F456536

General Info

Members Datasets Scaffolds Average Seq Length
506 194 1010 312

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10015577|Ga0207707_100155774
Length 368
Sequence VFYEPVAKSQLDPFESNTMMPIGLSIRWVCRRGALGYRGETWEWSIMIGRIATGVFAGLLAFSLWLAPARCADKVRIGVSNYNISNLTVGVAQTQNFFRQEGIEAEIIRMNPNVATMALVSGDIDYSILVGSVIGANLKGAKLKMIACSQDRTPLSLVSKAAIKSVKELKGKTIGVGSYGSTPDIIARLVVKHYGVDPETEIKMLALGSDAARLTALKEGVVDAIVVAPPADYEGKNMGFNILSRAGEILRFPYNGLGASMKKLGEKPDEVKRVIRAIVRTNGFIRRNRDGAIQVLVSWTKTKPEFAAAAYESSVGFFSQDGTIPEDGLLIVVDNLKKSMNITRPVALYEVLDSTLLSEVQRELGIKK

Samples

Sample ID Description Type Environment
1 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
178 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.98
Rhizosphere 98.02
Stem 0
Stem Tuber 0
Unclassified 29.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207707_10015577 3300025912 Bacteria 6623
2 JGI25405J52794_10004896 3300003911 Unclassified 2400
3 Ga0065714_10090047 3300005288 Unclassified 1957
4 Ga0065712_10000212 3300005290 Bacteria 30259
5 Ga0065712_10067794 3300005290 Bacteria 34092
6 Ga0065712_10071415 3300005290 Bacteria 5283
7 Ga0065715_10000302 3300005293 Bacteria 23656
8 Ga0065715_10002599 3300005293 Bacteria 6558
9 Ga0065715_10018924 3300005293 Bacteria 2650
10 Ga0065715_10031065 3300005293 Bacteria 2539
11 Ga0065715_10094489 3300005293 Bacteria 4321
12 Ga0065707_10005861 3300005295 Bacteria 2975
13 Ga0065707_10007706 3300005295 Unclassified 2627
14 Ga0065707_10149659 3300005295 Unclassified 1657
15 Ga0065707_10220204 3300005295 Unclassified 1228
16 Ga0065707_10247508 3300005295 Bacteria 1135
17 Ga0070676_10163728 3300005328 Unclassified 1433
18 Ga0070690_100052555 3300005330 Bacteria 2604
19 Ga0070670_100036184 3300005331 Bacteria 4249
20 Ga0070670_100261299 3300005331 Bacteria 1509
21 Ga0070670_100273091 3300005331 Unclassified 1475
22 Ga0070677_10057256 3300005333 Bacteria 1597
23 Ga0068869_100244444 3300005334 Bacteria 1431
24 Ga0070666_10080906 3300005335 Bacteria 2220
25 Ga0070666_10167100 3300005335 Unclassified 1539
26 Ga0070680_100095309 3300005336 Bacteria 2467
27 Ga0070680_100125423 3300005336 Bacteria 2145
28 Ga0070680_100163258 3300005336 Bacteria 1872
29 Ga0070682_100075731 3300005337 Bacteria 2165
30 Ga0068868_100072873 3300005338 Bacteria 2741
31 Ga0068868_100290590 3300005338 Bacteria 1386
32 Ga0070691_10120122 3300005341 Bacteria 1323
33 Ga0070661_100035332 3300005344 Bacteria 3628
34 Ga0070661_100057067 3300005344 Unclassified 2861
35 Ga0070668_100233891 3300005347 Unclassified 1520
36 Ga0070668_100258128 3300005347 Bacteria 1448
37 Ga0070669_100070409 3300005353 Bacteria 2585
38 Ga0070675_100276583 3300005354 Bacteria 1474
39 Ga0070671_100011289 3300005355 Bacteria 7176
40 Ga0070674_100125039 3300005356 Bacteria 1909
41 Ga0070674_100219753 3300005356 Unclassified 1477
42 Ga0070673_100215583 3300005364 Unclassified 1659
43 Ga0070688_100179587 3300005365 Unclassified 1467
44 Ga0070667_100150314 3300005367 Unclassified 2045
45 Ga0070694_100031828 3300005444 Bacteria 3460
46 Ga0070694_100076346 3300005444 Unclassified 2319
47 Ga0070708_100230770 3300005445 Unclassified 1737
48 Ga0070708_100236908 3300005445 Unclassified 1713
49 Ga0070663_100136367 3300005455 Bacteria 1869
50 Ga0070678_100036698 3300005456 Bacteria 3433
51 Ga0070662_100018820 3300005457 Unclassified 4678
52 Ga0070662_100049183 3300005457 Unclassified 3040
53 Ga0070662_100220225 3300005457 Bacteria 1514
54 Ga0070662_100350263 3300005457 Unclassified 1210
55 Ga0070681_10002879 3300005458 Bacteria 15900
56 Ga0070681_10014329 3300005458 Bacteria 7889
57 Ga0070681_10030643 3300005458 Bacteria 5398
58 Ga0070681_10037767 3300005458 Bacteria 4844
59 Ga0070681_10087660 3300005458 Bacteria 3065
60 Ga0068867_100502470 3300005459 Unclassified 1042
61 Ga0070706_100225401 3300005467 Bacteria 1750
62 Ga0070706_100385571 3300005467 Unclassified 1305
63 Ga0070707_100317700 3300005468 Bacteria 1513
64 Ga0070707_100401303 3300005468 Unclassified 1331
65 Ga0070698_100099528 3300005471 Unclassified 2881
66 Ga0070698_100196320 3300005471 Unclassified 1955
67 Ga0070679_100028339 3300005530 Bacteria 5521
68 Ga0070679_100079551 3300005530 Bacteria 3267
69 Ga0070679_100122087 3300005530 Unclassified 2589
70 Ga0070679_100285403 3300005530 Bacteria 1603
71 Ga0070697_100136182 3300005536 Bacteria 2062
72 Ga0070697_100239950 3300005536 Bacteria 1547
73 Ga0068853_100062836 3300005539 Bacteria 3215
74 Ga0070672_100085037 3300005543 Unclassified 2541
75 Ga0070672_100155041 3300005543 Bacteria 1897
76 Ga0070686_100030461 3300005544 Bacteria 3291
77 Ga0070695_100024849 3300005545 Bacteria 3695
78 Ga0070696_100121870 3300005546 Bacteria 1888
79 Ga0070693_100179008 3300005547 Unclassified 1364
80 Ga0070665_100136284 3300005548 Bacteria 2458
81 Ga0070704_100057958 3300005549 Unclassified 2757
82 Ga0068855_100094830 3300005563 Bacteria 3440
83 Ga0068855_100187326 3300005563 Bacteria 2336
84 Ga0070664_100005650 3300005564 Bacteria 10069
85 Ga0070664_100019822 3300005564 Bacteria 5536
86 Ga0070664_100076978 3300005564 Unclassified 2867
87 Ga0070664_100247256 3300005564 Bacteria 1602
88 Ga0068854_100156361 3300005578 Bacteria 1762
89 Ga0068854_100211023 3300005578 Unclassified 1531
90 Ga0068856_100231415 3300005614 Bacteria 1863
91 Ga0068856_100306039 3300005614 Bacteria 1607
92 Ga0070702_100012825 3300005615 Bacteria 4217
93 Ga0068859_100266113 3300005617 Bacteria 1806
94 Ga0068859_100296206 3300005617 Unclassified 1711
95 Ga0068864_100304638 3300005618 Unclassified 1492
96 Ga0068866_10131758 3300005718 Bacteria 1423
97 Ga0068861_100250005 3300005719 Bacteria 1512
98 Ga0068863_100192787 3300005841 Bacteria 1959
99 Ga0068863_100274859 3300005841 Bacteria 1631
100 Ga0068863_100525229 3300005841 Bacteria 1167
101 Ga0068858_100168309 3300005842 Bacteria 2066
102 Ga0068860_100647102 3300005843 Unclassified 1065
103 Ga0081455_10000084 3300005937 Bacteria 101753
104 Ga0081455_10001378 3300005937 Bacteria 30033
105 Ga0081455_10002322 3300005937 Bacteria 22685
106 Ga0081455_10007338 3300005937 Bacteria 11627
107 Ga0081455_10024744 3300005937 Bacteria 5552
108 Ga0081455_10250742 3300005937 Bacteria 1295
109 Ga0081538_10004241 3300005981 Bacteria 13296
110 Ga0081538_10015632 3300005981 Bacteria 5864
111 Ga0081540_1010201 3300005983 Bacteria 6382
112 Ga0075432_10013579 3300006058 Unclassified 2768
113 Ga0070715_10046764 3300006163 Bacteria 1841
114 Ga0070712_100042318 3300006175 Bacteria 3132
115 Ga0097621_100175649 3300006237 Bacteria 1848
116 Ga0097621_100175963 3300006237 Bacteria 1847
117 Ga0075428_100013072 3300006844 Bacteria 9229
118 Ga0075428_100082100 3300006844 Unclassified 3517
119 Ga0075428_100110040 3300006844 Bacteria 3001
120 Ga0075428_100132003 3300006844 Unclassified 2716
121 Ga0075428_100145938 3300006844 Unclassified 2571
122 Ga0075428_100154095 3300006844 Unclassified 2496
123 Ga0075428_100209246 3300006844 Bacteria 2108
124 Ga0075428_100237122 3300006844 Bacteria 1968
125 Ga0075428_100241022 3300006844 Bacteria 1951
126 Ga0075428_100257322 3300006844 Unclassified 1880
127 Ga0075428_100326163 3300006844 Bacteria 1649
128 Ga0075428_100368936 3300006844 Bacteria 1540
129 Ga0075428_100589402 3300006844 Unclassified 1188
130 Ga0075430_100029937 3300006846 Unclassified 4622
131 Ga0075430_100070977 3300006846 Unclassified 2922
132 Ga0075430_100080441 3300006846 Unclassified 2730
133 Ga0075430_100153452 3300006846 Bacteria 1917
134 Ga0075430_100160115 3300006846 Bacteria 1874
135 Ga0075431_100014808 3300006847 Bacteria 7896
136 Ga0075431_100016877 3300006847 Bacteria 7413
137 Ga0075431_100039616 3300006847 Bacteria 4854
138 Ga0075431_100044465 3300006847 Bacteria 4581
139 Ga0075431_100108971 3300006847 Bacteria 2858
140 Ga0075431_100149860 3300006847 Bacteria 2402
141 Ga0075431_100293843 3300006847 Unclassified 1643
142 Ga0075431_100373608 3300006847 Unclassified 1431
143 Ga0075433_10003474 3300006852 Bacteria 12166
144 Ga0075433_10008009 3300006852 Bacteria 8414
145 Ga0075433_10013623 3300006852 Bacteria 6620
146 Ga0075433_10018041 3300006852 Bacteria 5858
147 Ga0075433_10018486 3300006852 Bacteria 5795
148 Ga0075433_10022283 3300006852 Bacteria 5317
149 Ga0075433_10100709 3300006852 Unclassified 2558
150 Ga0075433_10108507 3300006852 Bacteria 2462
151 Ga0075433_10185713 3300006852 Bacteria 1850
152 Ga0075433_10212156 3300006852 Bacteria 1720
153 Ga0075433_10270854 3300006852 Bacteria 1505
154 Ga0075433_10404952 3300006852 Unclassified 1203
155 Ga0075434_100002010 3300006871 Bacteria 17655
156 Ga0075434_100013300 3300006871 Bacteria 7826
157 Ga0075434_100016010 3300006871 Bacteria 7206
158 Ga0075434_100029969 3300006871 Bacteria 5356
159 Ga0075434_100030581 3300006871 Bacteria 5303
160 Ga0075434_100036003 3300006871 Bacteria 4895
161 Ga0075434_100049250 3300006871 Bacteria 4183
162 Ga0075434_100072844 3300006871 Bacteria 3427
163 Ga0075434_100085496 3300006871 Unclassified 3153
164 Ga0075434_100103918 3300006871 Bacteria 2850
165 Ga0075434_100125463 3300006871 Bacteria 2584
166 Ga0075434_100170368 3300006871 Bacteria 2197
167 Ga0075434_100201227 3300006871 Bacteria 2011
168 Ga0075434_100298817 3300006871 Bacteria 1630
169 Ga0075434_100320848 3300006871 Unclassified 1570
170 Ga0075434_100330293 3300006871 Bacteria 1545
171 Ga0075434_100330481 3300006871 Unclassified 1545
172 Ga0075434_100375476 3300006871 Unclassified 1443
173 Ga0075434_100494066 3300006871 Bacteria 1245
174 Ga0075429_100037584 3300006880 Bacteria 4214
175 Ga0075429_100071148 3300006880 Bacteria 3028
176 Ga0075429_100094922 3300006880 Unclassified 2601
177 Ga0075429_100104921 3300006880 Bacteria 2469
178 Ga0075429_100122986 3300006880 Unclassified 2268
179 Ga0075429_100148496 3300006880 Bacteria 2052
180 Ga0075429_100153627 3300006880 Bacteria 2015
181 Ga0075429_100276507 3300006880 Unclassified 1470
182 Ga0075429_100538722 3300006880 Unclassified 1023
183 Ga0068865_100031738 3300006881 Unclassified 3524
184 Ga0068865_100215352 3300006881 Unclassified 1499
185 Ga0068865_100277427 3300006881 Bacteria 1333
186 Ga0068865_100496188 3300006881 Unclassified 1017
187 Ga0075436_100009436 3300006914 Bacteria 6671
188 Ga0075436_100025073 3300006914 Bacteria 4100
189 Ga0075436_100044875 3300006914 Bacteria 3049
190 Ga0075436_100061815 3300006914 Unclassified 2588
191 Ga0075436_100282038 3300006914 Unclassified 1188
192 Ga0097620_100266097 3300006931 Bacteria 1806
193 Ga0097620_100296183 3300006931 Unclassified 1711
194 Ga0075435_100004303 3300007076 Bacteria 9786
195 Ga0075435_100013001 3300007076 Bacteria 6178
196 Ga0075435_100013966 3300007076 Bacteria 5988
197 Ga0075435_100015868 3300007076 Bacteria 5668
198 Ga0075435_100043013 3300007076 Bacteria 3616
199 Ga0075435_100045332 3300007076 Bacteria 3525
200 Ga0075435_100050210 3300007076 Unclassified 3356
201 Ga0075435_100056124 3300007076 Unclassified 3183
202 Ga0075435_100067059 3300007076 Bacteria 2921
203 Ga0075435_100080716 3300007076 Bacteria 2671
204 Ga0075435_100118266 3300007076 Unclassified 2209
205 Ga0075435_100159787 3300007076 Unclassified 1897
206 Ga0075435_100186525 3300007076 Unclassified 1754
207 Ga0111539_10058620 3300009094 Bacteria 4567
208 Ga0111539_10097018 3300009094 Bacteria 3462
209 Ga0111539_10157392 3300009094 Unclassified 2658
210 Ga0111539_10227119 3300009094 Bacteria 2174
211 Ga0105245_10147327 3300009098 Unclassified 2222
212 Ga0114129_10011434 3300009147 Bacteria 12642
213 Ga0114129_10014687 3300009147 Bacteria 11158
214 Ga0114129_10015635 3300009147 Bacteria 10792
215 Ga0114129_10021706 3300009147 Bacteria 9111
216 Ga0114129_10024908 3300009147 Bacteria 8484
217 Ga0114129_10034655 3300009147 Bacteria 7130
218 Ga0114129_10035824 3300009147 Bacteria 7008
219 Ga0114129_10072700 3300009147 Unclassified 4794
220 Ga0114129_10077565 3300009147 Bacteria 4621
221 Ga0114129_10081061 3300009147 Bacteria 4511
222 Ga0114129_10088184 3300009147 Bacteria 4302
223 Ga0114129_10095733 3300009147 Bacteria 4112
224 Ga0114129_10106503 3300009147 Unclassified 3873
225 Ga0114129_10162384 3300009147 Bacteria 3050
226 Ga0114129_10177307 3300009147 Bacteria 2902
227 Ga0114129_10200144 3300009147 Unclassified 2706
228 Ga0114129_10227482 3300009147 Viruses 2513
229 Ga0114129_10399772 3300009147 Unclassified 1811
230 Ga0114129_10405318 3300009147 Unclassified 1796
231 Ga0114129_10474996 3300009147 Unclassified 1637
232 Ga0114129_10484869 3300009147 Unclassified 1617
233 Ga0114129_10677500 3300009147 Bacteria 1328
234 Ga0114129_10682298 3300009147 Bacteria 1322
235 Ga0105243_10214201 3300009148 Unclassified 1698
236 Ga0105243_10444441 3300009148 Bacteria 1215
237 Ga0105241_10181261 3300009174 Bacteria 1747
238 Ga0105242_10130926 3300009176 Bacteria 2165
239 Ga0105242_10343071 3300009176 Bacteria 1377
240 Ga0105237_10366208 3300009545 Bacteria 1446
241 Ga0105249_10050051 3300009553 Bacteria 3810
242 Ga0105249_10083657 3300009553 Bacteria 2970
243 Ga0105249_10394641 3300009553 Unclassified 1413
244 Ga0105239_10069340 3300010375 Bacteria 3874
245 Ga0105239_10182112 3300010375 Bacteria 2351
246 Ga0105246_10141928 3300011119 Unclassified 1807
247 Ga0157373_10036035 3300013100 Bacteria 3551
248 Ga0157371_10113134 3300013102 Bacteria 1927
249 Ga0157374_10059967 3300013296 Bacteria 3560
250 Ga0157374_10402312 3300013296 Bacteria 1366
251 Ga0157378_10019351 3300013297 Bacteria 5986
252 Ga0157378_10031471 3300013297 Bacteria 4686
253 Ga0157378_10083144 3300013297 Unclassified 2896
254 Ga0157378_10124313 3300013297 Bacteria 2382
255 Ga0157378_10145574 3300013297 Bacteria 2203
256 Ga0157378_10188100 3300013297 Unclassified 1946
257 Ga0157378_10206535 3300013297 Bacteria 1860
258 Ga0157378_10317342 3300013297 Bacteria 1513
259 Ga0163162_10037200 3300013306 Bacteria 4855
260 Ga0163162_10043778 3300013306 Bacteria 4482
261 Ga0163162_10193120 3300013306 Bacteria 2164
262 Ga0163162_10364655 3300013306 Unclassified 1578
263 Ga0157372_10476243 3300013307 Bacteria 1455
264 Ga0157372_10476751 3300013307 Unclassified 1455
265 Ga0157375_10114406 3300013308 Bacteria 2800
266 Ga0157375_10513609 3300013308 Bacteria 1362
267 Ga0157375_10526614 3300013308 Bacteria 1345
268 Ga0163163_10262241 3300014325 Bacteria 1779
269 Ga0157376_10054581 3300014969 Bacteria 3332
270 Ga0157376_10490208 3300014969 Bacteria 1206
271 Ga0182007_10027211 3300015262 Bacteria 1973
272 Ga0163161_10235687 3300017792 Bacteria 1422
273 Ga0163161_10376612 3300017792 Unclassified 1134
274 Ga0207697_10006537 3300025315 Bacteria 5260
275 Ga0207697_10017365 3300025315 Bacteria 2957
276 Ga0207682_10128914 3300025893 Bacteria 1128
277 Ga0207688_10014138 3300025901 Bacteria 4342
278 Ga0207688_10051470 3300025901 Bacteria 2307
279 Ga0207645_10003317 3300025907 Bacteria 12283
280 Ga0207645_10014855 3300025907 Bacteria 5195
281 Ga0207684_10181723 3300025910 Bacteria 1814
282 Ga0207654_10301124 3300025911 Bacteria 1090
283 Ga0207707_10000954 3300025912 Bacteria 27843
284 Ga0207707_10008194 3300025912 Bacteria 9071
285 Ga0207707_10008717 3300025912 Bacteria 8798
286 Ga0207707_10013778 3300025912 Bacteria 7051
287 Ga0207707_10171463 3300025912 Bacteria 1896
288 Ga0207663_10130437 3300025916 Bacteria 1736
289 Ga0207660_10009084 3300025917 Bacteria 6438
290 Ga0207660_10056196 3300025917 Bacteria 2816
291 Ga0207657_10008787 3300025919 Bacteria 10223
292 Ga0207649_10133360 3300025920 Bacteria 1690
293 Ga0207652_10011440 3300025921 Bacteria 7153
294 Ga0207652_10077255 3300025921 Unclassified 2905
295 Ga0207652_10103781 3300025921 Bacteria 2514
296 Ga0207681_10111643 3300025923 Bacteria 1989
297 Ga0207650_10016238 3300025925 Bacteria 5201
298 Ga0207650_10238818 3300025925 Bacteria 1468
299 Ga0207644_10026528 3300025931 Bacteria 3992
300 Ga0207690_10452628 3300025932 Bacteria 1032
301 Ga0207706_10010676 3300025933 Bacteria 8389
302 Ga0207706_10022739 3300025933 Bacteria 5627
303 Ga0207706_10026544 3300025933 Bacteria 5184
304 Ga0207706_10068074 3300025933 Unclassified 3134
305 Ga0207686_10065908 3300025934 Unclassified 2311
306 Ga0207686_10327850 3300025934 Unclassified 1146
307 Ga0207709_10336093 3300025935 Bacteria 1135
308 Ga0207670_10253937 3300025936 Bacteria 1360
309 Ga0207665_10066244 3300025939 Bacteria 2458
310 Ga0207691_10006273 3300025940 Bacteria 11477
311 Ga0207691_10030278 3300025940 Bacteria 5059
312 Ga0207689_10072715 3300025942 Bacteria 2825
313 Ga0207661_10092795 3300025944 Unclassified 2518
314 Ga0207679_10005990 3300025945 Bacteria 7648
315 Ga0207679_10033962 3300025945 Bacteria 3595
316 Ga0207679_10111071 3300025945 Unclassified 2163
317 Ga0207679_10114007 3300025945 Bacteria 2139
318 Ga0207667_10361398 3300025949 Unclassified 1480
319 Ga0207651_10500228 3300025960 Bacteria 1050
320 Ga0207677_10177864 3300026023 Unclassified 1671
321 Ga0207678_10068537 3300026067 Unclassified 3043
322 Ga0207678_10099792 3300026067 Bacteria 2480
323 Ga0207708_10087282 3300026075 Bacteria 2402
324 Ga0207641_10120761 3300026088 Bacteria 2338
325 Ga0207641_10247668 3300026088 Unclassified 1663
326 Ga0207648_10116543 3300026089 Bacteria 2348
327 Ga0207648_10275404 3300026089 Unclassified 1504
328 Ga0207676_10249157 3300026095 Bacteria 1598
329 Ga0207676_10284692 3300026095 Unclassified 1502
330 Ga0207674_10294865 3300026116 Bacteria 1570
331 Ga0207675_100189135 3300026118 Bacteria 1974
332 Ga0207683_10000890 3300026121 Bacteria 27458
333 Ga0207683_10020533 3300026121 Bacteria 5651
334 Ga0209983_1021551 3300027665 Unclassified 1347
335 Ga0209971_1010013 3300027682 Bacteria 2243
336 Ga0209971_1035315 3300027682 Bacteria 1202
337 Ga0207428_10015310 3300027907 Bacteria 6637
338 Ga0207428_10196143 3300027907 Bacteria 1520
339 Ga0307410_10005637 3300031852 Bacteria 6656
340 Ga0307412_10125317 3300031911 Bacteria 1857
341 Ga0307409_100025598 3300031995 Bacteria 4142
342 Ga0307416_100028606 3300032002 Bacteria 4148
343 Ga0307414_10040784 3300032004 Bacteria 3138
344 Ga0307411_10012091 3300032005 Bacteria 4690
345 Ga0307415_100020949 3300032126 Bacteria 4005
346 Ga0373951_0018483 3300035091 Bacteria 1584
347 Ga0373936_0117578 3300035113 Unclassified 1133
348 Ga0373931_0002443 3300035691 Bacteria 8232
349 Ga0373931_0004279 3300035691 Bacteria 6503
350 Ga0373931_0027976 3300035691 Unclassified 2882
351 Ga0373931_0074284 3300035691 Bacteria 1862
352 Ga0373931_0170228 3300035691 Bacteria 1283
353 Ga0373935_0045426 3300035692 Bacteria 2772
354 Ga0373927_0127384 3300035695 Unclassified 1663
355 Ga0373925_0110464 3300037068 Unclassified 2123
356 Ga0451577_0560960 3300042876 Unclassified 1037
357 Ga0453684_0458035 3300044712 Bacteria 1419
358 Ga0451576_0144756 3300045051 Bacteria 2478
359 Ga0451576_0577070 3300045051 Unclassified 1182
360 Ga0451576_0664926 3300045051 Unclassified 1094
361 Ga0495580_0072680 3300046472 Bacteria 2401
362 Ga0495580_0127950 3300046472 Bacteria 1763
363 Ga0495644_0073422 3300046523 Unclassified 1287
364 Ga0495633_0154379 3300046558 Bacteria 1060
365 Ga0495659_0008733 3300046664 Unclassified 3227
366 Ga0496100_0264054 3300048903 Bacteria 1278
367 Ga0496102_0142739 3300048905 Bacteria 2246
368 Ga0496108_0148267 3300048911 Unclassified 2024
369 Ga0496111_0193498 3300048914 Unclassified 1512
370 Ga0496112_0005186 3300048915 Bacteria 11204
371 Ga0496112_0012741 3300048915 Bacteria 7735
372 Ga0496112_0060889 3300048915 Bacteria 3720
373 Ga0496112_0342380 3300048915 Unclassified 1438
374 Ga0496112_0365209 3300048915 Bacteria 1385
375 Ga0496113_0128407 3300048916 Unclassified 1987
376 Ga0501299_011063 3300049522 Bacteria 1517
377 Ga0501033_0047128 3300049570 Unclassified 3205
378 Ga0501036_0082029 3300049572 Unclassified 2725
379 Ga0501038_0022269 3300049574 Bacteria 5679
380 Ga0501039_0001841 3300049575 Bacteria 15660
381 Ga0501040_0001713 3300049576 Bacteria 14052
382 Ga0501041_0000023 3300049577 Bacteria 51046
383 Ga0501041_0124365 3300049577 Unclassified 1604
384 Ga0501042_0067001 3300049578 Unclassified 2566
385 Ga0501046_0060342 3300049580 Unclassified 2968
386 Ga0501046_0141297 3300049580 Bacteria 1822
387 Ga0501048_0007425 3300049582 Bacteria 8309
388 Ga0501048_0250003 3300049582 Unclassified 1258
389 Ga0501068_0281468 3300049584 Unclassified 1063
390 Ga0501071_0001597 3300049587 Bacteria 13285
391 Ga0501072_0052765 3300049588 Unclassified 3201
392 Ga0501072_0163226 3300049588 Bacteria 1777
393 Ga0501074_0145769 3300049590 Bacteria 1693
394 Ga0501075_0023610 3300049591 Unclassified 4504
395 Ga0501075_0249212 3300049591 Unclassified 1353
396 Ga0501076_0002160 3300049592 Bacteria 13479
397 Ga0501077_0004839 3300049593 Bacteria 8181
398 Ga0501216_019764 3300049660 Bacteria 1171
399 Ga0501217_004322 3300049661 Bacteria 2915
400 Ga0501079_0015327 3300049741 Bacteria 5847
401 Ga0501079_0304727 3300049741 Unclassified 1246
402 Ga0501081_0005453 3300049743 Bacteria 8209
403 Ga0501081_0281093 3300049743 Unclassified 1218
404 Ga0501045_0001165 3300049824 Bacteria 17428
405 Ga0501045_0202870 3300049824 Unclassified 1477
406 Ga0501204_002865 3300049850 Bacteria 1778
407 nmdc:mga05p37_103760_c1 3300050507 Bacteria 3499
408 nmdc:mga05p37_15366_c1 3300050507 Bacteria 9197
409 nmdc:mga05p37_18047_c1 3300050507 Bacteria 8522
410 nmdc:mga05p37_18215_c1 3300050507 Bacteria 8484
411 nmdc:mga05p37_185719_c1 3300050507 Bacteria 2528
412 nmdc:mga05p37_2482_c1 3300050507 Bacteria 21469
413 nmdc:mga05p37_285864_c1 3300050507 Bacteria 1965
414 nmdc:mga05p37_5911_c1 3300050507 Bacteria 14393
415 nmdc:mga05p37_63031_c1 3300050507 Unclassified 4563
416 nmdc:mga05p37_63951_c1 3300050507 Viruses 4528
417 nmdc:mga05p37_6399_c2 3300050507 Bacteria 12447
418 nmdc:mga05p37_692618_c1 3300050507 Unclassified 1134
419 nmdc:mga05p37_71891_c1 3300050507 Bacteria 4257
420 nmdc:mga05p37_74507_c1 3300050507 Bacteria 4178
421 nmdc:mga05p37_76152_c1 3300050507 Bacteria 4131
422 nmdc:mga05p37_76538_c1 3300050507 Bacteria 4119
423 nmdc:mga05p37_83843_c1 3300050507 Unclassified 3927
424 nmdc:mga05p37_85727_c1 3300050507 Bacteria 3882
425 nmdc:mga05p37_87594_c1 3300050507 Bacteria 3838
426 nmdc:mga09592_151471_c1 3300050508 Unclassified 2001
427 nmdc:mga09592_156313_c1 3300050508 Bacteria 1969
428 nmdc:mga09592_156533_c1 3300050508 Unclassified 1967
429 nmdc:mga09592_19874_c1 3300050508 Bacteria 5517
430 nmdc:mga09592_27938_c1 3300050508 Bacteria 4684
431 nmdc:mga09592_595863_c1 3300050508 Unclassified 947
432 nmdc:mga09592_70861_c1 3300050508 Bacteria 2958
433 nmdc:mga09592_7922_c1 3300050508 Bacteria 8634
434 nmdc:mga09592_8238_c1 3300050508 Bacteria 8477
435 nmdc:mga09592_91842_c1 3300050508 Bacteria 2595
436 nmdc:mga0qj67_114770_c1 3300050509 Bacteria 2175
437 nmdc:mga0qj67_175143_c1 3300050509 Bacteria 1742
438 nmdc:mga0qj67_268570_c1 3300050509 Unclassified 1383
439 nmdc:mga0qj67_71011_c1 3300050509 Unclassified 2778
440 nmdc:mga06r32_121421_c1 3300050510 Unclassified 2578
441 nmdc:mga06r32_13378_c1 3300050510 Bacteria 7430
442 nmdc:mga06r32_15322_c1 3300050510 Bacteria 6965
443 nmdc:mga06r32_241343_c1 3300050510 Unclassified 1794
444 nmdc:mga06r32_260473_c1 3300050510 Bacteria 1722
445 nmdc:mga06r32_33226_c1 3300050510 Bacteria 4401
446 nmdc:mga06r32_350531_c1 3300050510 Bacteria 1461
447 nmdc:mga06r32_476283_c1 3300050510 Unclassified 1227
448 nmdc:mga06r32_58988_c1 3300050510 Bacteria 3690
449 nmdc:mga06r32_653407_c1 3300050510 Unclassified 1020
450 nmdc:mga08y16_12592_c1 3300050511 Bacteria 8897
451 nmdc:mga08y16_166378_c1 3300050511 Bacteria 2291
452 nmdc:mga08y16_196419_c1 3300050511 Unclassified 2091
453 nmdc:mga08y16_440533_c1 3300050511 Unclassified 1330
454 nmdc:mga0n895_11851_c1 3300050512 Bacteria 7797
455 nmdc:mga0n895_131286_c1 3300050512 Bacteria 2530
456 nmdc:mga0n895_150739_c1 3300050512 Unclassified 2356
457 nmdc:mga0n895_15788_c1 3300050512 Bacteria 6904
458 nmdc:mga0n895_18070_c1 3300050512 Bacteria 6518
459 nmdc:mga0n895_22995_c1 3300050512 Bacteria 5852
460 nmdc:mga0n895_242167_c1 3300050512 Unclassified 1831
461 nmdc:mga0n895_309405_c1 3300050512 Bacteria 1601
462 nmdc:mga0n895_319568_c1 3300050512 Bacteria 1573
463 nmdc:mga0n895_392636_c1 3300050512 Unclassified 1404
464 nmdc:mga0n895_58703_c1 3300050512 Bacteria 3794
465 nmdc:mga0n895_649387_c1 3300050512 Bacteria 1054
466 nmdc:mga0n895_84242_c1 3300050512 Bacteria 3172
467 nmdc:mga0n895_89961_c1 3300050512 Bacteria 3071
468 nmdc:mga0n895_9390_c1 3300050512 Bacteria 8558
469 nmdc:mga0n895_97040_c1 3300050512 Bacteria 2953
470 nmdc:mga0rr50_1138_c1 3300050513 Bacteria 14452
471 nmdc:mga0rr50_166884_c1 3300050513 Bacteria 1791
472 nmdc:mga0rr50_189732_c1 3300050513 Bacteria 1683
473 nmdc:mga0rr50_198615_c1 3300050513 Bacteria 1647
474 nmdc:mga0rr50_20717_c1 3300050513 Unclassified 4472
475 nmdc:mga0rr50_22055_c1 3300050513 Unclassified 4363
476 nmdc:mga0rr50_234737_c1 3300050513 Unclassified 1518
477 nmdc:mga0rr50_234963_c1 3300050513 Bacteria 1518
478 nmdc:mga0rr50_25715_c1 3300050513 Unclassified 4097
479 nmdc:mga0rr50_6589_c1 3300050513 Bacteria 7093
480 nmdc:mga0rr50_90323_c1 3300050513 Bacteria 2383
481 nmdc:mga08x19_17163_c1 3300050514 Bacteria 4425
482 nmdc:mga08x19_288729_c1 3300050514 Unclassified 1138
483 nmdc:mga08x19_77787_c1 3300050514 Bacteria 2173
484 nmdc:mga0a205_102935_c1 3300050515 Bacteria 2754
485 nmdc:mga0a205_115683_c1 3300050515 Bacteria 2580
486 nmdc:mga0a205_12048_c1 3300050515 Bacteria 7988
487 nmdc:mga0a205_12856_c1 3300050515 Bacteria 7765
488 nmdc:mga0a205_139318_c1 3300050515 Unclassified 2326
489 nmdc:mga0a205_14333_c1 3300050515 Bacteria 7392
490 nmdc:mga0a205_15234_c1 3300050515 Bacteria 7184
491 nmdc:mga0a205_164179_c1 3300050515 Unclassified 2117
492 nmdc:mga0a205_165663_c1 3300050515 Bacteria 2106
493 nmdc:mga0a205_196613_c1 3300050515 Bacteria 1907
494 nmdc:mga0a205_214988_c1 3300050515 Bacteria 1810
495 nmdc:mga0a205_233890_c1 3300050515 Bacteria 1720
496 nmdc:mga0a205_63575_c1 3300050515 Bacteria 3565
497 nmdc:mga0a205_6839_c1 3300050515 Bacteria 10315
498 nmdc:mga0a205_7936_c1 3300050515 Bacteria 9639
499 nmdc:mga0a205_82733_c1 3300050515 Bacteria 3101
500 nmdc:mga0a205_95355_c1 3300050515 Unclassified 2874
501 Ga0501084_0003043 3300054114 Bacteria 13591
502 Ga0501084_0115045 3300054114 Unclassified 2261
503 Ga0501082_0012815 3300060353 Bacteria 7205
504 Ga0530510_0000336 3300061734 Bacteria 30243
505 Ga0530510_0004951 3300061734 Bacteria 9199
506 Ga0207707_10015577
507 JGI25405J52794_10004896
508 Ga0065714_10090047
509 Ga0065712_10000212
510 Ga0065712_10067794
511 Ga0065712_10071415
512 Ga0065715_10000302
513 Ga0065715_10002599
514 Ga0065715_10018924
515 Ga0065715_10031065
516 Ga0065715_10094489
517 Ga0065707_10005861
518 Ga0065707_10007706
519 Ga0065707_10149659
520 Ga0065707_10220204
521 Ga0065707_10247508
522 Ga0070676_10163728
523 Ga0070690_100052555
524 Ga0070670_100036184
525 Ga0070670_100261299
526 Ga0070670_100273091
527 Ga0070677_10057256
528 Ga0068869_100244444
529 Ga0070666_10080906
530 Ga0070666_10167100
531 Ga0070680_100095309
532 Ga0070680_100125423
533 Ga0070680_100163258
534 Ga0070682_100075731
535 Ga0068868_100072873
536 Ga0068868_100290590
537 Ga0070691_10120122
538 Ga0070661_100035332
539 Ga0070661_100057067
540 Ga0070668_100233891
541 Ga0070668_100258128
542 Ga0070669_100070409
543 Ga0070675_100276583
544 Ga0070671_100011289
545 Ga0070674_100125039
546 Ga0070674_100219753
547 Ga0070673_100215583
548 Ga0070688_100179587
549 Ga0070667_100150314
550 Ga0070694_100031828
551 Ga0070694_100076346
552 Ga0070708_100230770
553 Ga0070708_100236908
554 Ga0070663_100136367
555 Ga0070678_100036698
556 Ga0070662_100018820
557 Ga0070662_100049183
558 Ga0070662_100220225
559 Ga0070662_100350263
560 Ga0070681_10002879
561 Ga0070681_10014329
562 Ga0070681_10030643
563 Ga0070681_10037767
564 Ga0070681_10087660
565 Ga0068867_100502470
566 Ga0070706_100225401
567 Ga0070706_100385571
568 Ga0070707_100317700
569 Ga0070707_100401303
570 Ga0070698_100099528
571 Ga0070698_100196320
572 Ga0070679_100028339
573 Ga0070679_100079551
574 Ga0070679_100122087
575 Ga0070679_100285403
576 Ga0070697_100136182
577 Ga0070697_100239950
578 Ga0068853_100062836
579 Ga0070672_100085037
580 Ga0070672_100155041
581 Ga0070686_100030461
582 Ga0070695_100024849
583 Ga0070696_100121870
584 Ga0070693_100179008
585 Ga0070665_100136284
586 Ga0070704_100057958
587 Ga0068855_100094830
588 Ga0068855_100187326
589 Ga0070664_100005650
590 Ga0070664_100019822
591 Ga0070664_100076978
592 Ga0070664_100247256
593 Ga0068854_100156361
594 Ga0068854_100211023
595 Ga0068856_100231415
596 Ga0068856_100306039
597 Ga0070702_100012825
598 Ga0068859_100266113
599 Ga0068859_100296206
600 Ga0068864_100304638
601 Ga0068866_10131758
602 Ga0068861_100250005
603 Ga0068863_100192787
604 Ga0068863_100274859
605 Ga0068863_100525229
606 Ga0068858_100168309
607 Ga0068860_100647102
608 Ga0081455_10000084
609 Ga0081455_10001378
610 Ga0081455_10002322
611 Ga0081455_10007338
612 Ga0081455_10024744
613 Ga0081455_10250742
614 Ga0081538_10004241
615 Ga0081538_10015632
616 Ga0081540_1010201
617 Ga0075432_10013579
618 Ga0070715_10046764
619 Ga0070712_100042318
620 Ga0097621_100175649
621 Ga0097621_100175963
622 Ga0075428_100013072
623 Ga0075428_100082100
624 Ga0075428_100110040
625 Ga0075428_100132003
626 Ga0075428_100145938
627 Ga0075428_100154095
628 Ga0075428_100209246
629 Ga0075428_100237122
630 Ga0075428_100241022
631 Ga0075428_100257322
632 Ga0075428_100326163
633 Ga0075428_100368936
634 Ga0075428_100589402
635 Ga0075430_100029937
636 Ga0075430_100070977
637 Ga0075430_100080441
638 Ga0075430_100153452
639 Ga0075430_100160115
640 Ga0075431_100014808
641 Ga0075431_100016877
642 Ga0075431_100039616
643 Ga0075431_100044465
644 Ga0075431_100108971
645 Ga0075431_100149860
646 Ga0075431_100293843
647 Ga0075431_100373608
648 Ga0075433_10003474
649 Ga0075433_10008009
650 Ga0075433_10013623
651 Ga0075433_10018041
652 Ga0075433_10018486
653 Ga0075433_10022283
654 Ga0075433_10100709
655 Ga0075433_10108507
656 Ga0075433_10185713
657 Ga0075433_10212156
658 Ga0075433_10270854
659 Ga0075433_10404952
660 Ga0075434_100002010
661 Ga0075434_100013300
662 Ga0075434_100016010
663 Ga0075434_100029969
664 Ga0075434_100030581
665 Ga0075434_100036003
666 Ga0075434_100049250
667 Ga0075434_100072844
668 Ga0075434_100085496
669 Ga0075434_100103918
670 Ga0075434_100125463
671 Ga0075434_100170368
672 Ga0075434_100201227
673 Ga0075434_100298817
674 Ga0075434_100320848
675 Ga0075434_100330293
676 Ga0075434_100330481
677 Ga0075434_100375476
678 Ga0075434_100494066
679 Ga0075429_100037584
680 Ga0075429_100071148
681 Ga0075429_100094922
682 Ga0075429_100104921
683 Ga0075429_100122986
684 Ga0075429_100148496
685 Ga0075429_100153627
686 Ga0075429_100276507
687 Ga0075429_100538722
688 Ga0068865_100031738
689 Ga0068865_100215352
690 Ga0068865_100277427
691 Ga0068865_100496188
692 Ga0075436_100009436
693 Ga0075436_100025073
694 Ga0075436_100044875
695 Ga0075436_100061815
696 Ga0075436_100282038
697 Ga0097620_100266097
698 Ga0097620_100296183
699 Ga0075435_100004303
700 Ga0075435_100013001
701 Ga0075435_100013966
702 Ga0075435_100015868
703 Ga0075435_100043013
704 Ga0075435_100045332
705 Ga0075435_100050210
706 Ga0075435_100056124
707 Ga0075435_100067059
708 Ga0075435_100080716
709 Ga0075435_100118266
710 Ga0075435_100159787
711 Ga0075435_100186525
712 Ga0111539_10058620
713 Ga0111539_10097018
714 Ga0111539_10157392
715 Ga0111539_10227119
716 Ga0105245_10147327
717 Ga0114129_10011434
718 Ga0114129_10014687
719 Ga0114129_10015635
720 Ga0114129_10021706
721 Ga0114129_10024908
722 Ga0114129_10034655
723 Ga0114129_10035824
724 Ga0114129_10072700
725 Ga0114129_10077565
726 Ga0114129_10081061
727 Ga0114129_10088184
728 Ga0114129_10095733
729 Ga0114129_10106503
730 Ga0114129_10162384
731 Ga0114129_10177307
732 Ga0114129_10200144
733 Ga0114129_10227482
734 Ga0114129_10399772
735 Ga0114129_10405318
736 Ga0114129_10474996
737 Ga0114129_10484869
738 Ga0114129_10677500
739 Ga0114129_10682298
740 Ga0105243_10214201
741 Ga0105243_10444441
742 Ga0105241_10181261
743 Ga0105242_10130926
744 Ga0105242_10343071
745 Ga0105237_10366208
746 Ga0105249_10050051
747 Ga0105249_10083657
748 Ga0105249_10394641
749 Ga0105239_10069340
750 Ga0105239_10182112
751 Ga0105246_10141928
752 Ga0157373_10036035
753 Ga0157371_10113134
754 Ga0157374_10059967
755 Ga0157374_10402312
756 Ga0157378_10019351
757 Ga0157378_10031471
758 Ga0157378_10083144
759 Ga0157378_10124313
760 Ga0157378_10145574
761 Ga0157378_10188100
762 Ga0157378_10206535
763 Ga0157378_10317342
764 Ga0163162_10037200
765 Ga0163162_10043778
766 Ga0163162_10193120
767 Ga0163162_10364655
768 Ga0157372_10476243
769 Ga0157372_10476751
770 Ga0157375_10114406
771 Ga0157375_10513609
772 Ga0157375_10526614
773 Ga0163163_10262241
774 Ga0157376_10054581
775 Ga0157376_10490208
776 Ga0182007_10027211
777 Ga0163161_10235687
778 Ga0163161_10376612
779 Ga0207697_10006537
780 Ga0207697_10017365
781 Ga0207682_10128914
782 Ga0207688_10014138
783 Ga0207688_10051470
784 Ga0207645_10003317
785 Ga0207645_10014855
786 Ga0207684_10181723
787 Ga0207654_10301124
788 Ga0207707_10000954
789 Ga0207707_10008194
790 Ga0207707_10008717
791 Ga0207707_10013778
792 Ga0207707_10171463
793 Ga0207663_10130437
794 Ga0207660_10009084
795 Ga0207660_10056196
796 Ga0207657_10008787
797 Ga0207649_10133360
798 Ga0207652_10011440
799 Ga0207652_10077255
800 Ga0207652_10103781
801 Ga0207681_10111643
802 Ga0207650_10016238
803 Ga0207650_10238818
804 Ga0207644_10026528
805 Ga0207690_10452628
806 Ga0207706_10010676
807 Ga0207706_10022739
808 Ga0207706_10026544
809 Ga0207706_10068074
810 Ga0207686_10065908
811 Ga0207686_10327850
812 Ga0207709_10336093
813 Ga0207670_10253937
814 Ga0207665_10066244
815 Ga0207691_10006273
816 Ga0207691_10030278
817 Ga0207689_10072715
818 Ga0207661_10092795
819 Ga0207679_10005990
820 Ga0207679_10033962
821 Ga0207679_10111071
822 Ga0207679_10114007
823 Ga0207667_10361398
824 Ga0207651_10500228
825 Ga0207677_10177864
826 Ga0207678_10068537
827 Ga0207678_10099792
828 Ga0207708_10087282
829 Ga0207641_10120761
830 Ga0207641_10247668
831 Ga0207648_10116543
832 Ga0207648_10275404
833 Ga0207676_10249157
834 Ga0207676_10284692
835 Ga0207674_10294865
836 Ga0207675_100189135
837 Ga0207683_10000890
838 Ga0207683_10020533
839 Ga0209983_1021551
840 Ga0209971_1010013
841 Ga0209971_1035315
842 Ga0207428_10015310
843 Ga0207428_10196143
844 Ga0307410_10005637
845 Ga0307412_10125317
846 Ga0307409_100025598
847 Ga0307416_100028606
848 Ga0307414_10040784
849 Ga0307411_10012091
850 Ga0307415_100020949
851 Ga0373951_0018483
852 Ga0373936_0117578
853 Ga0373931_0002443
854 Ga0373931_0004279
855 Ga0373931_0027976
856 Ga0373931_0074284
857 Ga0373931_0170228
858 Ga0373935_0045426
859 Ga0373927_0127384
860 Ga0373925_0110464
861 Ga0451577_0560960
862 Ga0453684_0458035
863 Ga0451576_0144756
864 Ga0451576_0577070
865 Ga0451576_0664926
866 Ga0495580_0072680
867 Ga0495580_0127950
868 Ga0495644_0073422
869 Ga0495633_0154379
870 Ga0495659_0008733
871 Ga0496100_0264054
872 Ga0496102_0142739
873 Ga0496108_0148267
874 Ga0496111_0193498
875 Ga0496112_0005186
876 Ga0496112_0012741
877 Ga0496112_0060889
878 Ga0496112_0342380
879 Ga0496112_0365209
880 Ga0496113_0128407
881 Ga0501299_011063
882 Ga0501033_0047128
883 Ga0501036_0082029
884 Ga0501038_0022269
885 Ga0501039_0001841
886 Ga0501040_0001713
887 Ga0501041_0000023
888 Ga0501041_0124365
889 Ga0501042_0067001
890 Ga0501046_0060342
891 Ga0501046_0141297
892 Ga0501048_0007425
893 Ga0501048_0250003
894 Ga0501068_0281468
895 Ga0501071_0001597
896 Ga0501072_0052765
897 Ga0501072_0163226
898 Ga0501074_0145769
899 Ga0501075_0023610
900 Ga0501075_0249212
901 Ga0501076_0002160
902 Ga0501077_0004839
903 Ga0501216_019764
904 Ga0501217_004322
905 Ga0501079_0015327
906 Ga0501079_0304727
907 Ga0501081_0005453
908 Ga0501081_0281093
909 Ga0501045_0001165
910 Ga0501045_0202870
911 Ga0501204_002865
912 nmdc:mga05p37_103760_c1
913 nmdc:mga05p37_15366_c1
914 nmdc:mga05p37_18047_c1
915 nmdc:mga05p37_18215_c1
916 nmdc:mga05p37_185719_c1
917 nmdc:mga05p37_2482_c1
918 nmdc:mga05p37_285864_c1
919 nmdc:mga05p37_5911_c1
920 nmdc:mga05p37_63031_c1
921 nmdc:mga05p37_63951_c1
922 nmdc:mga05p37_6399_c2
923 nmdc:mga05p37_692618_c1
924 nmdc:mga05p37_71891_c1
925 nmdc:mga05p37_74507_c1
926 nmdc:mga05p37_76152_c1
927 nmdc:mga05p37_76538_c1
928 nmdc:mga05p37_83843_c1
929 nmdc:mga05p37_85727_c1
930 nmdc:mga05p37_87594_c1
931 nmdc:mga09592_151471_c1
932 nmdc:mga09592_156313_c1
933 nmdc:mga09592_156533_c1
934 nmdc:mga09592_19874_c1
935 nmdc:mga09592_27938_c1
936 nmdc:mga09592_595863_c1
937 nmdc:mga09592_70861_c1
938 nmdc:mga09592_7922_c1
939 nmdc:mga09592_8238_c1
940 nmdc:mga09592_91842_c1
941 nmdc:mga0qj67_114770_c1
942 nmdc:mga0qj67_175143_c1
943 nmdc:mga0qj67_268570_c1
944 nmdc:mga0qj67_71011_c1
945 nmdc:mga06r32_121421_c1
946 nmdc:mga06r32_13378_c1
947 nmdc:mga06r32_15322_c1
948 nmdc:mga06r32_241343_c1
949 nmdc:mga06r32_260473_c1
950 nmdc:mga06r32_33226_c1
951 nmdc:mga06r32_350531_c1
952 nmdc:mga06r32_476283_c1
953 nmdc:mga06r32_58988_c1
954 nmdc:mga06r32_653407_c1
955 nmdc:mga08y16_12592_c1
956 nmdc:mga08y16_166378_c1
957 nmdc:mga08y16_196419_c1
958 nmdc:mga08y16_440533_c1
959 nmdc:mga0n895_11851_c1
960 nmdc:mga0n895_131286_c1
961 nmdc:mga0n895_150739_c1
962 nmdc:mga0n895_15788_c1
963 nmdc:mga0n895_18070_c1
964 nmdc:mga0n895_22995_c1
965 nmdc:mga0n895_242167_c1
966 nmdc:mga0n895_309405_c1
967 nmdc:mga0n895_319568_c1
968 nmdc:mga0n895_392636_c1
969 nmdc:mga0n895_58703_c1
970 nmdc:mga0n895_649387_c1
971 nmdc:mga0n895_84242_c1
972 nmdc:mga0n895_89961_c1
973 nmdc:mga0n895_9390_c1
974 nmdc:mga0n895_97040_c1
975 nmdc:mga0rr50_1138_c1
976 nmdc:mga0rr50_166884_c1
977 nmdc:mga0rr50_189732_c1
978 nmdc:mga0rr50_198615_c1
979 nmdc:mga0rr50_20717_c1
980 nmdc:mga0rr50_22055_c1
981 nmdc:mga0rr50_234737_c1
982 nmdc:mga0rr50_234963_c1
983 nmdc:mga0rr50_25715_c1
984 nmdc:mga0rr50_6589_c1
985 nmdc:mga0rr50_90323_c1
986 nmdc:mga08x19_17163_c1
987 nmdc:mga08x19_288729_c1
988 nmdc:mga08x19_77787_c1
989 nmdc:mga0a205_102935_c1
990 nmdc:mga0a205_115683_c1
991 nmdc:mga0a205_12048_c1
992 nmdc:mga0a205_12856_c1
993 nmdc:mga0a205_139318_c1
994 nmdc:mga0a205_14333_c1
995 nmdc:mga0a205_15234_c1
996 nmdc:mga0a205_164179_c1
997 nmdc:mga0a205_165663_c1
998 nmdc:mga0a205_196613_c1
999 nmdc:mga0a205_214988_c1
1000 nmdc:mga0a205_233890_c1
1001 nmdc:mga0a205_63575_c1
1002 nmdc:mga0a205_6839_c1
1003 nmdc:mga0a205_7936_c1
1004 nmdc:mga0a205_82733_c1
1005 nmdc:mga0a205_95355_c1
1006 Ga0501084_0003043
1007 Ga0501084_0115045
1008 Ga0501082_0012815
1009 Ga0530510_0000336
1010 Ga0530510_0004951

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09084

NMT1

NMT1/THI5 like

83

292

0.84

PF16868

NMT1_3

NMT1-like family

78

234

0.83

PF13379

NMT1_2

NMT1-like family

72

300

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8141 3 279
3uif-assembly1.cif.gz_A crystal structure of putative sulfonate abc transporter, periplasmic sulfonate-binding protein ssua from methylobacillus flagellatus kt 0.8086 3 293
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8036 1 272
3uif-assembly1.cif.gz_A crystal structure of putative sulfonate abc transporter, periplasmic sulfonate-binding protein ssua from methylobacillus flagellatus kt 0.8013 3 293
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.7719 3 279
ID Description Score Start End Superfamily
2i4cA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8486 81 172 3.40.190.10
1zbmA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8434 79 174 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8302 80 174 3.40.190.10
2g29A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8286 80 175 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8266 77 176 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A535BIQ0-F1-model_v4 ABC transporter substrate-binding protein 0.9612 93 293 GO:0042918
AF-A0A535BIQ0-F1-model_v4 ABC transporter substrate-binding protein 0.943 93 293 GO:0042918
AF-A0A521SAB6-F1-model_v4 ABC transporter substrate-binding protein 0.9398 2 293 GO:0042918
AF-A0A521SAB6-F1-model_v4 ABC transporter substrate-binding protein 0.9337 2 293 GO:0042918
AF-A0A1F8Y5U3-F1-model_v4 SsuA/THI5-like domain-containing protein 0.9265 2 291

Map