F456560

General Info

Members Datasets Scaffolds Average Seq Length
506 277 1012 157

Family's Representative Sequence

Representative Sequence 3300042156|Ga0439446_0066397|Ga0439446_0066397_479_943
Length 154
Sequence MAHAHKHFGAERVVKGEMPHTSADMNVTPLIDVLLVLLIIFMAALPLTQKGVDVNLPLETKSATQAVDPNQIVIDIAADRSISVNKQVIGIDALQEFLRTTFESRKEKTLFLIGDPTLRYAEIIAVIDAAKGAGVEKVGIVTEAMRRAAGAGTE

Samples

Sample ID Description Type Environment
1 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
2 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
157 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
158 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
159 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
160 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
161 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
162 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
165 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
166 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
167 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.56
Metatranscriptomes 13.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.35
Nodule 0
Rhizoplane 2.77
Rhizosphere 91.5
Stem 0
Stem Tuber 0
Unclassified 8.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439446_0066397 3300042156 Bacteria 1098
2 Ga0006765J45826_115157 3300003161 Bacteria 527
3 Ga0006759J45824_1018877 3300003163 Bacteria 1081
4 Ga0006777J48905_1045790 3300003308 Bacteria 1300
5 Ga0007417J51691_1055751 3300003544 Bacteria 1818
6 Ga0007410J51695_1022997 3300003574 Bacteria 1104
7 Ga0007410J51695_1044862 3300003574 Bacteria 543
8 Ga0007409J51694_1062237 3300003575 Bacteria 734
9 Ga0007416J51690_1013238 3300003577 Bacteria 2000
10 Ga0007429J51699_1065813 3300003579 Bacteria 1027
11 Ga0032354_1019356 3300003693 Bacteria 1959
12 Ga0058859_10139750 3300004798 Bacteria 965
13 Ga0058859_11766987 3300004798 Bacteria 1256
14 Ga0058861_11800814 3300004800 Bacteria 1367
15 Ga0058861_11949273 3300004800 Bacteria 1241
16 Ga0058860_10004545 3300004801 Bacteria 632
17 Ga0058860_10009161 3300004801 Bacteria 1839
18 Ga0058860_11835410 3300004801 Bacteria 900
19 Ga0058860_12141545 3300004801 Bacteria 1157
20 Ga0058862_12761160 3300004803 Bacteria 1389
21 Ga0058862_12880018 3300004803 Bacteria 2107
22 Ga0065704_10316299 3300005289 Bacteria 860
23 Ga0070676_10467544 3300005328 Bacteria 890
24 Ga0070690_100177389 3300005330 Bacteria 1470
25 Ga0070670_100135630 3300005331 Bacteria 2127
26 Ga0070670_100493965 3300005331 Bacteria 1088
27 Ga0068869_100053514 3300005334 Bacteria 2936
28 Ga0068869_101081584 3300005334 Bacteria 701
29 Ga0070666_10087294 3300005335 Bacteria 2138
30 Ga0070666_10151304 3300005335 Bacteria 1619
31 Ga0070666_10187504 3300005335 Bacteria 1452
32 Ga0070666_10490852 3300005335 Unclassified 890
33 Ga0070680_101592703 3300005336 Bacteria 566
34 Ga0070682_100229651 3300005337 Bacteria 1326
35 Ga0068868_100113892 3300005338 Bacteria 2200
36 Ga0068868_100929608 3300005338 Bacteria 792
37 Ga0068868_101067096 3300005338 Bacteria 742
38 Ga0070660_100673325 3300005339 Bacteria 867
39 Ga0070689_100130558 3300005340 Bacteria 2014
40 Ga0070689_100296667 3300005340 Bacteria 1345
41 Ga0070687_100023353 3300005343 Bacteria 2938
42 Ga0070687_100971039 3300005343 Bacteria 614
43 Ga0070661_100904281 3300005344 Bacteria 729
44 Ga0070692_10060111 3300005345 Bacteria 1999
45 Ga0070692_10337104 3300005345 Bacteria 933
46 Ga0070668_100472274 3300005347 Bacteria 1082
47 Ga0070669_100002989 3300005353 Bacteria 12187
48 Ga0070669_100049679 3300005353 Bacteria 3062
49 Ga0070669_100182245 3300005353 Unclassified 1643
50 Ga0070675_100438130 3300005354 Bacteria 1170
51 Ga0070675_100900479 3300005354 Unclassified 811
52 Ga0070671_100346511 3300005355 Bacteria 1268
53 Ga0070671_100605892 3300005355 Bacteria 947
54 Ga0070671_100617826 3300005355 Unclassified 937
55 Ga0070674_100005123 3300005356 Bacteria 7535
56 Ga0070674_100134805 3300005356 Bacteria 1846
57 Ga0070674_100151538 3300005356 Bacteria 1750
58 Ga0070674_100495310 3300005356 Bacteria 1017
59 Ga0070673_100234065 3300005364 Bacteria 1594
60 Ga0070673_101225236 3300005364 Bacteria 703
61 Ga0070688_100136796 3300005365 Bacteria 1660
62 Ga0070688_100254461 3300005365 Bacteria 1252
63 Ga0070659_100409564 3300005366 Bacteria 1145
64 Ga0070659_100908724 3300005366 Bacteria 770
65 Ga0070667_100069513 3300005367 Bacteria 2997
66 Ga0070667_100296183 3300005367 Bacteria 1456
67 Ga0070700_100176651 3300005441 Bacteria 1483
68 Ga0070708_100697429 3300005445 Bacteria 956
69 Ga0070678_101650071 3300005456 Bacteria 603
70 Ga0070662_100108497 3300005457 Bacteria 2111
71 Ga0070662_100259536 3300005457 Bacteria 1399
72 Ga0070681_10518656 3300005458 Bacteria 1105
73 Ga0070681_11762224 3300005458 Bacteria 546
74 Ga0070706_100522813 3300005467 Bacteria 1104
75 Ga0070707_100789675 3300005468 Bacteria 913
76 Ga0070707_100795036 3300005468 Bacteria 910
77 Ga0070698_100036863 3300005471 Bacteria 5046
78 Ga0070698_100448608 3300005471 Bacteria 1225
79 Ga0070698_101168304 3300005471 Bacteria 719
80 Ga0070698_101947775 3300005471 Bacteria 541
81 Ga0070699_100102708 3300005518 Bacteria 2507
82 Ga0070684_100028054 3300005535 Bacteria 4758
83 Ga0070697_100989212 3300005536 Bacteria 747
84 Ga0068853_100498095 3300005539 Bacteria 1150
85 Ga0070672_100104669 3300005543 Bacteria 2299
86 Ga0070672_101604507 3300005543 Bacteria 584
87 Ga0070686_100012299 3300005544 Bacteria 4869
88 Ga0070686_100232344 3300005544 Bacteria 1338
89 Ga0070696_100204202 3300005546 Bacteria 1476
90 Ga0070693_100181866 3300005547 Bacteria 1354
91 Ga0070665_100074367 3300005548 Bacteria 3403
92 Ga0070704_100201256 3300005549 Unclassified 1608
93 Ga0068855_100545450 3300005563 Unclassified 1256
94 Ga0070664_100913826 3300005564 Bacteria 823
95 Ga0068854_100029698 3300005578 Bacteria 3786
96 Ga0068852_100608404 3300005616 Bacteria 1098
97 Ga0068852_101376253 3300005616 Bacteria 728
98 Ga0068859_100611538 3300005617 Bacteria 1183
99 Ga0068859_100614700 3300005617 Bacteria 1179
100 Ga0068859_101647584 3300005617 Bacteria 709
101 Ga0068864_100078642 3300005618 Bacteria 2887
102 Ga0068866_10077708 3300005718 Bacteria 1773
103 Ga0068866_10133412 3300005718 Bacteria 1416
104 Ga0068861_100106417 3300005719 Unclassified 2241
105 Ga0068861_100152993 3300005719 Bacteria 1895
106 Ga0068861_100921679 3300005719 Bacteria 829
107 Ga0068870_10022372 3300005840 Bacteria 3106
108 Ga0068863_100016899 3300005841 Bacteria 6998
109 Ga0068858_100065796 3300005842 Bacteria 3355
110 Ga0068858_100791726 3300005842 Bacteria 925
111 Ga0068860_100064236 3300005843 Bacteria 3487
112 Ga0068860_100105308 3300005843 Bacteria 2694
113 Ga0068860_100242444 3300005843 Bacteria 1753
114 Ga0068860_100573930 3300005843 Bacteria 1132
115 Ga0068862_100011268 3300005844 Bacteria 7382
116 Ga0068862_100236380 3300005844 Bacteria 1659
117 Ga0075365_10104124 3300006038 Bacteria 1946
118 Ga0075365_10197697 3300006038 Bacteria 1408
119 Ga0075368_10004153 3300006042 Bacteria 4880
120 Ga0075364_10023349 3300006051 Bacteria 3916
121 Ga0075364_10027945 3300006051 Bacteria 3607
122 Ga0075364_10080834 3300006051 Bacteria 2148
123 Ga0075362_10002425 3300006177 Bacteria 6257
124 Ga0075367_10170313 3300006178 Bacteria 1356
125 Ga0075366_10024175 3300006195 Bacteria 3544
126 Ga0075366_10034537 3300006195 Bacteria 2978
127 Ga0097621_100029261 3300006237 Bacteria 4349
128 Ga0097621_100193907 3300006237 Bacteria 1761
129 Ga0097621_100365075 3300006237 Bacteria 1287
130 Ga0075370_10011191 3300006353 Bacteria 4710
131 Ga0068871_100096303 3300006358 Bacteria 2472
132 Ga0068871_100207272 3300006358 Bacteria 1695
133 Ga0068871_100479302 3300006358 Bacteria 1119
134 Ga0068871_100804007 3300006358 Bacteria 867
135 Ga0068871_101128170 3300006358 Bacteria 734
136 Ga0075428_100254997 3300006844 Bacteria 1890
137 Ga0075433_10042200 3300006852 Bacteria 3957
138 Ga0075433_10102024 3300006852 Bacteria 2540
139 Ga0075433_10269006 3300006852 Bacteria 1510
140 Ga0075433_11081352 3300006852 Unclassified 698
141 Ga0075434_100001358 3300006871 Bacteria 20536
142 Ga0075434_100001737 3300006871 Bacteria 18704
143 Ga0075434_100126849 3300006871 Bacteria 2569
144 Ga0075434_100191175 3300006871 Bacteria 2067
145 Ga0075429_101426993 3300006880 Bacteria 603
146 Ga0075436_100068008 3300006914 Bacteria 2461
147 Ga0075436_100207064 3300006914 Bacteria 1390
148 Ga0075436_100486569 3300006914 Unclassified 901
149 Ga0097620_100614686 3300006931 Bacteria 1179
150 Ga0097620_101647640 3300006931 Bacteria 709
151 Ga0075435_100002501 3300007076 Bacteria 12223
152 Ga0075435_100015933 3300007076 Bacteria 5660
153 Ga0075435_100026242 3300007076 Bacteria 4543
154 Ga0075435_100264612 3300007076 Bacteria 1466
155 Ga0075435_100357125 3300007076 Bacteria 1253
156 Ga0105251_10286430 3300009011 Unclassified 745
157 Ga0111539_10092467 3300009094 Bacteria 3555
158 Ga0111539_10596190 3300009094 Unclassified 1287
159 Ga0111539_10617278 3300009094 Bacteria 1263
160 Ga0111539_11178539 3300009094 Bacteria 890
161 Ga0111539_11231718 3300009094 Unclassified 869
162 Ga0105245_10480029 3300009098 Bacteria 1256
163 Ga0105247_10007823 3300009101 Bacteria 6542
164 Ga0105247_10016909 3300009101 Bacteria 4374
165 Ga0105247_10573848 3300009101 Bacteria 833
166 Ga0114129_10018856 3300009147 Bacteria 9828
167 Ga0114129_10342488 3300009147 Bacteria 1982
168 Ga0114129_10371868 3300009147 Bacteria 1889
169 Ga0114129_10416419 3300009147 Bacteria 1768
170 Ga0105243_10056836 3300009148 Bacteria 3114
171 Ga0105241_10994991 3300009174 Bacteria 784
172 Ga0105242_10529382 3300009176 Bacteria 1126
173 Ga0105242_10704386 3300009176 Bacteria 988
174 Ga0105242_10709463 3300009176 Bacteria 985
175 Ga0105242_10830749 3300009176 Bacteria 917
176 Ga0105242_11075303 3300009176 Bacteria 817
177 Ga0105242_11789485 3300009176 Bacteria 652
178 Ga0105248_10005069 3300009177 Bacteria 14544
179 Ga0105248_10266037 3300009177 Bacteria 1930
180 Ga0105248_10319934 3300009177 Bacteria 1747
181 Ga0105248_10375107 3300009177 Bacteria 1601
182 Ga0105248_10497773 3300009177 Unclassified 1374
183 Ga0105248_10553502 3300009177 Bacteria 1298
184 Ga0105248_11803223 3300009177 Bacteria 694
185 Ga0105248_12104211 3300009177 Bacteria 642
186 Ga0105238_10382931 3300009551 Bacteria 1398
187 Ga0105238_11331927 3300009551 Bacteria 744
188 Ga0105249_10654729 3300009553 Bacteria 1108
189 Ga0105246_10882867 3300011119 Archaea 800
190 Ga0157374_12435866 3300013296 Bacteria 551
191 Ga0163162_10011041 3300013306 Bacteria 8800
192 Ga0163162_10432928 3300013306 Bacteria 1447
193 Ga0163162_11003514 3300013306 Bacteria 944
194 Ga0157372_11603903 3300013307 Bacteria 749
195 Ga0157375_10434007 3300013308 Bacteria 1479
196 Ga0157375_10797944 3300013308 Bacteria 1093
197 Ga0163163_10133916 3300014325 Bacteria 2518
198 Ga0163163_10396081 3300014325 Bacteria 1439
199 Ga0163163_10399302 3300014325 Bacteria 1433
200 Ga0157380_10198086 3300014326 Bacteria 1779
201 Ga0157380_10342964 3300014326 Bacteria 1394
202 Ga0157377_10117283 3300014745 Bacteria 1609
203 Ga0157379_10005965 3300014968 Bacteria 10501
204 Ga0157379_10063891 3300014968 Bacteria 3290
205 Ga0157379_10131737 3300014968 Bacteria 2251
206 Ga0157376_10929865 3300014969 Unclassified 889
207 Ga0157376_11495448 3300014969 Bacteria 708
208 Ga0182007_10100109 3300015262 Bacteria 959
209 Ga0163161_10725778 3300017792 Bacteria 829
210 Ga0206356_11370603 3300020070 Bacteria 620
211 Ga0206356_11432270 3300020070 Bacteria 1063
212 Ga0207697_10198695 3300025315 Bacteria 882
213 Ga0207710_10138900 3300025900 Bacteria 1172
214 Ga0207688_10268973 3300025901 Bacteria 1036
215 Ga0207680_10278774 3300025903 Bacteria 1161
216 Ga0207645_10274621 3300025907 Bacteria 1118
217 Ga0207645_10810961 3300025907 Bacteria 636
218 Ga0207643_10027534 3300025908 Bacteria 3151
219 Ga0207684_10569620 3300025910 Bacteria 968
220 Ga0207684_10825163 3300025910 Bacteria 783
221 Ga0207707_10476841 3300025912 Bacteria 1066
222 Ga0207695_10215189 3300025913 Unclassified 1831
223 Ga0207693_11053049 3300025915 Unclassified 619
224 Ga0207662_10011646 3300025918 Bacteria 4885
225 Ga0207662_10313673 3300025918 Bacteria 1045
226 Ga0207646_10059862 3300025922 Bacteria 3401
227 Ga0207646_10950146 3300025922 Unclassified 761
228 Ga0207681_10015878 3300025923 Bacteria 4700
229 Ga0207681_10020093 3300025923 Bacteria 4228
230 Ga0207681_10045177 3300025923 Bacteria 2956
231 Ga0207650_10107865 3300025925 Bacteria 2152
232 Ga0207650_11331523 3300025925 Bacteria 611
233 Ga0207659_10106102 3300025926 Bacteria 2127
234 Ga0207659_11148535 3300025926 Unclassified 668
235 Ga0207659_11621423 3300025926 Bacteria 552
236 Ga0207687_10718954 3300025927 Bacteria 848
237 Ga0207687_11310601 3300025927 Bacteria 622
238 Ga0207644_10004183 3300025931 Bacteria 9365
239 Ga0207644_10483852 3300025931 Bacteria 1020
240 Ga0207644_10512471 3300025931 Bacteria 990
241 Ga0207690_10037604 3300025932 Bacteria 3144
242 Ga0207706_10135407 3300025933 Bacteria 2167
243 Ga0207706_10280677 3300025933 Bacteria 1453
244 Ga0207706_10292007 3300025933 Bacteria 1421
245 Ga0207686_10414421 3300025934 Bacteria 1029
246 Ga0207709_10056123 3300025935 Bacteria 2436
247 Ga0207709_11516242 3300025935 Unclassified 556
248 Ga0207669_10282742 3300025937 Bacteria 1252
249 Ga0207669_10427583 3300025937 Bacteria 1044
250 Ga0207669_10931947 3300025937 Bacteria 727
251 Ga0207704_10392061 3300025938 Bacteria 1093
252 Ga0207665_10075551 3300025939 Bacteria 2308
253 Ga0207691_10068111 3300025940 Bacteria 3216
254 Ga0207691_10092084 3300025940 Bacteria 2715
255 Ga0207691_10224340 3300025940 Bacteria 1629
256 Ga0207691_10634005 3300025940 Bacteria 904
257 Ga0207691_11206182 3300025940 Bacteria 627
258 Ga0207711_10006661 3300025941 Bacteria 9723
259 Ga0207711_10223793 3300025941 Bacteria 1722
260 Ga0207711_10231152 3300025941 Bacteria 1694
261 Ga0207711_10295705 3300025941 Bacteria 1493
262 Ga0207689_10095459 3300025942 Bacteria 2442
263 Ga0207661_10221224 3300025944 Bacteria 1673
264 Ga0207651_10153392 3300025960 Bacteria 1796
265 Ga0207651_10581569 3300025960 Bacteria 977
266 Ga0207712_10048619 3300025961 Bacteria 2951
267 Ga0207712_10562738 3300025961 Bacteria 982
268 Ga0207712_11861339 3300025961 Unclassified 539
269 Ga0207668_12044138 3300025972 Bacteria 516
270 Ga0207640_10012925 3300025981 Bacteria 4770
271 Ga0207640_10053128 3300025981 Bacteria 2643
272 Ga0207677_10124296 3300026023 Bacteria 1947
273 Ga0207677_10820212 3300026023 Bacteria 834
274 Ga0207703_10012192 3300026035 Bacteria 6702
275 Ga0207639_10105071 3300026041 Unclassified 2290
276 Ga0207639_10343055 3300026041 Bacteria 1332
277 Ga0207639_10488645 3300026041 Bacteria 1123
278 Ga0207708_10169752 3300026075 Bacteria 1727
279 Ga0207641_10002105 3300026088 Bacteria 18816
280 Ga0207676_11156793 3300026095 Bacteria 766
281 Ga0207675_100034095 3300026118 Bacteria 4744
282 Ga0207675_100065358 3300026118 Bacteria 3400
283 Ga0207675_100071486 3300026118 Bacteria 3244
284 Ga0207675_100372747 3300026118 Bacteria 1402
285 Ga0207675_100519391 3300026118 Bacteria 1187
286 Ga0207675_101092780 3300026118 Bacteria 817
287 Ga0207683_10632864 3300026121 Bacteria 991
288 Ga0207683_10743153 3300026121 Bacteria 910
289 Ga0207683_11309023 3300026121 Unclassified 671
290 Ga0207698_10369945 3300026142 Bacteria 1360
291 Ga0209813_10045749 3300027866 Bacteria 1349
292 Ga0207428_10008027 3300027907 Bacteria 9579
293 Ga0268266_10072243 3300028379 Bacteria 2992
294 Ga0268265_10004086 3300028380 Bacteria 10255
295 Ga0268265_10363538 3300028380 Bacteria 1325
296 Ga0268265_11209754 3300028380 Bacteria 753
297 Ga0268265_11655962 3300028380 Bacteria 645
298 Ga0268264_10104137 3300028381 Bacteria 2473
299 Ga0268264_10142502 3300028381 Bacteria 2139
300 Ga0268264_10492803 3300028381 Bacteria 1194
301 Ga0268264_10532157 3300028381 Bacteria 1150
302 Ga0268264_10928842 3300028381 Bacteria 874
303 Ga0307408_100899063 3300031548 Bacteria 810
304 Ga0373930_0014282 3300034816 Bacteria 1476
305 Ga0373948_0001910 3300034817 Bacteria 2988
306 Ga0373958_0002174 3300034819 Bacteria 2718
307 Ga0373959_0002901 3300034820 Bacteria 2719
308 Ga0373938_0023726 3300034957 Bacteria 1263
309 Ga0373928_0001584 3300035084 Bacteria 4410
310 Ga0373929_0001310 3300035085 Bacteria 4796
311 Ga0373940_0004300 3300035088 Bacteria 3001
312 Ga0373951_0009649 3300035091 Bacteria 2169
313 Ga0373952_0003164 3300035092 Bacteria 2963
314 Ga0373932_0001227 3300035112 Bacteria 7276
315 Ga0373939_0000417 3300035114 Bacteria 10668
316 Ga0373941_0001684 3300035115 Bacteria 4734
317 Ga0373941_0267586 3300035115 Bacteria 672
318 Ga0373960_0000383 3300035121 Bacteria 8599
319 Ga0373960_0097218 3300035121 Bacteria 950
320 Ga0373942_0000206 3300035207 Bacteria 15248
321 Ga0373961_0000423 3300035241 Bacteria 17501
322 Ga0373962_0002541 3300035242 Bacteria 4327
323 Ga0373931_0002559 3300035691 Bacteria 8092
324 Ga0373931_1095890 3300035691 Bacteria 542
325 Ga0373937_0395122 3300036401 Bacteria 1312
326 Ga0451807_0738835 3300041486 Bacteria 698
327 Ga0451853_0536332 3300041512 Bacteria 958
328 Ga0439458_0093278 3300042157 Bacteria 777
329 Ga0466964_0390296 3300044706 Bacteria 725
330 Ga0466960_0836910 3300044901 Viruses 559
331 Ga0451576_0039489 3300045051 Bacteria 4995
332 Ga0451576_0123050 3300045051 Bacteria 2702
333 Ga0466967_0381804 3300045976 Bacteria 1368
334 Ga0495586_0149511 3300046535 Bacteria 1314
335 Ga0495587_0353240 3300046536 Bacteria 819
336 Ga0495621_0369545 3300046539 Bacteria 604
337 Ga0495621_0467165 3300046539 Bacteria 542
338 Ga0495645_0287498 3300046543 Bacteria 1079
339 Ga0495599_0236292 3300046678 Bacteria 1115
340 Ga0495669_0110719 3300046684 Bacteria 1282
341 Ga0495613_0073667 3300046689 Bacteria 2488
342 Ga0495674_0826422 3300047319 Unclassified 719
343 Ga0496101_0480721 3300048904 Bacteria 981
344 Ga0496102_0039911 3300048905 Bacteria 4244
345 Ga0496102_0752408 3300048905 Bacteria 897
346 Ga0496106_0170424 3300048909 Bacteria 1725
347 Ga0496106_0228470 3300048909 Bacteria 1485
348 Ga0496106_0242937 3300048909 Bacteria 1439
349 Ga0496107_0168851 3300048910 Bacteria 1623
350 Ga0496108_1373898 3300048911 Bacteria 592
351 Ga0496109_0110058 3300048912 Bacteria 2561
352 Ga0496109_0644652 3300048912 Bacteria 996
353 Ga0496112_0476487 3300048915 Bacteria 1185
354 Ga0496112_1683343 3300048915 Bacteria 547
355 Ga0496114_0785201 3300048917 Bacteria 831
356 Ga0501031_0018465 3300049568 Bacteria 4538
357 Ga0501032_0326682 3300049569 Bacteria 989
358 Ga0501033_0361562 3300049570 Bacteria 1015
359 Ga0501034_0038697 3300049571 Bacteria 4830
360 Ga0501034_0053105 3300049571 Bacteria 4082
361 Ga0501036_0014412 3300049572 Bacteria 6583
362 Ga0501036_0015981 3300049572 Bacteria 6269
363 Ga0501036_0121200 3300049572 Bacteria 2208
364 Ga0501037_0005124 3300049573 Bacteria 9531
365 Ga0501037_0030014 3300049573 Bacteria 4016
366 Ga0501038_0018205 3300049574 Bacteria 6341
367 Ga0501039_0017411 3300049575 Bacteria 5511
368 Ga0501039_0070800 3300049575 Bacteria 2709
369 Ga0501042_0370768 3300049578 Bacteria 1036
370 Ga0501042_0512074 3300049578 Bacteria 871
371 Ga0501043_0004740 3300049579 Bacteria 11028
372 Ga0501043_0298889 3300049579 Bacteria 1230
373 Ga0501046_0004293 3300049580 Bacteria 12971
374 Ga0501047_0002315 3300049581 Bacteria 18217
375 Ga0501047_0024979 3300049581 Bacteria 5739
376 Ga0501047_0090444 3300049581 Bacteria 2937
377 Ga0501048_0019666 3300049582 Bacteria 4953
378 Ga0501067_0719118 3300049583 Bacteria 562
379 Ga0501067_0781867 3300049583 Bacteria 537
380 Ga0501068_0009256 3300049584 Bacteria 5505
381 Ga0501068_0297671 3300049584 Bacteria 1032
382 Ga0501069_0506349 3300049585 Bacteria 720
383 Ga0501070_0012204 3300049586 Bacteria 7250
384 Ga0501070_0245696 3300049586 Bacteria 1464
385 Ga0501071_0629074 3300049587 Bacteria 825
386 Ga0501071_0774719 3300049587 Bacteria 739
387 Ga0501071_0862300 3300049587 Bacteria 698
388 Ga0501072_0239334 3300049588 Bacteria 1445
389 Ga0501073_0365504 3300049589 Bacteria 996
390 Ga0501073_0521736 3300049589 Bacteria 821
391 Ga0501074_0002059 3300049590 Bacteria 13895
392 Ga0501074_0005866 3300049590 Bacteria 8859
393 Ga0501074_0028403 3300049590 Bacteria 4054
394 Ga0501075_0521046 3300049591 Bacteria 907
395 Ga0501075_0721062 3300049591 Bacteria 759
396 Ga0501076_0386752 3300049592 Bacteria 1150
397 Ga0501077_0223362 3300049593 Bacteria 1197
398 Ga0501206_086068 3300049653 Bacteria 552
399 Ga0501079_0156981 3300049741 Bacteria 1773
400 Ga0501079_0234137 3300049741 Bacteria 1435
401 Ga0501080_0019621 3300049742 Bacteria 6262
402 Ga0501080_0023685 3300049742 Bacteria 5688
403 Ga0501080_0567463 3300049742 Bacteria 1010
404 Ga0501083_0016610 3300049744 Bacteria 5146
405 Ga0501083_0503320 3300049744 Bacteria 788
406 Ga0501083_0735980 3300049744 Bacteria 641
407 Ga0501083_0963020 3300049744 Bacteria 555
408 Ga0501035_0069014 3300049822 Bacteria 3133
409 Ga0501035_0251510 3300049822 Bacteria 1500
410 Ga0501044_0749923 3300049823 Bacteria 858
411 Ga0501045_0323600 3300049824 Bacteria 1147
412 Ga0501045_0568394 3300049824 Bacteria 840
413 Ga0501045_0582141 3300049824 Bacteria 829
414 nmdc:mga03683_8984_c1 3300050489 Bacteria 3536
415 nmdc:mga00v17_784_c1 3300050491 Bacteria 17281
416 nmdc:mga0yw44_61875_c1 3300050492 Bacteria 2298
417 nmdc:mga0yw44_91884_c1 3300050492 Bacteria 1920
418 nmdc:mga0k408_18415_c1 3300050493 Bacteria 3900
419 nmdc:mga0k408_72964_c1 3300050493 Bacteria 2005
420 nmdc:mga06z11_122612_c1 3300050494 Bacteria 1452
421 nmdc:mga06z11_41619_c1 3300050494 Bacteria 2300
422 nmdc:mga07m45_2193_c1 3300050496 Bacteria 9109
423 nmdc:mga05p37_106008_c1 3300050507 Bacteria 3457
424 nmdc:mga05p37_19613_c1 3300050507 Bacteria 8178
425 nmdc:mga05p37_33089_c1 3300050507 Bacteria 6332
426 nmdc:mga05p37_446635_c1 3300050507 Bacteria 1498
427 nmdc:mga05p37_96584_c1 3300050507 Bacteria 3640
428 nmdc:mga08y16_720789_c1 3300050511 Bacteria 995
429 nmdc:mga08y16_97676_c1 3300050511 Bacteria 3059
430 nmdc:mga0n895_1017843_c1 3300050512 Bacteria 809
431 nmdc:mga0n895_10522_c1 3300050512 Bacteria 8181
432 nmdc:mga0n895_1162629_c1 3300050512 Bacteria 747
433 nmdc:mga0n895_235457_c1 3300050512 Bacteria 1858
434 nmdc:mga0n895_369300_c1 3300050512 Bacteria 1453
435 nmdc:mga0n895_60819_c1 3300050512 Bacteria 3728
436 nmdc:mga0n895_875077_c1 3300050512 Bacteria 885
437 nmdc:mga0rr50_109364_c1 3300050513 Bacteria 2185
438 nmdc:mga0rr50_119495_c2 3300050513 Bacteria 569
439 nmdc:mga0rr50_160125_c1 3300050513 Bacteria 1826
440 nmdc:mga0rr50_230057_c1 3300050513 Bacteria 1534
441 nmdc:mga0rr50_689426_c1 3300050513 Bacteria 872
442 nmdc:mga0rr50_69851_c1 3300050513 Bacteria 2675
443 nmdc:mga08x19_20081_c1 3300050514 Bacteria 4112
444 nmdc:mga08x19_227896_c1 3300050514 Bacteria 1282
445 nmdc:mga0a205_1166804_c1 3300050515 Unclassified 618
446 nmdc:mga0a205_340466_c1 3300050515 Bacteria 1368
447 nmdc:mga0a205_43427_c1 3300050515 Bacteria 4334
448 nmdc:mga0a205_51689_c1 3300050515 Bacteria 3967
449 nmdc:mga0a205_6877_c1 3300050515 Bacteria 10288
450 nmdc:mga0a205_885180_c1 3300050515 Bacteria 740
451 nmdc:mga0a205_975992_c1 3300050515 Bacteria 694
452 nmdc:mga0sz30_86663_c1 3300050516 Bacteria 1359
453 Ga0495619_0589439 3300053085 Bacteria 761
454 Ga0501084_0036090 3300054114 Bacteria 4130
455 Ga0501084_0494590 3300054114 Bacteria 1033
456 Ga0590071_005863 3300059421 Bacteria 2945
457 Ga0587093_095390 3300059478 Unclassified 531
458 Ga0587066_022279 3300059490 Bacteria 1058
459 Ga0587070_057413 3300059491 Unclassified 795
460 Ga0587070_057570 3300059491 Unclassified 794
461 Ga0587070_146108 3300059491 Bacteria 589
462 Ga0587073_0090714 3300059492 Unclassified 777
463 Ga0587077_019964 3300059493 Bacteria 1172
464 Ga0587080_005540 3300059503 Bacteria 1701
465 Ga0587082_008113 3300059504 Bacteria 1455
466 Ga0587082_028990 3300059504 Bacteria 953
467 Ga0587082_158303 3300059504 Bacteria 541
468 Ga0587083_0006335 3300059505 Bacteria 1759
469 Ga0587085_030348 3300059506 Bacteria 885
470 Ga0587086_034410 3300059507 Unclassified 760
471 Ga0587088_005179 3300059508 Bacteria 1699
472 Ga0587091_009707 3300059511 Bacteria 1457
473 Ga0587092_117583 3300059512 Unclassified 565
474 Ga0587094_042277 3300059513 Unclassified 746
475 Ga0587094_065352 3300059513 Bacteria 645
476 Ga0587106_039833 3300059605 Unclassified 793
477 Ga0587113_016626 3300059625 Unclassified 740
478 Ga0587115_029391 3300059626 Bacteria 809
479 Ga0587117_012894 3300059627 Bacteria 1061
480 Ga0587062_006883 3300059639 Bacteria 1307
481 Ga0587062_049410 3300059639 Bacteria 708
482 Ga0587062_086785 3300059639 Unclassified 590
483 Ga0587067_023463 3300059640 Bacteria 1082
484 Ga0587067_065933 3300059640 Unclassified 770
485 Ga0587068_041737 3300059641 Unclassified 832
486 Ga0587068_042048 3300059641 Bacteria 830
487 Ga0587068_123461 3300059641 Bacteria 564
488 Ga0587069_044116 3300059642 Unclassified 771
489 Ga0587072_054152 3300059643 Unclassified 811
490 Ga0587072_081904 3300059643 Bacteria 699
491 Ga0587075_035344 3300059644 Bacteria 815
492 Ga0587075_040743 3300059644 Unclassified 777
493 Ga0587076_022340 3300059645 Unclassified 1056
494 Ga0587079_029188 3300059647 Bacteria 1049
495 Ga0587079_079451 3300059647 Bacteria 747
496 Ga0587079_108011 3300059647 Bacteria 673
497 Ga0587107_014658 3300059652 Bacteria 1011
498 Ga0587114_027564 3300059655 Unclassified 847
499 Ga0587119_027183 3300059658 Unclassified 763
500 Ga0587071_021901 3300060344 Unclassified 1176
501 Ga0587111_0023436 3300060346 Bacteria 1207
502 Ga0587111_0153267 3300060346 Bacteria 621
503 Ga0501082_0100809 3300060353 Bacteria 2497
504 Ga0501082_0416230 3300060353 Bacteria 1173
505 Ga0501082_0507223 3300060353 Bacteria 1054
506 Ga0530510_0905284 3300061734 Bacteria 674
507 Ga0439446_0066397
508 Ga0006765J45826_115157
509 Ga0006759J45824_1018877
510 Ga0006777J48905_1045790
511 Ga0007417J51691_1055751
512 Ga0007410J51695_1022997
513 Ga0007410J51695_1044862
514 Ga0007409J51694_1062237
515 Ga0007416J51690_1013238
516 Ga0007429J51699_1065813
517 Ga0032354_1019356
518 Ga0058859_10139750
519 Ga0058859_11766987
520 Ga0058861_11800814
521 Ga0058861_11949273
522 Ga0058860_10004545
523 Ga0058860_10009161
524 Ga0058860_11835410
525 Ga0058860_12141545
526 Ga0058862_12761160
527 Ga0058862_12880018
528 Ga0065704_10316299
529 Ga0070676_10467544
530 Ga0070690_100177389
531 Ga0070670_100135630
532 Ga0070670_100493965
533 Ga0068869_100053514
534 Ga0068869_101081584
535 Ga0070666_10087294
536 Ga0070666_10151304
537 Ga0070666_10187504
538 Ga0070666_10490852
539 Ga0070680_101592703
540 Ga0070682_100229651
541 Ga0068868_100113892
542 Ga0068868_100929608
543 Ga0068868_101067096
544 Ga0070660_100673325
545 Ga0070689_100130558
546 Ga0070689_100296667
547 Ga0070687_100023353
548 Ga0070687_100971039
549 Ga0070661_100904281
550 Ga0070692_10060111
551 Ga0070692_10337104
552 Ga0070668_100472274
553 Ga0070669_100002989
554 Ga0070669_100049679
555 Ga0070669_100182245
556 Ga0070675_100438130
557 Ga0070675_100900479
558 Ga0070671_100346511
559 Ga0070671_100605892
560 Ga0070671_100617826
561 Ga0070674_100005123
562 Ga0070674_100134805
563 Ga0070674_100151538
564 Ga0070674_100495310
565 Ga0070673_100234065
566 Ga0070673_101225236
567 Ga0070688_100136796
568 Ga0070688_100254461
569 Ga0070659_100409564
570 Ga0070659_100908724
571 Ga0070667_100069513
572 Ga0070667_100296183
573 Ga0070700_100176651
574 Ga0070708_100697429
575 Ga0070678_101650071
576 Ga0070662_100108497
577 Ga0070662_100259536
578 Ga0070681_10518656
579 Ga0070681_11762224
580 Ga0070706_100522813
581 Ga0070707_100789675
582 Ga0070707_100795036
583 Ga0070698_100036863
584 Ga0070698_100448608
585 Ga0070698_101168304
586 Ga0070698_101947775
587 Ga0070699_100102708
588 Ga0070684_100028054
589 Ga0070697_100989212
590 Ga0068853_100498095
591 Ga0070672_100104669
592 Ga0070672_101604507
593 Ga0070686_100012299
594 Ga0070686_100232344
595 Ga0070696_100204202
596 Ga0070693_100181866
597 Ga0070665_100074367
598 Ga0070704_100201256
599 Ga0068855_100545450
600 Ga0070664_100913826
601 Ga0068854_100029698
602 Ga0068852_100608404
603 Ga0068852_101376253
604 Ga0068859_100611538
605 Ga0068859_100614700
606 Ga0068859_101647584
607 Ga0068864_100078642
608 Ga0068866_10077708
609 Ga0068866_10133412
610 Ga0068861_100106417
611 Ga0068861_100152993
612 Ga0068861_100921679
613 Ga0068870_10022372
614 Ga0068863_100016899
615 Ga0068858_100065796
616 Ga0068858_100791726
617 Ga0068860_100064236
618 Ga0068860_100105308
619 Ga0068860_100242444
620 Ga0068860_100573930
621 Ga0068862_100011268
622 Ga0068862_100236380
623 Ga0075365_10104124
624 Ga0075365_10197697
625 Ga0075368_10004153
626 Ga0075364_10023349
627 Ga0075364_10027945
628 Ga0075364_10080834
629 Ga0075362_10002425
630 Ga0075367_10170313
631 Ga0075366_10024175
632 Ga0075366_10034537
633 Ga0097621_100029261
634 Ga0097621_100193907
635 Ga0097621_100365075
636 Ga0075370_10011191
637 Ga0068871_100096303
638 Ga0068871_100207272
639 Ga0068871_100479302
640 Ga0068871_100804007
641 Ga0068871_101128170
642 Ga0075428_100254997
643 Ga0075433_10042200
644 Ga0075433_10102024
645 Ga0075433_10269006
646 Ga0075433_11081352
647 Ga0075434_100001358
648 Ga0075434_100001737
649 Ga0075434_100126849
650 Ga0075434_100191175
651 Ga0075429_101426993
652 Ga0075436_100068008
653 Ga0075436_100207064
654 Ga0075436_100486569
655 Ga0097620_100614686
656 Ga0097620_101647640
657 Ga0075435_100002501
658 Ga0075435_100015933
659 Ga0075435_100026242
660 Ga0075435_100264612
661 Ga0075435_100357125
662 Ga0105251_10286430
663 Ga0111539_10092467
664 Ga0111539_10596190
665 Ga0111539_10617278
666 Ga0111539_11178539
667 Ga0111539_11231718
668 Ga0105245_10480029
669 Ga0105247_10007823
670 Ga0105247_10016909
671 Ga0105247_10573848
672 Ga0114129_10018856
673 Ga0114129_10342488
674 Ga0114129_10371868
675 Ga0114129_10416419
676 Ga0105243_10056836
677 Ga0105241_10994991
678 Ga0105242_10529382
679 Ga0105242_10704386
680 Ga0105242_10709463
681 Ga0105242_10830749
682 Ga0105242_11075303
683 Ga0105242_11789485
684 Ga0105248_10005069
685 Ga0105248_10266037
686 Ga0105248_10319934
687 Ga0105248_10375107
688 Ga0105248_10497773
689 Ga0105248_10553502
690 Ga0105248_11803223
691 Ga0105248_12104211
692 Ga0105238_10382931
693 Ga0105238_11331927
694 Ga0105249_10654729
695 Ga0105246_10882867
696 Ga0157374_12435866
697 Ga0163162_10011041
698 Ga0163162_10432928
699 Ga0163162_11003514
700 Ga0157372_11603903
701 Ga0157375_10434007
702 Ga0157375_10797944
703 Ga0163163_10133916
704 Ga0163163_10396081
705 Ga0163163_10399302
706 Ga0157380_10198086
707 Ga0157380_10342964
708 Ga0157377_10117283
709 Ga0157379_10005965
710 Ga0157379_10063891
711 Ga0157379_10131737
712 Ga0157376_10929865
713 Ga0157376_11495448
714 Ga0182007_10100109
715 Ga0163161_10725778
716 Ga0206356_11370603
717 Ga0206356_11432270
718 Ga0207697_10198695
719 Ga0207710_10138900
720 Ga0207688_10268973
721 Ga0207680_10278774
722 Ga0207645_10274621
723 Ga0207645_10810961
724 Ga0207643_10027534
725 Ga0207684_10569620
726 Ga0207684_10825163
727 Ga0207707_10476841
728 Ga0207695_10215189
729 Ga0207693_11053049
730 Ga0207662_10011646
731 Ga0207662_10313673
732 Ga0207646_10059862
733 Ga0207646_10950146
734 Ga0207681_10015878
735 Ga0207681_10020093
736 Ga0207681_10045177
737 Ga0207650_10107865
738 Ga0207650_11331523
739 Ga0207659_10106102
740 Ga0207659_11148535
741 Ga0207659_11621423
742 Ga0207687_10718954
743 Ga0207687_11310601
744 Ga0207644_10004183
745 Ga0207644_10483852
746 Ga0207644_10512471
747 Ga0207690_10037604
748 Ga0207706_10135407
749 Ga0207706_10280677
750 Ga0207706_10292007
751 Ga0207686_10414421
752 Ga0207709_10056123
753 Ga0207709_11516242
754 Ga0207669_10282742
755 Ga0207669_10427583
756 Ga0207669_10931947
757 Ga0207704_10392061
758 Ga0207665_10075551
759 Ga0207691_10068111
760 Ga0207691_10092084
761 Ga0207691_10224340
762 Ga0207691_10634005
763 Ga0207691_11206182
764 Ga0207711_10006661
765 Ga0207711_10223793
766 Ga0207711_10231152
767 Ga0207711_10295705
768 Ga0207689_10095459
769 Ga0207661_10221224
770 Ga0207651_10153392
771 Ga0207651_10581569
772 Ga0207712_10048619
773 Ga0207712_10562738
774 Ga0207712_11861339
775 Ga0207668_12044138
776 Ga0207640_10012925
777 Ga0207640_10053128
778 Ga0207677_10124296
779 Ga0207677_10820212
780 Ga0207703_10012192
781 Ga0207639_10105071
782 Ga0207639_10343055
783 Ga0207639_10488645
784 Ga0207708_10169752
785 Ga0207641_10002105
786 Ga0207676_11156793
787 Ga0207675_100034095
788 Ga0207675_100065358
789 Ga0207675_100071486
790 Ga0207675_100372747
791 Ga0207675_100519391
792 Ga0207675_101092780
793 Ga0207683_10632864
794 Ga0207683_10743153
795 Ga0207683_11309023
796 Ga0207698_10369945
797 Ga0209813_10045749
798 Ga0207428_10008027
799 Ga0268266_10072243
800 Ga0268265_10004086
801 Ga0268265_10363538
802 Ga0268265_11209754
803 Ga0268265_11655962
804 Ga0268264_10104137
805 Ga0268264_10142502
806 Ga0268264_10492803
807 Ga0268264_10532157
808 Ga0268264_10928842
809 Ga0307408_100899063
810 Ga0373930_0014282
811 Ga0373948_0001910
812 Ga0373958_0002174
813 Ga0373959_0002901
814 Ga0373938_0023726
815 Ga0373928_0001584
816 Ga0373929_0001310
817 Ga0373940_0004300
818 Ga0373951_0009649
819 Ga0373952_0003164
820 Ga0373932_0001227
821 Ga0373939_0000417
822 Ga0373941_0001684
823 Ga0373941_0267586
824 Ga0373960_0000383
825 Ga0373960_0097218
826 Ga0373942_0000206
827 Ga0373961_0000423
828 Ga0373962_0002541
829 Ga0373931_0002559
830 Ga0373931_1095890
831 Ga0373937_0395122
832 Ga0451807_0738835
833 Ga0451853_0536332
834 Ga0439458_0093278
835 Ga0466964_0390296
836 Ga0466960_0836910
837 Ga0451576_0039489
838 Ga0451576_0123050
839 Ga0466967_0381804
840 Ga0495586_0149511
841 Ga0495587_0353240
842 Ga0495621_0369545
843 Ga0495621_0467165
844 Ga0495645_0287498
845 Ga0495599_0236292
846 Ga0495669_0110719
847 Ga0495613_0073667
848 Ga0495674_0826422
849 Ga0496101_0480721
850 Ga0496102_0039911
851 Ga0496102_0752408
852 Ga0496106_0170424
853 Ga0496106_0228470
854 Ga0496106_0242937
855 Ga0496107_0168851
856 Ga0496108_1373898
857 Ga0496109_0110058
858 Ga0496109_0644652
859 Ga0496112_0476487
860 Ga0496112_1683343
861 Ga0496114_0785201
862 Ga0501031_0018465
863 Ga0501032_0326682
864 Ga0501033_0361562
865 Ga0501034_0038697
866 Ga0501034_0053105
867 Ga0501036_0014412
868 Ga0501036_0015981
869 Ga0501036_0121200
870 Ga0501037_0005124
871 Ga0501037_0030014
872 Ga0501038_0018205
873 Ga0501039_0017411
874 Ga0501039_0070800
875 Ga0501042_0370768
876 Ga0501042_0512074
877 Ga0501043_0004740
878 Ga0501043_0298889
879 Ga0501046_0004293
880 Ga0501047_0002315
881 Ga0501047_0024979
882 Ga0501047_0090444
883 Ga0501048_0019666
884 Ga0501067_0719118
885 Ga0501067_0781867
886 Ga0501068_0009256
887 Ga0501068_0297671
888 Ga0501069_0506349
889 Ga0501070_0012204
890 Ga0501070_0245696
891 Ga0501071_0629074
892 Ga0501071_0774719
893 Ga0501071_0862300
894 Ga0501072_0239334
895 Ga0501073_0365504
896 Ga0501073_0521736
897 Ga0501074_0002059
898 Ga0501074_0005866
899 Ga0501074_0028403
900 Ga0501075_0521046
901 Ga0501075_0721062
902 Ga0501076_0386752
903 Ga0501077_0223362
904 Ga0501206_086068
905 Ga0501079_0156981
906 Ga0501079_0234137
907 Ga0501080_0019621
908 Ga0501080_0023685
909 Ga0501080_0567463
910 Ga0501083_0016610
911 Ga0501083_0503320
912 Ga0501083_0735980
913 Ga0501083_0963020
914 Ga0501035_0069014
915 Ga0501035_0251510
916 Ga0501044_0749923
917 Ga0501045_0323600
918 Ga0501045_0568394
919 Ga0501045_0582141
920 nmdc:mga03683_8984_c1
921 nmdc:mga00v17_784_c1
922 nmdc:mga0yw44_61875_c1
923 nmdc:mga0yw44_91884_c1
924 nmdc:mga0k408_18415_c1
925 nmdc:mga0k408_72964_c1
926 nmdc:mga06z11_122612_c1
927 nmdc:mga06z11_41619_c1
928 nmdc:mga07m45_2193_c1
929 nmdc:mga05p37_106008_c1
930 nmdc:mga05p37_19613_c1
931 nmdc:mga05p37_33089_c1
932 nmdc:mga05p37_446635_c1
933 nmdc:mga05p37_96584_c1
934 nmdc:mga08y16_720789_c1
935 nmdc:mga08y16_97676_c1
936 nmdc:mga0n895_1017843_c1
937 nmdc:mga0n895_10522_c1
938 nmdc:mga0n895_1162629_c1
939 nmdc:mga0n895_235457_c1
940 nmdc:mga0n895_369300_c1
941 nmdc:mga0n895_60819_c1
942 nmdc:mga0n895_875077_c1
943 nmdc:mga0rr50_109364_c1
944 nmdc:mga0rr50_119495_c2
945 nmdc:mga0rr50_160125_c1
946 nmdc:mga0rr50_230057_c1
947 nmdc:mga0rr50_689426_c1
948 nmdc:mga0rr50_69851_c1
949 nmdc:mga08x19_20081_c1
950 nmdc:mga08x19_227896_c1
951 nmdc:mga0a205_1166804_c1
952 nmdc:mga0a205_340466_c1
953 nmdc:mga0a205_43427_c1
954 nmdc:mga0a205_51689_c1
955 nmdc:mga0a205_6877_c1
956 nmdc:mga0a205_885180_c1
957 nmdc:mga0a205_975992_c1
958 nmdc:mga0sz30_86663_c1
959 Ga0495619_0589439
960 Ga0501084_0036090
961 Ga0501084_0494590
962 Ga0590071_005863
963 Ga0587093_095390
964 Ga0587066_022279
965 Ga0587070_057413
966 Ga0587070_057570
967 Ga0587070_146108
968 Ga0587073_0090714
969 Ga0587077_019964
970 Ga0587080_005540
971 Ga0587082_008113
972 Ga0587082_028990
973 Ga0587082_158303
974 Ga0587083_0006335
975 Ga0587085_030348
976 Ga0587086_034410
977 Ga0587088_005179
978 Ga0587091_009707
979 Ga0587092_117583
980 Ga0587094_042277
981 Ga0587094_065352
982 Ga0587106_039833
983 Ga0587113_016626
984 Ga0587115_029391
985 Ga0587117_012894
986 Ga0587062_006883
987 Ga0587062_049410
988 Ga0587062_086785
989 Ga0587067_023463
990 Ga0587067_065933
991 Ga0587068_041737
992 Ga0587068_042048
993 Ga0587068_123461
994 Ga0587069_044116
995 Ga0587072_054152
996 Ga0587072_081904
997 Ga0587075_035344
998 Ga0587075_040743
999 Ga0587076_022340
1000 Ga0587079_029188
1001 Ga0587079_079451
1002 Ga0587079_108011
1003 Ga0587107_014658
1004 Ga0587114_027564
1005 Ga0587119_027183
1006 Ga0587071_021901
1007 Ga0587111_0023436
1008 Ga0587111_0153267
1009 Ga0501082_0100809
1010 Ga0501082_0416230
1011 Ga0501082_0507223
1012 Ga0530510_0905284

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

19

145

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8804 72 142
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.848 72 142
2jwl-assembly1.cif.gz_B solution structure of periplasmic domain of tolr from h. influenzae with saxs data 0.7799 72 137
1z26-assembly1.cif.gz_A structure of pyrococcus furiosus argonaute with bound tungstate 0.7754 92 145
1z25-assembly1.cif.gz_A structure of p.furiosus argonaute with bound mn2+ 0.7754 92 145
ID Description Score Start End Superfamily
af_Q943F5_38_417_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.7855 109 144 3.80.10.10
af_Q4DB76_342_532_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7818 107 143 3.40.50.720
2jwlB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7799 72 137 3.30.420.270
af_Q9D864_5_250_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7779 108 152 3.30.420.40
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7728 73 140 3.30.420.270
ID Description Score Start End GO Terms
AF-A0A7Z9FA47-F1-model_v4 Protein TolR 0.9594 72 143 GO:0005886
GO:0015031
GO:0022857
AF-X1Q1P4-F1-model_v4 Biopolymer transporter ExbD 0.9378 72 144 GO:0005886
GO:0022857
AF-A0A3M3A539-F1-model_v4 TonB system transport protein ExbD2 0.9284 72 143 GO:0005886
GO:0015031
GO:0022857
AF-A0A349UJD8-F1-model_v4 Uncharacterized protein 0.9276 72 143
AF-A0A7V3UWM1-F1-model_v4 Biopolymer transporter ExbD 0.9268 74 144 GO:0005886
GO:0015031
GO:0022857

Map