F456576

General Info

Members Datasets Scaffolds Average Seq Length
506 276 1012 113

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0064855|Ga0495686_0064855_114_509
Length 131
Sequence MQGDRMRKVNEAVREVVSTALTSGVNDERLGFITITGVETSPDLRNAVVFVSTYGNKKQRELTFEALDDLRLELQREIATHMRMKFTPVLRFEYDGTLDRSMRVSELINQEAAVFDSLPADTEAHKMEDGQ

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
90 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
142 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
147 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
163 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
164 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
165 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
166 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
167 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
168 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
169 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
170 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
171 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
172 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
173 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
174 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
175 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
178 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
179 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
201 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
202 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
203 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
204 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
205 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
206 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
207 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
212 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
223 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
226 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
227 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
228 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.98
Nodule 0
Rhizoplane 8.3
Rhizosphere 84.19
Stem 0
Stem Tuber 0
Unclassified 16.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0064855 3300047472 Bacteria 2260
2 JGI25407J50210_10001516 3300003373 Bacteria 5281
3 JGI25407J50210_10054997 3300003373 Bacteria 1005
4 JGI25404J52841_10027649 3300003659 Bacteria 1219
5 Ga0070683_101458405 3300005329 Unclassified 658
6 Ga0070683_101684627 3300005329 Unclassified 610
7 Ga0070690_101253555 3300005330 Bacteria 593
8 Ga0070670_100846780 3300005331 Unclassified 827
9 Ga0068869_100134728 3300005334 Bacteria 1902
10 Ga0068869_101618481 3300005334 Bacteria 577
11 Ga0070682_100069145 3300005337 Bacteria 2254
12 Ga0070682_101558187 3300005337 Unclassified 570
13 Ga0068868_100097273 3300005338 Bacteria 2378
14 Ga0068868_100159886 3300005338 Bacteria 1860
15 Ga0070660_101580188 3300005339 Bacteria 558
16 Ga0070691_10232414 3300005341 Bacteria 982
17 Ga0070691_10734064 3300005341 Bacteria 596
18 Ga0070668_100022619 3300005347 Bacteria 4753
19 Ga0070675_100554023 3300005354 Unclassified 1040
20 Ga0070673_100566505 3300005364 Bacteria 1033
21 Ga0070659_100117385 3300005366 Bacteria 2152
22 Ga0070659_102116999 3300005366 Unclassified 506
23 Ga0070667_100724207 3300005367 Bacteria 921
24 Ga0070667_101146835 3300005367 Unclassified 727
25 Ga0070709_11251748 3300005434 Bacteria 597
26 Ga0070714_100476739 3300005435 Bacteria 1188
27 Ga0070714_100563131 3300005435 Bacteria 1092
28 Ga0070714_100769084 3300005435 Bacteria 932
29 Ga0070714_101258296 3300005435 Unclassified 722
30 Ga0070713_100031566 3300005436 Bacteria 4221
31 Ga0070713_100509210 3300005436 Bacteria 1136
32 Ga0070711_100064784 3300005439 Bacteria 2554
33 Ga0070700_100534398 3300005441 Unclassified 908
34 Ga0070708_100027318 3300005445 Bacteria 4896
35 Ga0070708_100037166 3300005445 Bacteria 4247
36 Ga0070663_100619928 3300005455 Bacteria 912
37 Ga0070678_100646038 3300005456 Unclassified 949
38 Ga0070662_100073280 3300005457 Bacteria 2530
39 Ga0070681_10044906 3300005458 Bacteria 4422
40 Ga0068867_100446880 3300005459 Unclassified 1100
41 Ga0070706_100007268 3300005467 Bacteria 10401
42 Ga0070706_100072800 3300005467 Bacteria 3180
43 Ga0070706_100204041 3300005467 Unclassified 1846
44 Ga0070706_100306679 3300005467 Bacteria 1481
45 Ga0070707_100000635 3300005468 Bacteria 35108
46 Ga0070707_100135271 3300005468 Bacteria 2398
47 Ga0070707_100480600 3300005468 Bacteria 1204
48 Ga0070707_100481237 3300005468 Bacteria 1203
49 Ga0070707_100489126 3300005468 Bacteria 1192
50 Ga0070707_101943021 3300005468 Bacteria 556
51 Ga0070698_100078507 3300005471 Bacteria 3299
52 Ga0070698_100362531 3300005471 Unclassified 1381
53 Ga0070698_100504646 3300005471 Bacteria 1148
54 Ga0070698_101080569 3300005471 Unclassified 751
55 Ga0070699_100004137 3300005518 Bacteria 12817
56 Ga0070699_100019671 3300005518 Bacteria 5817
57 Ga0070699_100142682 3300005518 Bacteria 2116
58 Ga0070699_101993972 3300005518 Unclassified 531
59 Ga0070679_100245039 3300005530 Unclassified 1749
60 Ga0070684_100241923 3300005535 Bacteria 1649
61 Ga0070697_100256436 3300005536 Bacteria 1496
62 Ga0070697_100816409 3300005536 Bacteria 825
63 Ga0070686_100582033 3300005544 Bacteria 880
64 Ga0070686_100638023 3300005544 Bacteria 843
65 Ga0070695_100372386 3300005545 Bacteria 1075
66 Ga0070696_100030834 3300005546 Bacteria 3672
67 Ga0070696_100080916 3300005546 Bacteria 2301
68 Ga0070696_100373488 3300005546 Bacteria 1109
69 Ga0070693_100807061 3300005547 Bacteria 696
70 Ga0070665_100001256 3300005548 Bacteria 30586
71 Ga0070665_100951864 3300005548 Bacteria 871
72 Ga0070704_100186750 3300005549 Bacteria 1663
73 Ga0068855_100334969 3300005563 Unclassified 1670
74 Ga0070664_102125699 3300005564 Bacteria 533
75 Ga0068854_100039848 3300005578 Bacteria 3311
76 Ga0068856_100203617 3300005614 Bacteria 1994
77 Ga0070702_100091192 3300005615 Bacteria 1848
78 Ga0070702_100219686 3300005615 Bacteria 1270
79 Ga0068864_102504119 3300005618 Bacteria 522
80 Ga0081455_10025998 3300005937 Bacteria 5393
81 Ga0081455_10041666 3300005937 Bacteria 4035
82 Ga0081455_10152344 3300005937 Bacteria 1781
83 Ga0081538_10000020 3300005981 Bacteria 139567
84 Ga0081538_10000200 3300005981 Bacteria 66229
85 Ga0081538_10009529 3300005981 Bacteria 8087
86 Ga0081538_10010141 3300005981 Bacteria 7749
87 Ga0081538_10017344 3300005981 Bacteria 5469
88 Ga0081538_10029426 3300005981 Bacteria 3752
89 Ga0081540_1001396 3300005983 Bacteria 20924
90 Ga0081540_1018895 3300005983 Bacteria 4210
91 Ga0081539_10023505 3300005985 Bacteria 4036
92 Ga0070717_10148919 3300006028 Bacteria 2024
93 Ga0070717_10249856 3300006028 Bacteria 1566
94 Ga0070717_10678664 3300006028 Bacteria 936
95 Ga0070717_10727690 3300006028 Bacteria 902
96 Ga0075365_10133214 3300006038 Bacteria 1721
97 Ga0075363_100378394 3300006048 Unclassified 830
98 Ga0075432_10025589 3300006058 Bacteria 2025
99 Ga0070715_10069014 3300006163 Bacteria 1574
100 Ga0070712_100177910 3300006175 Bacteria 1655
101 Ga0070712_100225794 3300006175 Unclassified 1485
102 Ga0070712_100455323 3300006175 Bacteria 1066
103 Ga0070712_100657966 3300006175 Bacteria 890
104 Ga0070712_100944359 3300006175 Unclassified 745
105 Ga0075362_10071413 3300006177 Bacteria 1586
106 Ga0075367_10084967 3300006178 Bacteria 1920
107 Ga0097621_101502747 3300006237 Unclassified 639
108 Ga0068871_100445165 3300006358 Bacteria 1160
109 Ga0075428_100162344 3300006844 Bacteria 2425
110 Ga0075428_100390570 3300006844 Bacteria 1492
111 Ga0075430_100000896 3300006846 Bacteria 23379
112 Ga0075430_100291216 3300006846 Bacteria 1350
113 Ga0075430_101008607 3300006846 Bacteria 686
114 Ga0075431_100050431 3300006847 Bacteria 4291
115 Ga0075431_100084917 3300006847 Bacteria 3268
116 Ga0075431_100456475 3300006847 Bacteria 1273
117 Ga0075433_11023573 3300006852 Unclassified 719
118 Ga0075434_100287503 3300006871 Bacteria 1664
119 Ga0075434_100304240 3300006871 Bacteria 1615
120 Ga0075429_100211780 3300006880 Bacteria 1698
121 Ga0068865_100831119 3300006881 Bacteria 799
122 Ga0111539_10471662 3300009094 Bacteria 1462
123 Ga0111539_10547510 3300009094 Bacteria 1348
124 Ga0105245_10064406 3300009098 Bacteria 3312
125 Ga0105245_10065556 3300009098 Bacteria 3285
126 Ga0105245_10077188 3300009098 Bacteria 3036
127 Ga0105245_10604893 3300009098 Bacteria 1123
128 Ga0105245_10629383 3300009098 Bacteria 1102
129 Ga0114129_10042509 3300009147 Bacteria 6400
130 Ga0114129_10440344 3300009147 Bacteria 1711
131 Ga0114129_10597704 3300009147 Bacteria 1430
132 Ga0114129_10803678 3300009147 Bacteria 1199
133 Ga0114129_11192054 3300009147 Bacteria 949
134 Ga0114129_11451586 3300009147 Archaea 845
135 Ga0114129_12472858 3300009147 Unclassified 621
136 Ga0105243_10664059 3300009148 Bacteria 1012
137 Ga0105241_10691814 3300009174 Unclassified 930
138 Ga0105242_10082481 3300009176 Bacteria 2691
139 Ga0105242_10270779 3300009176 Bacteria 1538
140 Ga0105242_11352317 3300009176 Bacteria 738
141 Ga0105248_10119439 3300009177 Bacteria 2973
142 Ga0105238_11959114 3300009551 Bacteria 619
143 Ga0105238_12831979 3300009551 Bacteria 521
144 Ga0105239_10039439 3300010375 Bacteria 5174
145 Ga0105239_10515750 3300010375 Bacteria 1360
146 Ga0105239_13487883 3300010375 Bacteria 511
147 Ga0157373_10897691 3300013100 Bacteria 657
148 Ga0157371_10242416 3300013102 Unclassified 1297
149 Ga0157371_10520377 3300013102 Unclassified 880
150 Ga0157371_10911018 3300013102 Bacteria 667
151 Ga0157370_10824995 3300013104 Unclassified 843
152 Ga0157374_10151323 3300013296 Bacteria 2256
153 Ga0157378_10695679 3300013297 Bacteria 1036
154 Ga0157378_11187338 3300013297 Unclassified 802
155 Ga0157372_10088718 3300013307 Bacteria 3512
156 Ga0157372_10361384 3300013307 Bacteria 1692
157 Ga0157375_10008139 3300013308 Bacteria 9171
158 Ga0163163_11157855 3300014325 Bacteria 836
159 Ga0163163_12281519 3300014325 Bacteria 600
160 Ga0157377_10333017 3300014745 Unclassified 1013
161 Ga0157376_10130747 3300014969 Bacteria 2240
162 Ga0163161_10035044 3300017792 Bacteria 3591
163 Ga0206350_10108729 3300020080 Unclassified 694
164 Ga0213873_10071829 3300021358 Bacteria 955
165 Ga0213874_10151685 3300021377 Bacteria 809
166 Ga0213876_10013997 3300021384 Bacteria 4252
167 Ga0213876_10038318 3300021384 Bacteria 2529
168 Ga0207692_10165405 3300025898 Bacteria 1278
169 Ga0207699_10274147 3300025906 Bacteria 1170
170 Ga0207705_10346515 3300025909 Bacteria 1144
171 Ga0207684_10007664 3300025910 Bacteria 9683
172 Ga0207684_10695494 3300025910 Unclassified 864
173 Ga0207684_10726774 3300025910 Unclassified 842
174 Ga0207654_10746489 3300025911 Unclassified 705
175 Ga0207707_10145390 3300025912 Bacteria 2073
176 Ga0207693_10002242 3300025915 Bacteria 16827
177 Ga0207693_10062055 3300025915 Unclassified 2928
178 Ga0207693_11423850 3300025915 Bacteria 514
179 Ga0207663_10401719 3300025916 Bacteria 1048
180 Ga0207663_11453028 3300025916 Bacteria 552
181 Ga0207660_10713245 3300025917 Unclassified 818
182 Ga0207662_10136003 3300025918 Bacteria 1553
183 Ga0207652_10115420 3300025921 Bacteria 2385
184 Ga0207652_10836644 3300025921 Unclassified 816
185 Ga0207646_10546773 3300025922 Bacteria 1041
186 Ga0207646_10725910 3300025922 Bacteria 887
187 Ga0207681_11446577 3300025923 Bacteria 577
188 Ga0207694_11844698 3300025924 Bacteria 508
189 Ga0207650_10878948 3300025925 Unclassified 761
190 Ga0207687_10018066 3300025927 Bacteria 4652
191 Ga0207687_10091884 3300025927 Bacteria 2215
192 Ga0207687_10278912 3300025927 Bacteria 1339
193 Ga0207687_11523262 3300025927 Unclassified 574
194 Ga0207700_10170146 3300025928 Bacteria 1817
195 Ga0207664_10044458 3300025929 Bacteria 3478
196 Ga0207664_10191247 3300025929 Bacteria 1762
197 Ga0207664_10309597 3300025929 Bacteria 1391
198 Ga0207664_10762344 3300025929 Bacteria 870
199 Ga0207664_11624518 3300025929 Unclassified 568
200 Ga0207664_11714084 3300025929 Unclassified 551
201 Ga0207690_10612720 3300025932 Archaea 889
202 Ga0207709_10802774 3300025935 Bacteria 760
203 Ga0207651_10365204 3300025960 Bacteria 1220
204 Ga0207668_10329451 3300025972 Bacteria 1270
205 Ga0207668_10382161 3300025972 Bacteria 1186
206 Ga0207640_10564133 3300025981 Bacteria 959
207 Ga0207640_10634943 3300025981 Unclassified 908
208 Ga0207678_10121731 3300026067 Bacteria 2227
209 Ga0207708_10839161 3300026075 Bacteria 793
210 Ga0207702_10374168 3300026078 Bacteria 1368
211 Ga0207702_11552334 3300026078 Bacteria 655
212 Ga0207648_10752422 3300026089 Bacteria 905
213 Ga0207683_10121547 3300026121 Bacteria 2345
214 Ga0207683_10460974 3300026121 Bacteria 1172
215 Ga0207428_10054361 3300027907 Bacteria 3189
216 Ga0207428_10831203 3300027907 Bacteria 655
217 Ga0268266_10011210 3300028379 Bacteria 7800
218 Ga0268266_11823426 3300028379 Bacteria 583
219 Ga0265319_1000079 3300028563 Bacteria 75683
220 Ga0265334_10038035 3300028573 Bacteria 1895
221 Ga0265318_10001862 3300028577 Bacteria 11881
222 Ga0265338_10352853 3300028800 Bacteria 1057
223 Ga0265338_10763969 3300028800 Bacteria 664
224 Ga0265320_10005759 3300031240 Bacteria 7902
225 Ga0265325_10155381 3300031241 Bacteria 1079
226 Ga0265313_10125467 3300031595 Bacteria 1116
227 Ga0265314_10046444 3300031711 Bacteria 3064
228 Ga0307405_10606095 3300031731 Unclassified 894
229 Ga0307405_10899484 3300031731 Bacteria 749
230 Ga0307413_10221465 3300031824 Bacteria 1382
231 Ga0307410_10094657 3300031852 Bacteria 2128
232 Ga0307410_10295617 3300031852 Bacteria 1276
233 Ga0307406_10077496 3300031901 Bacteria 2199
234 Ga0307406_10154888 3300031901 Bacteria 1640
235 Ga0307406_10195344 3300031901 Bacteria 1485
236 Ga0307406_10765947 3300031901 Bacteria 812
237 Ga0307407_10569323 3300031903 Bacteria 840
238 Ga0307412_10060793 3300031911 Bacteria 2537
239 Ga0307412_10823119 3300031911 Bacteria 808
240 Ga0307412_11298369 3300031911 Bacteria 655
241 Ga0307409_100046467 3300031995 Bacteria 3286
242 Ga0307409_100641799 3300031995 Bacteria 1054
243 Ga0307416_100036841 3300032002 Bacteria 3757
244 Ga0307416_100213380 3300032002 Bacteria 1843
245 Ga0307416_100927283 3300032002 Bacteria 972
246 Ga0307416_101937419 3300032002 Bacteria 692
247 Ga0307416_103661567 3300032002 Unclassified 514
248 Ga0307414_10249041 3300032004 Bacteria 1476
249 Ga0307414_10554454 3300032004 Bacteria 1025
250 Ga0307414_11660398 3300032004 Unclassified 596
251 Ga0307411_10196905 3300032005 Bacteria 1544
252 Ga0307411_10337063 3300032005 Bacteria 1224
253 Ga0307411_10780828 3300032005 Bacteria 839
254 Ga0307415_100057894 3300032126 Bacteria 2665
255 Ga0307415_100456342 3300032126 Bacteria 1106
256 Ga0307415_102596166 3300032126 Bacteria 500
257 Ga0373926_0145107 3300035083 Bacteria 902
258 Ga0373949_0118414 3300035090 Bacteria 741
259 Ga0373939_0015919 3300035114 Bacteria 1975
260 Ga0373960_0021350 3300035121 Bacteria 1721
261 Ga0373943_0025094 3300035170 Bacteria 2784
262 Ga0373943_0476869 3300035170 Unclassified 727
263 Ga0373942_0109128 3300035207 Bacteria 854
264 Ga0373961_0010189 3300035241 Bacteria 2312
265 Ga0373931_0140869 3300035691 Bacteria 1396
266 Ga0373935_0277285 3300035692 Bacteria 1180
267 Ga0373927_0163236 3300035695 Unclassified 1460
268 Ga0373947_0015682 3300035725 Bacteria 4353
269 Ga0373925_0222382 3300037068 Bacteria 1507
270 Ga0395899_0009196 3300037312 Bacteria 7587
271 Ga0395899_0052151 3300037312 Bacteria 3033
272 Ga0395899_0429032 3300037312 Bacteria 869
273 Ga0395900_0043824 3300037418 Bacteria 4611
274 Ga0395900_0049168 3300037418 Bacteria 4344
275 Ga0395900_1600443 3300037418 Unclassified 563
276 Ga0395898_0013450 3300037466 Bacteria 8427
277 Ga0395898_0136104 3300037466 Bacteria 2352
278 Ga0395898_0357885 3300037466 Bacteria 1392
279 Ga0395898_0524855 3300037466 Unclassified 1125
280 Ga0395905_0007707 3300037471 Bacteria 10683
281 Ga0395905_0053064 3300037471 Bacteria 3795
282 Ga0395905_0305492 3300037471 Bacteria 1479
283 Ga0395905_0964010 3300037471 Bacteria 756
284 Ga0436364_0324999 3300037853 Bacteria 16084
285 Ga0436364_0402335 3300037853 Bacteria 1217
286 Ga0436364_0452123 3300037853 Bacteria 5679
287 Ga0436364_1135557 3300037853 Bacteria 792
288 Ga0395901_0063932 3300038443 Bacteria 3830
289 Ga0395901_0180437 3300038443 Unclassified 2214
290 Ga0395901_0564296 3300038443 Bacteria 1152
291 Ga0395901_0586415 3300038443 Unclassified 1126
292 Ga0395901_1084446 3300038443 Bacteria 772
293 Ga0395901_1260965 3300038443 Bacteria 702
294 Ga0436365_0322791 3300039437 Bacteria 2532
295 Ga0436365_0343902 3300039437 Unclassified 597
296 Ga0436365_0626905 3300039437 Bacteria 1506
297 Ga0436365_0920074 3300039437 Bacteria 17041
298 Ga0436365_1168763 3300039437 Bacteria 90017
299 Ga0436365_1380658 3300039437 Bacteria 17187
300 Ga0436365_1634568 3300039437 Archaea 626
301 Ga0436360_0541500 3300039438 Unclassified 503
302 Ga0436363_0622033 3300039450 Bacteria 2062
303 Ga0436363_0973645 3300039450 Bacteria 5462
304 Ga0436363_1612917 3300039450 Bacteria 2672
305 Ga0436362_0286633 3300039453 Bacteria 1660
306 Ga0436362_0317694 3300039453 Bacteria 1369
307 Ga0436362_0359120 3300039453 Bacteria 1584
308 Ga0436362_0586522 3300039453 Bacteria 2260
309 Ga0451789_1147762 3300041443 Bacteria 1812
310 Ga0451793_0320640 3300041452 Bacteria 3124
311 Ga0451795_1069486 3300041456 Bacteria 530
312 Ga0451800_0043981 3300041459 Bacteria 638
313 Ga0451800_0209431 3300041459 Bacteria 3287
314 Ga0451800_1021413 3300041459 Bacteria 760
315 Ga0451802_0941993 3300041460 Bacteria 2622
316 Ga0451802_1233621 3300041460 Bacteria 647
317 Ga0451802_1622299 3300041460 Unclassified 705
318 Ga0451807_1067696 3300041486 Bacteria 1189
319 Ga0451835_0274349 3300041492 Bacteria 735
320 Ga0451835_0948273 3300041492 Bacteria 1360
321 Ga0451839_0120851 3300041496 Bacteria 3120
322 Ga0451845_0849816 3300041501 Bacteria 3526
323 Ga0451847_0811894 3300041503 Bacteria 1793
324 Ga0451849_0346405 3300041505 Unclassified 937
325 Ga0451849_1098845 3300041505 Bacteria 2215
326 Ga0451851_1149160 3300041507 Bacteria 1158
327 Ga0451855_0710545 3300041511 Bacteria 3349
328 Ga0451853_0483348 3300041512 Bacteria 2525
329 Ga0451853_1291017 3300041512 Bacteria 2261
330 Ga0439448_0016670 3300042005 Archaea 2238
331 Ga0439464_0194898 3300042439 Bacteria 645
332 Ga0439460_0231168 3300042461 Unclassified 636
333 Ga0466972_0158172 3300044658 Bacteria 1065
334 Ga0453683_0490223 3300044673 Unclassified 797
335 Ga0466965_0046920 3300044683 Bacteria 2139
336 Ga0466965_0282466 3300044683 Bacteria 897
337 Ga0466966_0002641 3300044684 Bacteria 11739
338 Ga0466966_0091506 3300044684 Bacteria 1888
339 Ga0466966_0114460 3300044684 Bacteria 1661
340 Ga0466961_0228629 3300044693 Bacteria 1145
341 Ga0466963_0014324 3300044694 Bacteria 4887
342 Ga0466964_0196687 3300044706 Bacteria 965
343 Ga0466971_0661972 3300044719 Unclassified 523
344 Ga0466970_0027996 3300044765 Bacteria 2960
345 Ga0466957_0038827 3300044842 Bacteria 2870
346 Ga0466960_0186145 3300044901 Bacteria 1128
347 Ga0466960_0960220 3300044901 Unclassified 524
348 Ga0466959_0020957 3300045049 Bacteria 4819
349 Ga0466959_0195494 3300045049 Bacteria 1410
350 Ga0466958_0000401 3300045836 Bacteria 17774
351 Ga0466967_0001515 3300045976 Bacteria 13576
352 Ga0466967_0068379 3300045976 Bacteria 3171
353 Ga0466967_0072567 3300045976 Bacteria 3085
354 Ga0466967_0143485 3300045976 Bacteria 2226
355 Ga0466967_1060982 3300045976 Bacteria 807
356 Ga0466967_2110962 3300045976 Unclassified 560
357 Ga0495592_0775832 3300046454 Bacteria 571
358 Ga0495603_0031071 3300046455 Bacteria 3215
359 Ga0495641_0228530 3300046461 Bacteria 835
360 Ga0495580_0050232 3300046472 Bacteria 2949
361 Ga0495605_0092626 3300046474 Bacteria 1399
362 Ga0495605_0367062 3300046474 Bacteria 602
363 Ga0495584_0044326 3300046491 Unclassified 2245
364 Ga0495584_0050910 3300046491 Bacteria 2086
365 Ga0495584_0261975 3300046491 Bacteria 879
366 Ga0495585_0145917 3300046492 Bacteria 1237
367 Ga0495596_0063990 3300046500 Bacteria 1431
368 Ga0495596_0112943 3300046500 Bacteria 1055
369 Ga0495596_0220732 3300046500 Unclassified 736
370 Ga0495607_0146516 3300046501 Unclassified 1213
371 Ga0495620_0168084 3300046515 Bacteria 851
372 Ga0495631_0182010 3300046518 Unclassified 900
373 Ga0495631_0204657 3300046518 Bacteria 844
374 Ga0495637_0206080 3300046520 Bacteria 721
375 Ga0495644_0065318 3300046523 Unclassified 1367
376 Ga0495663_0014489 3300046525 Bacteria 2210
377 Ga0495666_0244010 3300046526 Bacteria 819
378 Ga0495642_0128372 3300046528 Archaea 1091
379 Ga0495587_0027873 3300046536 Bacteria 3439
380 Ga0495598_0065852 3300046537 Unclassified 1129
381 Ga0495609_0148743 3300046538 Bacteria 997
382 Ga0495656_0004187 3300046615 Bacteria 4926
383 Ga0495656_0213250 3300046615 Bacteria 963
384 Ga0495656_0495157 3300046615 Bacteria 648
385 Ga0495659_0024238 3300046664 Bacteria 2068
386 Ga0495659_0285588 3300046664 Bacteria 694
387 Ga0495661_0344880 3300046665 Bacteria 735
388 Ga0495588_0275000 3300046674 Unclassified 887
389 Ga0495599_0755861 3300046678 Bacteria 557
390 Ga0495646_0520414 3300046680 Bacteria 610
391 Ga0495658_0248561 3300046683 Bacteria 1118
392 Ga0495613_0142373 3300046689 Bacteria 1713
393 Ga0495624_0002990 3300046690 Bacteria 12645
394 Ga0495671_0063700 3300046692 Bacteria 1816
395 Ga0495589_0040565 3300046794 Bacteria 2324
396 Ga0495676_0036492 3300047321 Bacteria 4104
397 Ga0495676_0288341 3300047321 Bacteria 1110
398 Ga0495676_0594691 3300047321 Bacteria 721
399 Ga0495683_0190190 3300047323 Bacteria 932
400 Ga0495677_0440125 3300047445 Unclassified 516
401 Ga0495685_120091 3300047447 Bacteria 863
402 Ga0495626_0175295 3300048091 Bacteria 892
403 Ga0496100_0106632 3300048903 Unclassified 1940
404 Ga0496100_0284139 3300048903 Bacteria 1234
405 Ga0496102_0499657 3300048905 Bacteria 1138
406 Ga0496102_1105697 3300048905 Unclassified 712
407 Ga0496103_0334889 3300048906 Bacteria 973
408 Ga0496105_0118871 3300048908 Bacteria 2180
409 Ga0496105_0130859 3300048908 Unclassified 2069
410 Ga0496107_0615791 3300048910 Bacteria 802
411 Ga0496107_0852679 3300048910 Unclassified 665
412 Ga0496108_0009239 3300048911 Bacteria 7977
413 Ga0496108_0563589 3300048911 Bacteria 993
414 Ga0496109_0004612 3300048912 Bacteria 11501
415 Ga0496109_0198674 3300048912 Bacteria 1885
416 Ga0496109_0308373 3300048912 Bacteria 1493
417 Ga0496109_0309173 3300048912 Bacteria 1491
418 Ga0496109_0325660 3300048912 Bacteria 1450
419 Ga0496109_1227434 3300048912 Unclassified 686
420 Ga0496110_0018146 3300048913 Bacteria 5895
421 Ga0496110_0035898 3300048913 Bacteria 4304
422 Ga0496110_0304249 3300048913 Bacteria 1452
423 Ga0496111_0004911 3300048914 Bacteria 8495
424 Ga0496111_0128644 3300048914 Bacteria 1873
425 Ga0496111_0152559 3300048914 Bacteria 1714
426 Ga0496112_0064715 3300048915 Bacteria 3609
427 Ga0496112_0278665 3300048915 Bacteria 1620
428 Ga0496112_0503011 3300048915 Unclassified 1147
429 Ga0496113_0134995 3300048916 Bacteria 1938
430 Ga0496113_0139296 3300048916 Bacteria 1908
431 Ga0496113_0155419 3300048916 Bacteria 1806
432 Ga0496113_0634964 3300048916 Bacteria 854
433 Ga0496114_0350408 3300048917 Bacteria 1306
434 Ga0496115_0415797 3300048918 Bacteria 1090
435 Ga0501299_183397 3300049522 Bacteria 548
436 Ga0501031_0411867 3300049568 Bacteria 874
437 Ga0501031_0500510 3300049568 Unclassified 784
438 Ga0501036_0291709 3300049572 Bacteria 1365
439 Ga0501036_0442663 3300049572 Bacteria 1083
440 Ga0501036_0990644 3300049572 Unclassified 688
441 Ga0501036_1188693 3300049572 Unclassified 622
442 Ga0501038_1197091 3300049574 Bacteria 552
443 Ga0501039_0379326 3300049575 Bacteria 1111
444 Ga0501039_1005616 3300049575 Bacteria 648
445 Ga0501040_0375913 3300049576 Unclassified 1019
446 Ga0501040_0457175 3300049576 Bacteria 919
447 Ga0501040_0527741 3300049576 Bacteria 852
448 Ga0501041_0750459 3300049577 Bacteria 625
449 Ga0501041_0970592 3300049577 Bacteria 546
450 Ga0501042_0325303 3300049578 Bacteria 1111
451 Ga0501042_0977387 3300049578 Bacteria 617
452 Ga0501048_0691666 3300049582 Bacteria 732
453 Ga0501067_0191131 3300049583 Bacteria 1140
454 Ga0501070_0434274 3300049586 Bacteria 1060
455 Ga0501075_0437667 3300049591 Unclassified 997
456 Ga0501075_1299774 3300049591 Bacteria 551
457 Ga0501076_0136659 3300049592 Bacteria 1990
458 Ga0501076_0524368 3300049592 Bacteria 977
459 Ga0501076_1174914 3300049592 Unclassified 632
460 Ga0501079_0261057 3300049741 Bacteria 1354
461 Ga0501080_0186252 3300049742 Bacteria 1909
462 Ga0501080_1132055 3300049742 Bacteria 675
463 Ga0501045_0203742 3300049824 Bacteria 1474
464 nmdc:mga03n38_157547_c1 3300050490 Bacteria 1147
465 nmdc:mga03n38_326965_c1 3300050490 Bacteria 829
466 nmdc:mga00v17_310998_c1 3300050491 Bacteria 1023
467 nmdc:mga00v17_540147_c1 3300050491 Bacteria 754
468 nmdc:mga0yw44_227367_c1 3300050492 Bacteria 1238
469 nmdc:mga06z11_289919_c1 3300050494 Bacteria 971
470 nmdc:mga05p37_312271_c1 3300050507 Bacteria 1863
471 nmdc:mga05p37_359829_c1 3300050507 Bacteria 1711
472 nmdc:mga05p37_533741_c1 3300050507 Bacteria 1339
473 nmdc:mga05p37_6826_c1 3300050507 Bacteria 13454
474 nmdc:mga09592_195445_c1 3300050508 Bacteria 1751
475 nmdc:mga09592_231015_c1 3300050508 Bacteria 1603
476 nmdc:mga09592_358724_c1 3300050508 Bacteria 1261
477 nmdc:mga09592_87510_c1 3300050508 Bacteria 2660
478 nmdc:mga0qj67_315806_c1 3300050509 Bacteria 1265
479 nmdc:mga0qj67_42548_c1 3300050509 Bacteria 3576
480 nmdc:mga06r32_120314_c1 3300050510 Bacteria 2589
481 nmdc:mga06r32_182375_c1 3300050510 Bacteria 2085
482 nmdc:mga06r32_567730_c1 3300050510 Unclassified 1107
483 nmdc:mga06r32_8783_c1 3300050510 Bacteria 9106
484 nmdc:mga08y16_1204359_c1 3300050511 Unclassified 728
485 nmdc:mga08y16_195776_c1 3300050511 Bacteria 2095
486 nmdc:mga08y16_223942_c1 3300050511 Bacteria 1946
487 nmdc:mga08y16_9341_c1 3300050511 Bacteria 10284
488 nmdc:mga0n895_1102906_c1 3300050512 Bacteria 771
489 nmdc:mga0n895_179971_c1 3300050512 Bacteria 2145
490 nmdc:mga0n895_279803_c1 3300050512 Bacteria 1692
491 nmdc:mga0rr50_1733022_c1 3300050513 Bacteria 526
492 nmdc:mga0a205_1209755_c1 3300050515 Bacteria 603
493 nmdc:mga0a205_925112_c1 3300050515 Unclassified 719
494 Ga0495655_0199196 3300053083 Bacteria 654
495 Ga0501084_0130515 3300054114 Bacteria 2115
496 Ga0501084_1420772 3300054114 Bacteria 581
497 Ga0501084_1508797 3300054114 Unclassified 562
498 Ga0587073_0039229 3300059492 Bacteria 1023
499 Ga0587080_139791 3300059503 Bacteria 552
500 Ga0501082_0407859 3300060353 Unclassified 1186
501 Ga0501082_2006211 3300060353 Bacteria 504
502 Ga0466962_0021743 3300061719 Bacteria 3079
503 Ga0530510_0231060 3300061734 Bacteria 1376
504 Ga0530510_0248702 3300061734 Unclassified 1325
505 Ga0530510_0500726 3300061734 Bacteria 921
506 Ga0530510_0875806 3300061734 Bacteria 686
507 Ga0495686_0064855
508 JGI25407J50210_10001516
509 JGI25407J50210_10054997
510 JGI25404J52841_10027649
511 Ga0070683_101458405
512 Ga0070683_101684627
513 Ga0070690_101253555
514 Ga0070670_100846780
515 Ga0068869_100134728
516 Ga0068869_101618481
517 Ga0070682_100069145
518 Ga0070682_101558187
519 Ga0068868_100097273
520 Ga0068868_100159886
521 Ga0070660_101580188
522 Ga0070691_10232414
523 Ga0070691_10734064
524 Ga0070668_100022619
525 Ga0070675_100554023
526 Ga0070673_100566505
527 Ga0070659_100117385
528 Ga0070659_102116999
529 Ga0070667_100724207
530 Ga0070667_101146835
531 Ga0070709_11251748
532 Ga0070714_100476739
533 Ga0070714_100563131
534 Ga0070714_100769084
535 Ga0070714_101258296
536 Ga0070713_100031566
537 Ga0070713_100509210
538 Ga0070711_100064784
539 Ga0070700_100534398
540 Ga0070708_100027318
541 Ga0070708_100037166
542 Ga0070663_100619928
543 Ga0070678_100646038
544 Ga0070662_100073280
545 Ga0070681_10044906
546 Ga0068867_100446880
547 Ga0070706_100007268
548 Ga0070706_100072800
549 Ga0070706_100204041
550 Ga0070706_100306679
551 Ga0070707_100000635
552 Ga0070707_100135271
553 Ga0070707_100480600
554 Ga0070707_100481237
555 Ga0070707_100489126
556 Ga0070707_101943021
557 Ga0070698_100078507
558 Ga0070698_100362531
559 Ga0070698_100504646
560 Ga0070698_101080569
561 Ga0070699_100004137
562 Ga0070699_100019671
563 Ga0070699_100142682
564 Ga0070699_101993972
565 Ga0070679_100245039
566 Ga0070684_100241923
567 Ga0070697_100256436
568 Ga0070697_100816409
569 Ga0070686_100582033
570 Ga0070686_100638023
571 Ga0070695_100372386
572 Ga0070696_100030834
573 Ga0070696_100080916
574 Ga0070696_100373488
575 Ga0070693_100807061
576 Ga0070665_100001256
577 Ga0070665_100951864
578 Ga0070704_100186750
579 Ga0068855_100334969
580 Ga0070664_102125699
581 Ga0068854_100039848
582 Ga0068856_100203617
583 Ga0070702_100091192
584 Ga0070702_100219686
585 Ga0068864_102504119
586 Ga0081455_10025998
587 Ga0081455_10041666
588 Ga0081455_10152344
589 Ga0081538_10000020
590 Ga0081538_10000200
591 Ga0081538_10009529
592 Ga0081538_10010141
593 Ga0081538_10017344
594 Ga0081538_10029426
595 Ga0081540_1001396
596 Ga0081540_1018895
597 Ga0081539_10023505
598 Ga0070717_10148919
599 Ga0070717_10249856
600 Ga0070717_10678664
601 Ga0070717_10727690
602 Ga0075365_10133214
603 Ga0075363_100378394
604 Ga0075432_10025589
605 Ga0070715_10069014
606 Ga0070712_100177910
607 Ga0070712_100225794
608 Ga0070712_100455323
609 Ga0070712_100657966
610 Ga0070712_100944359
611 Ga0075362_10071413
612 Ga0075367_10084967
613 Ga0097621_101502747
614 Ga0068871_100445165
615 Ga0075428_100162344
616 Ga0075428_100390570
617 Ga0075430_100000896
618 Ga0075430_100291216
619 Ga0075430_101008607
620 Ga0075431_100050431
621 Ga0075431_100084917
622 Ga0075431_100456475
623 Ga0075433_11023573
624 Ga0075434_100287503
625 Ga0075434_100304240
626 Ga0075429_100211780
627 Ga0068865_100831119
628 Ga0111539_10471662
629 Ga0111539_10547510
630 Ga0105245_10064406
631 Ga0105245_10065556
632 Ga0105245_10077188
633 Ga0105245_10604893
634 Ga0105245_10629383
635 Ga0114129_10042509
636 Ga0114129_10440344
637 Ga0114129_10597704
638 Ga0114129_10803678
639 Ga0114129_11192054
640 Ga0114129_11451586
641 Ga0114129_12472858
642 Ga0105243_10664059
643 Ga0105241_10691814
644 Ga0105242_10082481
645 Ga0105242_10270779
646 Ga0105242_11352317
647 Ga0105248_10119439
648 Ga0105238_11959114
649 Ga0105238_12831979
650 Ga0105239_10039439
651 Ga0105239_10515750
652 Ga0105239_13487883
653 Ga0157373_10897691
654 Ga0157371_10242416
655 Ga0157371_10520377
656 Ga0157371_10911018
657 Ga0157370_10824995
658 Ga0157374_10151323
659 Ga0157378_10695679
660 Ga0157378_11187338
661 Ga0157372_10088718
662 Ga0157372_10361384
663 Ga0157375_10008139
664 Ga0163163_11157855
665 Ga0163163_12281519
666 Ga0157377_10333017
667 Ga0157376_10130747
668 Ga0163161_10035044
669 Ga0206350_10108729
670 Ga0213873_10071829
671 Ga0213874_10151685
672 Ga0213876_10013997
673 Ga0213876_10038318
674 Ga0207692_10165405
675 Ga0207699_10274147
676 Ga0207705_10346515
677 Ga0207684_10007664
678 Ga0207684_10695494
679 Ga0207684_10726774
680 Ga0207654_10746489
681 Ga0207707_10145390
682 Ga0207693_10002242
683 Ga0207693_10062055
684 Ga0207693_11423850
685 Ga0207663_10401719
686 Ga0207663_11453028
687 Ga0207660_10713245
688 Ga0207662_10136003
689 Ga0207652_10115420
690 Ga0207652_10836644
691 Ga0207646_10546773
692 Ga0207646_10725910
693 Ga0207681_11446577
694 Ga0207694_11844698
695 Ga0207650_10878948
696 Ga0207687_10018066
697 Ga0207687_10091884
698 Ga0207687_10278912
699 Ga0207687_11523262
700 Ga0207700_10170146
701 Ga0207664_10044458
702 Ga0207664_10191247
703 Ga0207664_10309597
704 Ga0207664_10762344
705 Ga0207664_11624518
706 Ga0207664_11714084
707 Ga0207690_10612720
708 Ga0207709_10802774
709 Ga0207651_10365204
710 Ga0207668_10329451
711 Ga0207668_10382161
712 Ga0207640_10564133
713 Ga0207640_10634943
714 Ga0207678_10121731
715 Ga0207708_10839161
716 Ga0207702_10374168
717 Ga0207702_11552334
718 Ga0207648_10752422
719 Ga0207683_10121547
720 Ga0207683_10460974
721 Ga0207428_10054361
722 Ga0207428_10831203
723 Ga0268266_10011210
724 Ga0268266_11823426
725 Ga0265319_1000079
726 Ga0265334_10038035
727 Ga0265318_10001862
728 Ga0265338_10352853
729 Ga0265338_10763969
730 Ga0265320_10005759
731 Ga0265325_10155381
732 Ga0265313_10125467
733 Ga0265314_10046444
734 Ga0307405_10606095
735 Ga0307405_10899484
736 Ga0307413_10221465
737 Ga0307410_10094657
738 Ga0307410_10295617
739 Ga0307406_10077496
740 Ga0307406_10154888
741 Ga0307406_10195344
742 Ga0307406_10765947
743 Ga0307407_10569323
744 Ga0307412_10060793
745 Ga0307412_10823119
746 Ga0307412_11298369
747 Ga0307409_100046467
748 Ga0307409_100641799
749 Ga0307416_100036841
750 Ga0307416_100213380
751 Ga0307416_100927283
752 Ga0307416_101937419
753 Ga0307416_103661567
754 Ga0307414_10249041
755 Ga0307414_10554454
756 Ga0307414_11660398
757 Ga0307411_10196905
758 Ga0307411_10337063
759 Ga0307411_10780828
760 Ga0307415_100057894
761 Ga0307415_100456342
762 Ga0307415_102596166
763 Ga0373926_0145107
764 Ga0373949_0118414
765 Ga0373939_0015919
766 Ga0373960_0021350
767 Ga0373943_0025094
768 Ga0373943_0476869
769 Ga0373942_0109128
770 Ga0373961_0010189
771 Ga0373931_0140869
772 Ga0373935_0277285
773 Ga0373927_0163236
774 Ga0373947_0015682
775 Ga0373925_0222382
776 Ga0395899_0009196
777 Ga0395899_0052151
778 Ga0395899_0429032
779 Ga0395900_0043824
780 Ga0395900_0049168
781 Ga0395900_1600443
782 Ga0395898_0013450
783 Ga0395898_0136104
784 Ga0395898_0357885
785 Ga0395898_0524855
786 Ga0395905_0007707
787 Ga0395905_0053064
788 Ga0395905_0305492
789 Ga0395905_0964010
790 Ga0436364_0324999
791 Ga0436364_0402335
792 Ga0436364_0452123
793 Ga0436364_1135557
794 Ga0395901_0063932
795 Ga0395901_0180437
796 Ga0395901_0564296
797 Ga0395901_0586415
798 Ga0395901_1084446
799 Ga0395901_1260965
800 Ga0436365_0322791
801 Ga0436365_0343902
802 Ga0436365_0626905
803 Ga0436365_0920074
804 Ga0436365_1168763
805 Ga0436365_1380658
806 Ga0436365_1634568
807 Ga0436360_0541500
808 Ga0436363_0622033
809 Ga0436363_0973645
810 Ga0436363_1612917
811 Ga0436362_0286633
812 Ga0436362_0317694
813 Ga0436362_0359120
814 Ga0436362_0586522
815 Ga0451789_1147762
816 Ga0451793_0320640
817 Ga0451795_1069486
818 Ga0451800_0043981
819 Ga0451800_0209431
820 Ga0451800_1021413
821 Ga0451802_0941993
822 Ga0451802_1233621
823 Ga0451802_1622299
824 Ga0451807_1067696
825 Ga0451835_0274349
826 Ga0451835_0948273
827 Ga0451839_0120851
828 Ga0451845_0849816
829 Ga0451847_0811894
830 Ga0451849_0346405
831 Ga0451849_1098845
832 Ga0451851_1149160
833 Ga0451855_0710545
834 Ga0451853_0483348
835 Ga0451853_1291017
836 Ga0439448_0016670
837 Ga0439464_0194898
838 Ga0439460_0231168
839 Ga0466972_0158172
840 Ga0453683_0490223
841 Ga0466965_0046920
842 Ga0466965_0282466
843 Ga0466966_0002641
844 Ga0466966_0091506
845 Ga0466966_0114460
846 Ga0466961_0228629
847 Ga0466963_0014324
848 Ga0466964_0196687
849 Ga0466971_0661972
850 Ga0466970_0027996
851 Ga0466957_0038827
852 Ga0466960_0186145
853 Ga0466960_0960220
854 Ga0466959_0020957
855 Ga0466959_0195494
856 Ga0466958_0000401
857 Ga0466967_0001515
858 Ga0466967_0068379
859 Ga0466967_0072567
860 Ga0466967_0143485
861 Ga0466967_1060982
862 Ga0466967_2110962
863 Ga0495592_0775832
864 Ga0495603_0031071
865 Ga0495641_0228530
866 Ga0495580_0050232
867 Ga0495605_0092626
868 Ga0495605_0367062
869 Ga0495584_0044326
870 Ga0495584_0050910
871 Ga0495584_0261975
872 Ga0495585_0145917
873 Ga0495596_0063990
874 Ga0495596_0112943
875 Ga0495596_0220732
876 Ga0495607_0146516
877 Ga0495620_0168084
878 Ga0495631_0182010
879 Ga0495631_0204657
880 Ga0495637_0206080
881 Ga0495644_0065318
882 Ga0495663_0014489
883 Ga0495666_0244010
884 Ga0495642_0128372
885 Ga0495587_0027873
886 Ga0495598_0065852
887 Ga0495609_0148743
888 Ga0495656_0004187
889 Ga0495656_0213250
890 Ga0495656_0495157
891 Ga0495659_0024238
892 Ga0495659_0285588
893 Ga0495661_0344880
894 Ga0495588_0275000
895 Ga0495599_0755861
896 Ga0495646_0520414
897 Ga0495658_0248561
898 Ga0495613_0142373
899 Ga0495624_0002990
900 Ga0495671_0063700
901 Ga0495589_0040565
902 Ga0495676_0036492
903 Ga0495676_0288341
904 Ga0495676_0594691
905 Ga0495683_0190190
906 Ga0495677_0440125
907 Ga0495685_120091
908 Ga0495626_0175295
909 Ga0496100_0106632
910 Ga0496100_0284139
911 Ga0496102_0499657
912 Ga0496102_1105697
913 Ga0496103_0334889
914 Ga0496105_0118871
915 Ga0496105_0130859
916 Ga0496107_0615791
917 Ga0496107_0852679
918 Ga0496108_0009239
919 Ga0496108_0563589
920 Ga0496109_0004612
921 Ga0496109_0198674
922 Ga0496109_0308373
923 Ga0496109_0309173
924 Ga0496109_0325660
925 Ga0496109_1227434
926 Ga0496110_0018146
927 Ga0496110_0035898
928 Ga0496110_0304249
929 Ga0496111_0004911
930 Ga0496111_0128644
931 Ga0496111_0152559
932 Ga0496112_0064715
933 Ga0496112_0278665
934 Ga0496112_0503011
935 Ga0496113_0134995
936 Ga0496113_0139296
937 Ga0496113_0155419
938 Ga0496113_0634964
939 Ga0496114_0350408
940 Ga0496115_0415797
941 Ga0501299_183397
942 Ga0501031_0411867
943 Ga0501031_0500510
944 Ga0501036_0291709
945 Ga0501036_0442663
946 Ga0501036_0990644
947 Ga0501036_1188693
948 Ga0501038_1197091
949 Ga0501039_0379326
950 Ga0501039_1005616
951 Ga0501040_0375913
952 Ga0501040_0457175
953 Ga0501040_0527741
954 Ga0501041_0750459
955 Ga0501041_0970592
956 Ga0501042_0325303
957 Ga0501042_0977387
958 Ga0501048_0691666
959 Ga0501067_0191131
960 Ga0501070_0434274
961 Ga0501075_0437667
962 Ga0501075_1299774
963 Ga0501076_0136659
964 Ga0501076_0524368
965 Ga0501076_1174914
966 Ga0501079_0261057
967 Ga0501080_0186252
968 Ga0501080_1132055
969 Ga0501045_0203742
970 nmdc:mga03n38_157547_c1
971 nmdc:mga03n38_326965_c1
972 nmdc:mga00v17_310998_c1
973 nmdc:mga00v17_540147_c1
974 nmdc:mga0yw44_227367_c1
975 nmdc:mga06z11_289919_c1
976 nmdc:mga05p37_312271_c1
977 nmdc:mga05p37_359829_c1
978 nmdc:mga05p37_533741_c1
979 nmdc:mga05p37_6826_c1
980 nmdc:mga09592_195445_c1
981 nmdc:mga09592_231015_c1
982 nmdc:mga09592_358724_c1
983 nmdc:mga09592_87510_c1
984 nmdc:mga0qj67_315806_c1
985 nmdc:mga0qj67_42548_c1
986 nmdc:mga06r32_120314_c1
987 nmdc:mga06r32_182375_c1
988 nmdc:mga06r32_567730_c1
989 nmdc:mga06r32_8783_c1
990 nmdc:mga08y16_1204359_c1
991 nmdc:mga08y16_195776_c1
992 nmdc:mga08y16_223942_c1
993 nmdc:mga08y16_9341_c1
994 nmdc:mga0n895_1102906_c1
995 nmdc:mga0n895_179971_c1
996 nmdc:mga0n895_279803_c1
997 nmdc:mga0rr50_1733022_c1
998 nmdc:mga0a205_1209755_c1
999 nmdc:mga0a205_925112_c1
1000 Ga0495655_0199196
1001 Ga0501084_0130515
1002 Ga0501084_1420772
1003 Ga0501084_1508797
1004 Ga0587073_0039229
1005 Ga0587080_139791
1006 Ga0501082_0407859
1007 Ga0501082_2006211
1008 Ga0466962_0021743
1009 Ga0530510_0231060
1010 Ga0530510_0248702
1011 Ga0530510_0500726
1012 Ga0530510_0875806

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02033

RBFA

Ribosome-binding factor A

5

108

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dyj-assembly1.cif.gz_A crystal structure of ribosome-binding factor a from thermus thermophilus hb8 0.9102 2 89
7nav-assembly1.cif.gz_V bacterial 30s ribosomal subunit assembly complex state d (consensus refinement) 0.9019 2 92
2dyj-assembly2.cif.gz_B crystal structure of ribosome-binding factor a from thermus thermophilus hb8 0.8998 2 88
8bxa-assembly1.cif.gz_A crystal structure of ribosome binding factor a (rbfa) from s. aureus 0.8972 3 93
2kzf-assembly1.cif.gz_A solution nmr structure of the thermotoga maritima protein tm0855 a putative ribosome binding factor a 0.8804 2 88
ID Description Score Start End Superfamily
af_P0A7G2_1_108_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9112 3 97 3.30.300.20
2dyjB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8998 2 88 3.30.300.20
af_Q2G2Q4_1_115_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8894 3 105 3.30.300.20
2kzfA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8804 2 88 3.30.300.20
af_Q4D6D1_94_193_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8614 2 90 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A538CTP3-F1-model_v4 30S ribosome-binding factor RbfA 0.9861 1 90 GO:0005829
GO:0006364
GO:0043024
AF-A0A538CTP3-F1-model_v4 30S ribosome-binding factor RbfA 0.9752 1 90 GO:0005829
GO:0006364
GO:0043024
AF-A0A6A0QXW2-F1-model_v4 Ribosome-binding factor A 0.9685 1 105 GO:0005829
GO:0030490
GO:0043024
AF-A0A7C4PRX7-F1-model_v4 Ribosome-binding factor A 0.9662 1 105 GO:0003676
GO:0005737
GO:0030490
AF-X0RQG6-F1-model_v4 Ribosome-binding factor A 0.9648 3 96 GO:0005829
GO:0006364
GO:0043024

Map