419 Ga0496126_0023120 3300048929 Bacteria 6026
420 Ga0496126_0108568 3300048929 Bacteria 2419
421 Ga0496126_0279499 3300048929 Bacteria 1383
422 Ga0496126_0654649 3300048929 Bacteria 821
423 Ga0501071_0693341 3300049587 Bacteria 784
424 nmdc:mga03683_10854_c1 3300050489 Bacteria 3277
425 nmdc:mga03683_222091_c1 3300050489 Bacteria 872
426 nmdc:mga03n38_208874_c1 3300050490 Bacteria 1014
427 nmdc:mga00v17_345213_c1 3300050491 Bacteria 968
428 nmdc:mga00v17_410847_c1 3300050491 Bacteria 879
429 nmdc:mga0yw44_256243_c1 3300050492 Bacteria 1165
430 nmdc:mga0yw44_361840_c1 3300050492 Bacteria 978
431 nmdc:mga0k408_169459_c1 3300050493 Bacteria 1302
432 nmdc:mga0k408_320229_c1 3300050493 Bacteria 925
433 nmdc:mga0k408_53291_c1 3300050493 Bacteria 2344
434 nmdc:mga06z11_116342_c2 3300050494 Bacteria 1046
435 nmdc:mga06z11_176663_c1 3300050494 Bacteria 1229
436 nmdc:mga06z11_432189_c1 3300050494 Unclassified 794
437 nmdc:mga04h51_180165_c1 3300050495 Bacteria 822
438 nmdc:mga07m45_189854_c1 3300050496 Bacteria 1195
439 nmdc:mga07m45_264579_c1 3300050496 Unclassified 1000
440 nmdc:mga07m45_517567_c1 3300050496 Bacteria 691
441 nmdc:mga07m45_595433_c1 3300050496 Bacteria 639
442 nmdc:mga05p37_1072_c1 3300050507 Bacteria 31317
443 nmdc:mga09592_26598_c1 3300050508 Bacteria 4795
444 nmdc:mga0qj67_82209_c2 3300050509 Bacteria 2181
445 nmdc:mga06r32_458_c1 3300050510 Bacteria 34859
446 nmdc:mga08y16_4007_c1 3300050511 Bacteria 15354
447 nmdc:mga0n895_15793_c1 3300050512 Bacteria 6903
448 nmdc:mga0n895_675192_c1 3300050512 Bacteria 1030
449 nmdc:mga0rr50_340498_c1 3300050513 Bacteria 1260
450 nmdc:mga08x19_662988_c1 3300050514 Bacteria 740
451 nmdc:mga0sz30_111254_c1 3300050516 Bacteria 1200
452 nmdc:mga0sz30_217304_c1 3300050516 Bacteria 850
453 nmdc:mga0sz30_249360_c1 3300050516 Bacteria 790
454 Ga0495612_0386236 3300053078 Bacteria 635
455 Ga0500635_0017023 3300053080 Bacteria 2171
456 Ga0495619_0201296 3300053085 Bacteria 1378
457 Ga0500651_0041814 3300053093 Bacteria 2889
458 Ga0500651_0229603 3300053093 Bacteria 1086
459 Ga0500640_130737 3300053095 Bacteria 990
460 Ga0500650_0123157 3300053098 Bacteria 1208
461 Ga0500650_0275726 3300053098 Bacteria 749
462 Ga0500650_0312730 3300053098 Bacteria 693
463 Ga0500556_0005445 3300053104 Bacteria 3594
464 Ga0500562_121636 3300053108 Bacteria 711
465 Ga0500595_016941 3300053119 Bacteria 2704
466 Ga0500607_031113 3300053121 Bacteria 2937
467 Ga0500608_126355 3300053122 Bacteria 1152
468 Ga0500642_0135144 3300053130 Bacteria 1156
469 Ga0500658_0340420 3300053134 Bacteria 689
470 Ga0500564_204967 3300053138 Bacteria 807
471 Ga0500568_0004386 3300053139 Bacteria 7553
472 Ga0500588_0003604 3300053146 Bacteria 3281
473 Ga0500590_094762 3300053148 Bacteria 1443
474 Ga0500616_0004795 3300053153 Bacteria 9471
475 Ga0500619_027685 3300053154 Bacteria 1699
476 Ga0500620_047264 3300053155 Bacteria 1432
477 Ga0500620_133252 3300053155 Bacteria 869
478 Ga0500636_0000197 3300053177 Bacteria 32448
479 Ga0500637_0111428 3300053178 Bacteria 1587
480 Ga0500611_091280 3300053727 Bacteria 776
481 Ga0500552_000469 3300053733 Bacteria 3730
482 Ga0500601_000867 3300053737 Bacteria 3669
483 Ga0530510_0774281 3300061734 Bacteria 732

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005437 Ga0070710_10261406 Ga0070710_102614062 162
2 3300050496 nmdc:mga07m45_264579_c1 nmdc:mga07m45_264579_c1_472_984 168
3 3300053130 Ga0500642_0135144 Ga0500642_0135144_20_532 168
4 3300005434 Ga0070709_10132209 Ga0070709_101322092 172
5 3300005435 Ga0070714_100472167 Ga0070714_1004721672 172
6 3300005436 Ga0070713_100577429 Ga0070713_1005774292 172
7 3300005439 Ga0070711_100049485 Ga0070711_1000494854 172
8 3300006175 Ga0070712_100324680 Ga0070712_1003246802 172
9 3300025898 Ga0207692_10082883 Ga0207692_100828832 172
10 3300025906 Ga0207699_10122760 Ga0207699_101227602 172
11 3300025915 Ga0207693_10271760 Ga0207693_102717602 172
12 3300025928 Ga0207700_10178943 Ga0207700_101789432 172
13 iso_pu_bacteria 2513237094 2513644653 172
14 iso_pu_bacteria 2617270741 2617373783 172
15 iso_pu_bacteria 2824671348 2824674415 172
16 iso_pu_bacteria 2824679649 2824685845 172
17 iso_pu_bacteria 2824687955 2824691087 172
18 iso_pu_bacteria 2824732956 2824738846 172
19 iso_pu_bacteria 2824746037 2824748675 172
20 iso_pu_bacteria 2874628541 2874628767 172
21 iso_pu_bacteria 2881665667 2881668158 172
22 iso_pu_bacteria 2908775508 2908776300 172
23 iso_pu_bacteria 2922393267 2922394263 172
24 iso_pu_bacteria 2941531003 2941535485 172
25 iso_pu_bacteria 8019648815 8019652439 172
26 iso_pu_bacteria 2791355196 2793062070 174
27 iso_pu_bacteria 2874604998 2874608039 174
28 iso_pu_bacteria 2922361189 2922363974 174
29 iso_pu_bacteria 8006926726 8006928936 174
30 iso_pu_bacteria 8006964411 8006967482 174
31 iso_pu_bacteria 2513237141 2513888792 175
32 3300003354 JGI25160J50197_1014932 JGI25160J50197_10149322 176
33 3300004625 Ga0055543_1032902 Ga0055543_10329022 176
34 3300005455 Ga0070663_100442631 Ga0070663_1004426311 176
35 3300006846 Ga0075430_100069585 Ga0075430_1000695851 176
36 3300006847 Ga0075431_100006409 Ga0075431_10000640914 176
37 3300006880 Ga0075429_100007594 Ga0075429_1000075942 176
38 3300006942 Ga0099824_1017750 Ga0099824_10177504 176
39 3300006943 Ga0099822_1040583 Ga0099822_10405832 176
40 3300009094 Ga0111539_10008018 Ga0111539_1000801810 176
41 3300009147 Ga0114129_10000066 Ga0114129_1000006685 176
42 3300021320 Ga0214544_1000016 Ga0214544_1000016146 176
43 3300021321 Ga0214542_1000016 Ga0214542_100001656 176
44 3300021324 Ga0214545_1000008 Ga0214545_100000862 176
45 3300021327 Ga0214543_1000043 Ga0214543_100004312 176
46 3300025302 Ga0207426_1022383 Ga0207426_10223831 176
47 3300027296 Ga0209389_1000033 Ga0209389_100003357 176
48 3300027357 Ga0209589_1000040 Ga0209589_100004057 176
49 3300027361 Ga0209489_100045 Ga0209489_10004569 176
50 3300027907 Ga0207428_10004434 Ga0207428_100044346 176
51 3300031250 Ga0265331_10170204 Ga0265331_101702042 176
52 3300037471 Ga0395905_0007209 Ga0395905_0007209_4577_5131 176
53 3300044656 Ga0466969_0014048 Ga0466969_0014048_1596_2126 176
54 3300044658 Ga0466972_0002429 Ga0466972_0002429_95_625 176
55 3300044658 Ga0466972_0297268 Ga0466972_0297268_51_584 176
56 3300044683 Ga0466965_0114609 Ga0466965_0114609_613_1143 176
57 3300044684 Ga0466966_0001443 Ga0466966_0001443_1038_1568 176
58 3300044693 Ga0466961_0000074 Ga0466961_0000074_60892_61422 176
59 3300044706 Ga0466964_0148826 Ga0466964_0148826_73_606 176
60 3300044735 Ga0466968_0001784 Ga0466968_0001784_6073_6603 176
61 3300044901 Ga0466960_0019012 Ga0466960_0019012_1076_1606 176
62 3300045049 Ga0466959_0040553 Ga0466959_0040553_1948_2478 176
63 3300046454 Ga0495592_0165688 Ga0495592_0165688_730_1287 176
64 3300046512 Ga0495610_0296831 Ga0495610_0296831_16_573 176
65 3300046524 Ga0495648_0000286 Ga0495648_0000286_53578_54108 176
66 3300046524 Ga0495648_0086723 Ga0495648_0086723_348_905 176
67 3300046528 Ga0495642_0227951 Ga0495642_0227951_128_685 176
68 3300046665 Ga0495661_0188470 Ga0495661_0188470_261_791 176
69 3300047320 Ga0495672_0044804 Ga0495672_0044804_1954_2511 176
70 3300047321 Ga0495676_0862248 Ga0495676_0862248_40_570 176
71 3300047443 Ga0495687_083764 Ga0495687_083764_103_633 176
72 3300047469 Ga0495673_0013578 Ga0495673_0013578_3333_3890 176
73 3300050507 nmdc:mga05p37_1072_c1 nmdc:mga05p37_1072_c1_19316_19927 176
74 3300050508 nmdc:mga09592_26598_c1 nmdc:mga09592_26598_c1_861_1472 176
75 3300050509 nmdc:mga0qj67_82209_c2 nmdc:mga0qj67_82209_c2_111_722 176
76 3300050510 nmdc:mga06r32_458_c1 nmdc:mga06r32_458_c1_32225_32836 176
77 3300050511 nmdc:mga08y16_4007_c1 nmdc:mga08y16_4007_c1_8191_8802 176
78 3300053080 Ga0500635_0017023 Ga0500635_0017023_935_1465 176
79 3300053095 Ga0500640_130737 Ga0500640_130737_211_741 176
80 3300053098 Ga0500650_0123157 Ga0500650_0123157_420_950 176
81 3300053121 Ga0500607_031113 Ga0500607_031113_1662_2192 176
82 3300053122 Ga0500608_126355 Ga0500608_126355_267_797 176
83 3300053134 Ga0500658_0340420 Ga0500658_0340420_143_673 176
84 3300053138 Ga0500564_204967 Ga0500564_204967_32_562 176
85 3300053146 Ga0500588_0003604 Ga0500588_0003604_2427_2957 176
86 3300053148 Ga0500590_094762 Ga0500590_094762_85_615 176
87 3300053154 Ga0500619_027685 Ga0500619_027685_690_1220 176
88 3300053155 Ga0500620_047264 Ga0500620_047264_571_1101 176
89 3300053177 Ga0500636_0000197 Ga0500636_0000197_18446_18976 176
90 3300053178 Ga0500637_0111428 Ga0500637_0111428_311_841 176
91 3300053727 Ga0500611_091280 Ga0500611_091280_210_764 176
92 3300053737 Ga0500601_000867 Ga0500601_000867_2822_3379 176
93 iso_pu_bacteria 2507262055 2507505273 176
94 iso_pu_bacteria 2935819856 2935825506 176
95 iso_pu_bacteria 8016566248 8016569491 176
96 3300003322 rootL2_10116603 rootL2_101166034 177
97 3300003323 rootH1_10215295 rootH1_102152954 177
98 3300003659 JGI25404J52841_10008363 JGI25404J52841_100083632 177
99 3300005455 Ga0070663_100463427 Ga0070663_1004634271 177
100 3300005937 Ga0081455_10016558 Ga0081455_100165585 177
101 3300005937 Ga0081455_10039096 Ga0081455_100390964 177
102 3300005983 Ga0081540_1002536 Ga0081540_10025363 177
103 3300005983 Ga0081540_1006135 Ga0081540_10061358 177
104 3300005983 Ga0081540_1007733 Ga0081540_10077335 177
105 3300005983 Ga0081540_1029010 Ga0081540_10290104 177
106 3300005983 Ga0081540_1030690 Ga0081540_10306905 177
107 3300005983 Ga0081540_1081047 Ga0081540_10810473 177
108 3300007076 Ga0075435_100969296 Ga0075435_1009692961 177
109 3300009553 Ga0105249_10865711 Ga0105249_108657112 177
110 3300026078 Ga0207702_10455673 Ga0207702_104556731 177
111 3300035691 Ga0373931_0137518 Ga0373931_0137518_738_1271 177
112 3300045976 Ga0466967_0788997 Ga0466967_0788997_86_649 177
113 3300050512 nmdc:mga0n895_675192_c1 nmdc:mga0n895_675192_c1_271_804 177
114 3300005329 Ga0070683_100819375 Ga0070683_1008193751 178
115 3300005334 Ga0068869_100106951 Ga0068869_1001069513 178
116 3300005335 Ga0070666_10459608 Ga0070666_104596081 178
117 3300005336 Ga0070680_100038719 Ga0070680_1000387195 178
118 3300005336 Ga0070680_100064607 Ga0070680_1000646073 178
119 3300005337 Ga0070682_100027943 Ga0070682_1000279434 178
120 3300005337 Ga0070682_100067452 Ga0070682_1000674522 178
121 3300005339 Ga0070660_100025078 Ga0070660_1000250785 178
122 3300005339 Ga0070660_100546954 Ga0070660_1005469542 178
123 3300005347 Ga0070668_100151717 Ga0070668_1001517172 178
124 3300005347 Ga0070668_100676528 Ga0070668_1006765281 178
125 3300005353 Ga0070669_100621420 Ga0070669_1006214202 178
126 3300005354 Ga0070675_100837557 Ga0070675_1008375571 178
127 3300005355 Ga0070671_100136679 Ga0070671_1001366792 178
128 3300005366 Ga0070659_100418548 Ga0070659_1004185481 178
129 3300005434 Ga0070709_10147600 Ga0070709_101476003 178
130 3300005434 Ga0070709_10174607 Ga0070709_101746072 178
131 3300005436 Ga0070713_100136475 Ga0070713_1001364752 178
132 3300005436 Ga0070713_100344714 Ga0070713_1003447142 178
133 3300005439 Ga0070711_100046199 Ga0070711_1000461994 178
134 3300005456 Ga0070678_100012480 Ga0070678_1000124806 178
135 3300005457 Ga0070662_100072072 Ga0070662_1000720721 178
136 3300005458 Ga0070681_10013576 Ga0070681_100135763 178
137 3300005458 Ga0070681_10069568 Ga0070681_100695683 178
138 3300005467 Ga0070706_100246318 Ga0070706_1002463183 178
139 3300005467 Ga0070706_100305629 Ga0070706_1003056293 178
140 3300005468 Ga0070707_100153903 Ga0070707_1001539033 178
141 3300005468 Ga0070707_100503350 Ga0070707_1005033501 178
142 3300005468 Ga0070707_101391196 Ga0070707_1013911961 178
143 3300005471 Ga0070698_100493600 Ga0070698_1004936002 178
144 3300005471 Ga0070698_100593601 Ga0070698_1005936012 178
145 3300005518 Ga0070699_100754667 Ga0070699_1007546671 178
146 3300005530 Ga0070679_100135841 Ga0070679_1001358412 178
147 3300005530 Ga0070679_100192758 Ga0070679_1001927583 178
148 3300005536 Ga0070697_100160053 Ga0070697_1001600532 178
149 3300005544 Ga0070686_100319201 Ga0070686_1003192012 178
150 3300005548 Ga0070665_100102858 Ga0070665_1001028584 178
151 3300005548 Ga0070665_100594619 Ga0070665_1005946191 178
152 3300005563 Ga0068855_100133256 Ga0068855_1001332562 178
153 3300005563 Ga0068855_100206221 Ga0068855_1002062216 178
154 3300005563 Ga0068855_100330575 Ga0068855_1003305752 178
155 3300005564 Ga0070664_100365949 Ga0070664_1003659492 178
156 3300005564 Ga0070664_101030205 Ga0070664_1010302052 178
157 3300005577 Ga0068857_100272864 Ga0068857_1002728642 178
158 3300005616 Ga0068852_100916285 Ga0068852_1009162852 178
159 3300005617 Ga0068859_101031854 Ga0068859_1010318541 178
160 3300005618 Ga0068864_101195696 Ga0068864_1011956962 178
161 3300005834 Ga0068851_10029667 Ga0068851_100296673 178
162 3300005841 Ga0068863_100129956 Ga0068863_1001299564 178
163 3300005842 Ga0068858_100259835 Ga0068858_1002598354 178
164 3300005843 Ga0068860_100831377 Ga0068860_1008313771 178
165 3300005844 Ga0068862_100084875 Ga0068862_1000848753 178
166 3300005844 Ga0068862_100210554 Ga0068862_1002105542 178
167 3300005983 Ga0081540_1004921 Ga0081540_10049213 178
168 3300006028 Ga0070717_10094512 Ga0070717_100945123 178
169 3300006038 Ga0075365_10305637 Ga0075365_103056373 178
170 3300006038 Ga0075365_10354737 Ga0075365_103547372 178
171 3300006038 Ga0075365_10458178 Ga0075365_104581782 178
172 3300006048 Ga0075363_100053139 Ga0075363_1000531394 178
173 3300006163 Ga0070715_10171846 Ga0070715_101718462 178
174 3300006173 Ga0070716_100155261 Ga0070716_1001552613 178
175 3300006175 Ga0070712_100433218 Ga0070712_1004332182 178
176 3300006177 Ga0075362_10053861 Ga0075362_100538613 178
177 3300006177 Ga0075362_10164161 Ga0075362_101641612 178
178 3300006178 Ga0075367_10129915 Ga0075367_101299152 178
179 3300006186 Ga0075369_10043584 Ga0075369_100435843 178
180 3300006186 Ga0075369_10047092 Ga0075369_100470922 178
181 3300006186 Ga0075369_10103336 Ga0075369_101033362 178
182 3300006186 Ga0075369_10278318 Ga0075369_102783181 178
183 3300006237 Ga0097621_101542228 Ga0097621_1015422281 178
184 3300006358 Ga0068871_100122484 Ga0068871_1001224844 178
185 3300006358 Ga0068871_100132309 Ga0068871_1001323091 178
186 3300006871 Ga0075434_100616637 Ga0075434_1006166372 178
187 3300006931 Ga0097620_101031886 Ga0097620_1010318861 178
188 3300009093 Ga0105240_10006681 Ga0105240_1000668112 178
189 3300009093 Ga0105240_10295206 Ga0105240_102952062 178
190 3300009093 Ga0105240_10328961 Ga0105240_103289612 178
191 3300009094 Ga0111539_11122509 Ga0111539_111225091 178
192 3300009094 Ga0111539_11593094 Ga0111539_115930941 178
193 3300009098 Ga0105245_10020480 Ga0105245_100204806 178
194 3300009098 Ga0105245_11291332 Ga0105245_112913321 178
195 3300009101 Ga0105247_10265480 Ga0105247_102654803 178
196 3300009101 Ga0105247_10561964 Ga0105247_105619641 178
197 3300009148 Ga0105243_10539446 Ga0105243_105394462 178
198 3300009148 Ga0105243_10871987 Ga0105243_108719872 178
199 3300009174 Ga0105241_10031944 Ga0105241_100319444 178
200 3300009174 Ga0105241_10065200 Ga0105241_100652005 178
201 3300009176 Ga0105242_11922289 Ga0105242_119222891 178
202 3300009177 Ga0105248_10029743 Ga0105248_100297435 178
203 3300009177 Ga0105248_10212719 Ga0105248_102127193 178
204 3300009545 Ga0105237_10009981 Ga0105237_100099819 178
205 3300009545 Ga0105237_10071238 Ga0105237_100712383 178
206 3300009545 Ga0105237_10676891 Ga0105237_106768911 178
207 3300009551 Ga0105238_10052285 Ga0105238_100522853 178
208 3300009551 Ga0105238_10321517 Ga0105238_103215173 178
209 3300009551 Ga0105238_10633499 Ga0105238_106334992 178
210 3300009553 Ga0105249_10382173 Ga0105249_103821731 178
211 3300010159 Ga0099796_10011420 Ga0099796_100114202 178
212 3300010375 Ga0105239_10021820 Ga0105239_100218206 178
213 3300010375 Ga0105239_10464237 Ga0105239_104642372 178
214 3300010375 Ga0105239_10729002 Ga0105239_107290021 178
215 3300011119 Ga0105246_10108941 Ga0105246_101089412 178
216 3300013102 Ga0157371_10157398 Ga0157371_101573983 178
217 3300013104 Ga0157370_10066724 Ga0157370_100667244 178
218 3300013105 Ga0157369_10022233 Ga0157369_100222332 178
219 3300013296 Ga0157374_11411810 Ga0157374_114118101 178
220 3300013297 Ga0157378_10087963 Ga0157378_100879635 178
221 3300013297 Ga0157378_10694451 Ga0157378_106944512 178
222 3300013306 Ga0163162_10436371 Ga0163162_104363712 178
223 3300013307 Ga0157372_11468592 Ga0157372_114685921 178
224 3300013308 Ga0157375_10626091 Ga0157375_106260912 178
225 3300014325 Ga0163163_11210697 Ga0163163_112106972 178
226 3300014326 Ga0157380_10820688 Ga0157380_108206881 178
227 3300014745 Ga0157377_10344122 Ga0157377_103441222 178
228 3300014968 Ga0157379_10233269 Ga0157379_102332693 178
229 3300014969 Ga0157376_10145980 Ga0157376_101459802 178
230 3300014969 Ga0157376_10759630 Ga0157376_107596302 178
231 3300014969 Ga0157376_12082861 Ga0157376_120828611 178
232 3300025321 Ga0207656_10117668 Ga0207656_101176682 178
233 3300025898 Ga0207692_10006485 Ga0207692_100064853 178
234 3300025900 Ga0207710_10045662 Ga0207710_100456622 178
235 3300025900 Ga0207710_10405717 Ga0207710_104057172 178
236 3300025901 Ga0207688_10250072 Ga0207688_102500723 178
237 3300025906 Ga0207699_10090593 Ga0207699_100905933 178
238 3300025910 Ga0207684_10380836 Ga0207684_103808362 178
239 3300025911 Ga0207654_10025899 Ga0207654_100258994 178
240 3300025911 Ga0207654_10131736 Ga0207654_101317363 178
241 3300025912 Ga0207707_10000818 Ga0207707_100008189 178
242 3300025912 Ga0207707_10026440 Ga0207707_100264407 178
243 3300025913 Ga0207695_10191621 Ga0207695_101916212 178
244 3300025914 Ga0207671_10388734 Ga0207671_103887342 178
245 3300025914 Ga0207671_10845649 Ga0207671_108456492 178
246 3300025915 Ga0207693_10086594 Ga0207693_100865942 178
247 3300025915 Ga0207693_10099970 Ga0207693_100999704 178
248 3300025917 Ga0207660_10014327 Ga0207660_100143275 178
249 3300025917 Ga0207660_10056654 Ga0207660_100566544 178
250 3300025917 Ga0207660_10121123 Ga0207660_101211234 178
251 3300025919 Ga0207657_10002310 Ga0207657_1000231017 178
252 3300025920 Ga0207649_10179863 Ga0207649_101798632 178
253 3300025921 Ga0207652_10002033 Ga0207652_1000203312 178
254 3300025921 Ga0207652_10073002 Ga0207652_100730022 178
255 3300025921 Ga0207652_10322640 Ga0207652_103226403 178
256 3300025922 Ga0207646_11007888 Ga0207646_110078881 178
257 3300025924 Ga0207694_10046228 Ga0207694_100462285 178
258 3300025924 Ga0207694_10247994 Ga0207694_102479941 178
259 3300025926 Ga0207659_10192949 Ga0207659_101929493 178
260 3300025927 Ga0207687_10045295 Ga0207687_100452954 178
261 3300025928 Ga0207700_10061431 Ga0207700_100614314 178
262 3300025928 Ga0207700_10094494 Ga0207700_100944943 178
263 3300025928 Ga0207700_10437484 Ga0207700_104374842 178
264 3300025931 Ga0207644_11031966 Ga0207644_110319661 178
265 3300025933 Ga0207706_10702320 Ga0207706_107023201 178
266 3300025935 Ga0207709_10161865 Ga0207709_101618651 178
267 3300025935 Ga0207709_10186241 Ga0207709_101862413 178
268 3300025936 Ga0207670_10750185 Ga0207670_107501852 178
269 3300025937 Ga0207669_11095793 Ga0207669_110957931 178
270 3300025939 Ga0207665_10147765 Ga0207665_101477652 178
271 3300025941 Ga0207711_10032980 Ga0207711_100329805 178
272 3300025941 Ga0207711_10107474 Ga0207711_101074743 178
273 3300025941 Ga0207711_10654195 Ga0207711_106541952 178
274 3300025944 Ga0207661_10063222 Ga0207661_100632222 178
275 3300025944 Ga0207661_10276573 Ga0207661_102765733 178
276 3300025945 Ga0207679_10428260 Ga0207679_104282602 178
277 3300025949 Ga0207667_10076540 Ga0207667_100765403 178
278 3300025949 Ga0207667_10164042 Ga0207667_101640423 178
279 3300025972 Ga0207668_10208355 Ga0207668_102083553 178
280 3300025972 Ga0207668_10696915 Ga0207668_106969152 178
281 3300025981 Ga0207640_10063207 Ga0207640_100632073 178
282 3300026023 Ga0207677_10066768 Ga0207677_100667683 178
283 3300026035 Ga0207703_10058015 Ga0207703_100580154 178
284 3300026041 Ga0207639_10064286 Ga0207639_100642864 178
285 3300026041 Ga0207639_10370514 Ga0207639_103705142 178
286 3300026067 Ga0207678_10080323 Ga0207678_100803233 178
287 3300026067 Ga0207678_10249867 Ga0207678_102498673 178
288 3300026078 Ga0207702_10785053 Ga0207702_107850531 178
289 3300026088 Ga0207641_10558223 Ga0207641_105582232 178
290 3300026095 Ga0207676_11423048 Ga0207676_114230481 178
291 3300026116 Ga0207674_10212150 Ga0207674_102121501 178
292 3300026116 Ga0207674_10243056 Ga0207674_102430563 178
293 3300026121 Ga0207683_10092472 Ga0207683_100924723 178
294 3300026142 Ga0207698_10503920 Ga0207698_105039203 178
295 3300026142 Ga0207698_10795128 Ga0207698_107951282 178
296 3300027866 Ga0209813_10014454 Ga0209813_100144543 178
297 3300028379 Ga0268266_10276738 Ga0268266_102767383 178
298 3300028380 Ga0268265_10400026 Ga0268265_104000263 178
299 3300028786 Ga0307517_10055822 Ga0307517_100558223 178
300 3300035089 Ga0373944_0048425 Ga0373944_0048425_460_996 178
301 3300035118 Ga0373954_0092916 Ga0373954_0092916_430_966 178
302 3300035170 Ga0373943_0010903 Ga0373943_0010903_1519_2055 178
303 3300035410 Ga0373924_0111553 Ga0373924_0111553_585_1121 178
304 3300035692 Ga0373935_0000338 Ga0373935_0000338_10141_10677 178
305 3300035695 Ga0373927_0001017 Ga0373927_0001017_7865_8401 178
306 3300035725 Ga0373947_0001103 Ga0373947_0001103_8114_8650 178
307 3300035725 Ga0373947_0026056 Ga0373947_0026056_42_578 178
308 3300037068 Ga0373925_0001334 Ga0373925_0001334_10609_11145 178
309 3300037418 Ga0395900_0002352 Ga0395900_0002352_18568_19104 178
310 3300037466 Ga0395898_0117140 Ga0395898_0117140_312_848 178
311 3300037471 Ga0395905_0347533 Ga0395905_0347533_704_1240 178
312 3300039437 Ga0436365_1451163 Ga0436365_1451163_1234_1782 178
313 3300039447 Ga0436361_0338149 Ga0436361_0338149_34_570 178
314 3300044706 Ga0466964_0375464 Ga0466964_0375464_31_567 178
315 3300045049 Ga0466959_0322420 Ga0466959_0322420_299_835 178
316 3300046454 Ga0495592_0008296 Ga0495592_0008296_7218_7754 178
317 3300046454 Ga0495592_0529034 Ga0495592_0529034_156_716 178
318 3300046455 Ga0495603_0000420 Ga0495603_0000420_12165_12701 178
319 3300046455 Ga0495603_0081268 Ga0495603_0081268_597_1133 178
320 3300046457 Ga0495590_0042392 Ga0495590_0042392_1006_1542 178
321 3300046459 Ga0495629_0000412 Ga0495629_0000412_24463_24999 178
322 3300046461 Ga0495641_0002262 Ga0495641_0002262_10385_10921 178
323 3300046462 Ga0495651_0047144 Ga0495651_0047144_1237_1773 178
324 3300046472 Ga0495580_0004412 Ga0495580_0004412_5533_6069 178
325 3300046473 Ga0495582_0000043 Ga0495582_0000043_10754_11290 178
326 3300046475 Ga0495639_0000393 Ga0495639_0000393_13337_13873 178
327 3300046475 Ga0495639_0519550 Ga0495639_0519550_52_588 178
328 3300046476 Ga0495662_0000725 Ga0495662_0000725_10841_11377 178
329 3300046477 Ga0495664_0022549 Ga0495664_0022549_2143_2679 178
330 3300046499 Ga0495594_0005033 Ga0495594_0005033_4028_4564 178
331 3300046507 Ga0495606_0281929 Ga0495606_0281929_325_861 178
332 3300046507 Ga0495606_0374470 Ga0495606_0374470_130_666 178
333 3300046513 Ga0495616_0087898 Ga0495616_0087898_312_848 178
334 3300046514 Ga0495618_0049754 Ga0495618_0049754_1172_1708 178
335 3300046516 Ga0495628_0079450 Ga0495628_0079450_338_874 178
336 3300046516 Ga0495628_0156729 Ga0495628_0156729_441_992 178
337 3300046517 Ga0495630_0000409 Ga0495630_0000409_27261_27797 178
338 3300046523 Ga0495644_0066462 Ga0495644_0066462_574_1110 178
339 3300046526 Ga0495666_0031113 Ga0495666_0031113_294_830 178
340 3300046529 Ga0495652_0027823 Ga0495652_0027823_3651_4187 178
341 3300046530 Ga0495654_0199870 Ga0495654_0199870_58_594 178
342 3300046531 Ga0495665_0000051 Ga0495665_0000051_10812_11348 178
343 3300046533 Ga0495640_0001853 Ga0495640_0001853_8069_8605 178
344 3300046537 Ga0495598_0003534 Ga0495598_0003534_1195_1731 178
345 3300046539 Ga0495621_0019450 Ga0495621_0019450_1334_1870 178
346 3300046557 Ga0495622_0003740 Ga0495622_0003740_6104_6640 178
347 3300046559 Ga0495667_0168125 Ga0495667_0168125_812_1348 178
348 3300046615 Ga0495656_0054160 Ga0495656_0054160_58_594 178
349 3300046642 Ga0495634_0000400 Ga0495634_0000400_6001_6537 178
350 3300046648 Ga0495611_0302513 Ga0495611_0302513_141_677 178
351 3300046663 Ga0495635_0000726 Ga0495635_0000726_7074_7610 178
352 3300046664 Ga0495659_0002538 Ga0495659_0002538_4541_5077 178
353 3300046664 Ga0495659_0037983 Ga0495659_0037983_850_1386 178
354 3300046674 Ga0495588_0053710 Ga0495588_0053710_533_1069 178
355 3300046680 Ga0495646_0013878 Ga0495646_0013878_4551_5087 178
356 3300046681 Ga0495647_0000550 Ga0495647_0000550_10140_10676 178
357 3300046683 Ga0495658_0002754 Ga0495658_0002754_5812_6348 178
358 3300046684 Ga0495669_0030348 Ga0495669_0030348_946_1482 178
359 3300046684 Ga0495669_0051364 Ga0495669_0051364_208_744 178
360 3300046690 Ga0495624_0001111 Ga0495624_0001111_10875_11411 178
361 3300046690 Ga0495624_0333010 Ga0495624_0333010_157_693 178
362 3300046691 Ga0495670_0037313 Ga0495670_0037313_1218_1754 178
363 3300046694 Ga0495649_0274850 Ga0495649_0274850_176_712 178
364 3300047315 Ga0495581_0000173 Ga0495581_0000173_10830_11366 178
365 3300047315 Ga0495581_0097358 Ga0495581_0097358_441_977 178
366 3300047317 Ga0495604_0203480 Ga0495604_0203480_24_560 178
367 3300047319 Ga0495674_0002072 Ga0495674_0002072_10815_11351 178
368 3300047320 Ga0495672_0046697 Ga0495672_0046697_632_1171 178
369 3300047321 Ga0495676_0011494 Ga0495676_0011494_2801_3337 178
370 3300047444 Ga0495675_0139370 Ga0495675_0139370_831_1394 178
371 3300047445 Ga0495677_0081470 Ga0495677_0081470_585_1121 178
372 3300047447 Ga0495685_071128 Ga0495685_071128_459_995 178
373 3300047469 Ga0495673_0178866 Ga0495673_0178866_68_604 178
374 3300047471 Ga0495684_0017683 Ga0495684_0017683_2306_2842 178
375 3300047673 Ga0495593_0000222 Ga0495593_0000222_4594_5130 178
376 3300048088 Ga0495602_0316444 Ga0495602_0316444_148_684 178
377 3300048089 Ga0495614_0005302 Ga0495614_0005302_2882_3418 178
378 3300048905 Ga0496102_0080275 Ga0496102_0080275_550_1086 178
379 3300048906 Ga0496103_0761397 Ga0496103_0761397_47_583 178
380 3300048907 Ga0496104_0635994 Ga0496104_0635994_157_693 178
381 3300048909 Ga0496106_0407014 Ga0496106_0407014_253_789 178
382 3300048910 Ga0496107_0172087 Ga0496107_0172087_149_685 178
383 3300048911 Ga0496108_0084338 Ga0496108_0084338_184_720 178
384 3300048913 Ga0496110_0406971 Ga0496110_0406971_692_1228 178
385 3300048916 Ga0496113_0372786 Ga0496113_0372786_175_711 178
386 3300048920 Ga0496117_0303181 Ga0496117_0303181_146_682 178
387 3300048924 Ga0496121_0000893 Ga0496121_0000893_22085_22624 178
388 3300048924 Ga0496121_0175321 Ga0496121_0175321_777_1313 178
389 3300048924 Ga0496121_0204708 Ga0496121_0204708_638_1174 178
390 3300048924 Ga0496121_0263227 Ga0496121_0263227_447_983 178
391 3300048924 Ga0496121_0611750 Ga0496121_0611750_12_551 178
392 3300048927 Ga0496124_0384137 Ga0496124_0384137_156_692 178
393 3300048928 Ga0496125_0089146 Ga0496125_0089146_467_1003 178
394 3300048929 Ga0496126_0108568 Ga0496126_0108568_1700_2293 178
395 3300048929 Ga0496126_0279499 Ga0496126_0279499_800_1354 178
396 3300048929 Ga0496126_0654649 Ga0496126_0654649_142_678 178
397 3300049587 Ga0501071_0693341 Ga0501071_0693341_112_648 178
398 3300050489 nmdc:mga03683_10854_c1 nmdc:mga03683_10854_c1_243_800 178
399 3300050489 nmdc:mga03683_222091_c1 nmdc:mga03683_222091_c1_114_650 178
400 3300050490 nmdc:mga03n38_208874_c1 nmdc:mga03n38_208874_c1_276_812 178
401 3300050491 nmdc:mga00v17_345213_c1 nmdc:mga00v17_345213_c1_369_905 178
402 3300050491 nmdc:mga00v17_410847_c1 nmdc:mga00v17_410847_c1_265_810 178
403 3300050492 nmdc:mga0yw44_256243_c1 nmdc:mga0yw44_256243_c1_580_1125 178
404 3300050492 nmdc:mga0yw44_361840_c1 nmdc:mga0yw44_361840_c1_352_897 178
405 3300050493 nmdc:mga0k408_169459_c1 nmdc:mga0k408_169459_c1_321_857 178
406 3300050493 nmdc:mga0k408_320229_c1 nmdc:mga0k408_320229_c1_140_685 178
407 3300050493 nmdc:mga0k408_53291_c1 nmdc:mga0k408_53291_c1_276_812 178
408 3300050494 nmdc:mga06z11_116342_c2 nmdc:mga06z11_116342_c2_428_985 178
409 3300050494 nmdc:mga06z11_176663_c1 nmdc:mga06z11_176663_c1_192_737 178
410 3300050494 nmdc:mga06z11_432189_c1 nmdc:mga06z11_432189_c1_179_724 178
411 3300050495 nmdc:mga04h51_180165_c1 nmdc:mga04h51_180165_c1_23_559 178
412 3300050496 nmdc:mga07m45_189854_c1 nmdc:mga07m45_189854_c1_607_1143 178
413 3300050496 nmdc:mga07m45_517567_c1 nmdc:mga07m45_517567_c1_38_574 178
414 3300050496 nmdc:mga07m45_595433_c1 nmdc:mga07m45_595433_c1_76_612 178
415 3300050513 nmdc:mga0rr50_340498_c1 nmdc:mga0rr50_340498_c1_583_1119 178
416 3300050516 nmdc:mga0sz30_111254_c1 nmdc:mga0sz30_111254_c1_205_762 178
417 3300050516 nmdc:mga0sz30_217304_c1 nmdc:mga0sz30_217304_c1_259_804 178
418 3300050516 nmdc:mga0sz30_249360_c1 nmdc:mga0sz30_249360_c1_199_744 178
419 3300053093 Ga0500651_0041814 Ga0500651_0041814_1857_2393 178
420 3300053093 Ga0500651_0229603 Ga0500651_0229603_460_1005 178
421 3300053098 Ga0500650_0275726 Ga0500650_0275726_132_677 178
422 3300053098 Ga0500650_0312730 Ga0500650_0312730_87_623 178
423 3300053104 Ga0500556_0005445 Ga0500556_0005445_1293_1832 178
424 3300053108 Ga0500562_121636 Ga0500562_121636_122_658 178
425 3300053119 Ga0500595_016941 Ga0500595_016941_1820_2359 178
426 3300053139 Ga0500568_0004386 Ga0500568_0004386_5976_6515 178
427 3300053153 Ga0500616_0004795 Ga0500616_0004795_1228_1773 178
428 3300053155 Ga0500620_133252 Ga0500620_133252_75_620 178
429 3300053733 Ga0500552_000469 Ga0500552_000469_1853_2398 178
430 3300061734 Ga0530510_0774281 Ga0530510_0774281_132_719 178
431 iso_pu_bacteria 2791355199 2793081050 178
432 3300005434 Ga0070709_10001335 Ga0070709_100013353 179
433 3300005434 Ga0070709_10018092 Ga0070709_100180923 179
434 3300005434 Ga0070709_10234074 Ga0070709_102340742 179
435 3300005435 Ga0070714_100016284 Ga0070714_1000162845 179
436 3300005436 Ga0070713_100004922 Ga0070713_1000049224 179
437 3300005436 Ga0070713_100122908 Ga0070713_1001229083 179
438 3300005437 Ga0070710_10082375 Ga0070710_100823751 179
439 3300005437 Ga0070710_10150392 Ga0070710_101503921 179
440 3300005439 Ga0070711_100036048 Ga0070711_1000360483 179
441 3300005536 Ga0070697_101257664 Ga0070697_1012576641 179
442 3300006028 Ga0070717_10007835 Ga0070717_100078359 179
443 3300006163 Ga0070715_10003126 Ga0070715_100031264 179
444 3300006173 Ga0070716_100007047 Ga0070716_1000070473 179
445 3300006173 Ga0070716_100073602 Ga0070716_1000736022 179
446 3300006173 Ga0070716_100125486 Ga0070716_1001254863 179
447 3300006175 Ga0070712_100018869 Ga0070712_1000188695 179
448 3300006175 Ga0070712_100022114 Ga0070712_1000221143 179
449 3300006914 Ga0075436_100091485 Ga0075436_1000914851 179
450 3300010375 Ga0105239_10172651 Ga0105239_101726513 179
451 3300021358 Ga0213873_10111885 Ga0213873_101118851 179
452 3300021361 Ga0213872_10022265 Ga0213872_100222653 179
453 3300021361 Ga0213872_10071191 Ga0213872_100711913 179
454 3300024227 Ga0228598_1025133 Ga0228598_10251332 179
455 3300025898 Ga0207692_10008743 Ga0207692_100087434 179
456 3300025898 Ga0207692_10021040 Ga0207692_100210401 179
457 3300025905 Ga0207685_10011283 Ga0207685_100112832 179
458 3300025906 Ga0207699_10004550 Ga0207699_100045508 179
459 3300025906 Ga0207699_10007207 Ga0207699_100072075 179
460 3300025915 Ga0207693_10001772 Ga0207693_1000177212 179
461 3300025915 Ga0207693_10386825 Ga0207693_103868252 179
462 3300025916 Ga0207663_10015860 Ga0207663_100158603 179
463 3300025916 Ga0207663_10327632 Ga0207663_103276322 179
464 3300025929 Ga0207664_10007907 Ga0207664_100079074 179
465 3300025939 Ga0207665_10001072 Ga0207665_1000107213 179
466 3300025939 Ga0207665_10008363 Ga0207665_100083634 179
467 3300025939 Ga0207665_10050948 Ga0207665_100509482 179
468 3300025939 Ga0207665_10505271 Ga0207665_105052712 179
469 3300035410 Ga0373924_0130046 Ga0373924_0130046_116_655 179
470 3300036401 Ga0373937_0113568 Ga0373937_0113568_1684_2223 179
471 3300039438 Ga0436360_0496486 Ga0436360_0496486_1519_2091 179
472 3300039438 Ga0436360_0688980 Ga0436360_0688980_932_1510 179
473 3300039447 Ga0436361_0771035 Ga0436361_0771035_3715_4302 179
474 3300039447 Ga0436361_1050549 Ga0436361_1050549_3180_3758 179
475 3300039453 Ga0436362_1161726 Ga0436362_1161726_177_749 179
476 3300044656 Ga0466969_0063486 Ga0466969_0063486_428_1060 179
477 3300045049 Ga0466959_0125244 Ga0466959_0125244_864_1496 179
478 3300046462 Ga0495651_0131248 Ga0495651_0131248_1004_1543 179
479 3300046463 Ga0495653_0371439 Ga0495653_0371439_352_891 179
480 3300046511 Ga0495608_0070334 Ga0495608_0070334_1012_1551 179
481 3300046516 Ga0495628_0246644 Ga0495628_0246644_588_1127 179
482 3300046536 Ga0495587_0089281 Ga0495587_0089281_746_1285 179
483 3300046543 Ga0495645_0281920 Ga0495645_0281920_227_766 179
484 3300046663 Ga0495635_0270968 Ga0495635_0270968_425_964 179
485 3300046679 Ga0495623_0016947 Ga0495623_0016947_1279_1818 179
486 3300046690 Ga0495624_0280197 Ga0495624_0280197_298_837 179
487 3300047319 Ga0495674_0467966 Ga0495674_0467966_254_793 179
488 3300047444 Ga0495675_0026516 Ga0495675_0026516_615_1154 179
489 3300047673 Ga0495593_0114872 Ga0495593_0114872_550_1089 179
490 3300048929 Ga0496126_0023120 Ga0496126_0023120_1025_1564 179
491 3300050512 nmdc:mga0n895_15793_c1 nmdc:mga0n895_15793_c1_1753_2292 179
492 3300050514 nmdc:mga08x19_662988_c1 nmdc:mga08x19_662988_c1_75_614 179
493 3300053078 Ga0495612_0386236 Ga0495612_0386236_84_623 179
494 3300053085 Ga0495619_0201296 Ga0495619_0201296_469_1008 179
495 3300003320 rootH2_10225435 rootH2_102254351 180
496 3300005435 Ga0070714_100352820 Ga0070714_1003528202 180
497 3300005437 Ga0070710_10348000 Ga0070710_103480002 180
498 3300005983 Ga0081540_1042158 Ga0081540_10421583 180
499 3300009545 Ga0105237_10027277 Ga0105237_100272775 180
500 3300010375 Ga0105239_10924470 Ga0105239_109244702 180
501 3300030521 Ga0307511_10054131 Ga0307511_100541315 180
502 3300031616 Ga0307508_10000002 Ga0307508_1000000220 180
503 3300031730 Ga0307516_10099649 Ga0307516_100996494 180
504 3300039450 Ga0436363_0200004 Ga0436363_0200004_2050_2631 180
505 3300044735 Ga0466968_0086308 Ga0466968_0086308_13_624 180
506 3300048928 Ga0496125_0247667 Ga0496125_0247667_186_806 180
507 iso_pu_bacteria 2508501128 2509153874 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

28

65

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g7r-assembly1.cif.gz_B crystal structure of sco4454, a tetr-family transcriptional regulator from streptomyces coelicolor 0.7891 7 178
3br5-assembly2.cif.gz_E crystal structure of the complex of rhodamine 6g bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor 0.7784 7 177
1jt0-assembly1.cif.gz_C crystal structure of a cooperative qacr-dna complex 0.7753 10 177
3br6-assembly2.cif.gz_D crystal structure of the complex of rhodamine 6g bound to qacr(e120q), a mutant of a multidrug binding transcriptional repressor 0.7741 10 177
3br3-assembly1.cif.gz_B crystal structure of the complex of ethidium bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor 0.7677 10 177
ID Description Score Start End Superfamily
3fiwB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.971 6 52 1.10.10.60
3fiwD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9594 6 52 1.10.10.60
3b6cA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9472 4 59 1.10.10.60
1zk8B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.945 5 47 1.10.10.60
2y2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9436 5 59 1.10.10.60
ID Description Score Start End GO Terms
AF-H0TRG6-F1-model_v4 Putative transcriptional regulator protein 0.9791 1 180 GO:0003677
AF-A0A2H9VKR7-F1-model_v4 deleted 0.9763 1 178
AF-A0A0S6UNV9-F1-model_v4 HTH tetR-type domain-containing protein 0.9732 1 179 GO:0003677
AF-A0A1I7EYK7-F1-model_v4 deleted 0.9721 1 176
AF-A0A2H9VKR7-F1-model_v4 deleted 0.9604 1 178

Feature Viewer

pLDDT pTM Quality
92.63 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map