F456479
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 506 | 235 | 506 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_11414362|Ga0070681_114143621 |
| Length | 139 |
| Sequence | MYTHQIEERVRYGETDRMGYLYYGNYAQYYEVGRVEALRNLGLRYKDMEDSGILMPVLDLVSTFVKPALYDQLLTIRTTVTTMPTVRMFFSYEIENEEKELINYGKTTLIFFDGNKRRPCRAPAYLLEKLLPYFENKMQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 88 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 89 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 133 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 136 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 137 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 138 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 139 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 140 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 141 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 142 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 143 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 144 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 145 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 149 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 150 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 151 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 152 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 154 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 155 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 156 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 157 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 158 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 159 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 160 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 161 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 162 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 163 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 164 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 165 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 166 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 167 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 168 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 169 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 194 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 195 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 208 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 211 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 212 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 214 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 215 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 218 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 219 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 220 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 221 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 222 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 223 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 224 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 225 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 226 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 227 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 228 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 229 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 230 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 231 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 232 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 233 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 234 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.93 |
| Nodule | 0 |
| Rhizoplane | 0.59 |
| Rhizosphere | 87.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10007063 | 3300001979 | Bacteria | 4603 |
| 2 | JGI25154J39366_1017064 | 3300002738 | Bacteria | 727 |
| 3 | rootH1_10092153 | 3300003316 | Bacteria | 4275 |
| 4 | rootH2_10003376 | 3300003320 | Bacteria | 4304 |
| 5 | rootH2_10008932 | 3300003320 | Bacteria | 37271 |
| 6 | rootH2_10020101 | 3300003320 | Bacteria | 5955 |
| 7 | rootH2_10041861 | 3300003320 | Bacteria | 17793 |
| 8 | rootH2_10198091 | 3300003320 | Bacteria | 2922 |
| 9 | rootL2_10031008 | 3300003322 | Bacteria | 3017 |
| 10 | rootL2_10244506 | 3300003322 | Bacteria | 2781 |
| 11 | rootL2_10356615 | 3300003322 | Bacteria | 1800 |
| 12 | rootH1_10035779 | 3300003323 | Bacteria | 4223 |
| 13 | JGI25160J50197_1001100 | 3300003354 | Bacteria | 13814 |
| 14 | Ga0070658_10002849 | 3300005327 | Bacteria | 14369 |
| 15 | Ga0070676_10001904 | 3300005328 | Bacteria | 10604 |
| 16 | Ga0070676_10460159 | 3300005328 | Bacteria | 896 |
| 17 | Ga0070683_100006532 | 3300005329 | Bacteria | 9793 |
| 18 | Ga0070690_100308722 | 3300005330 | Bacteria | 1136 |
| 19 | Ga0070690_100322034 | 3300005330 | Bacteria | 1114 |
| 20 | Ga0070690_100682264 | 3300005330 | Bacteria | 787 |
| 21 | Ga0070670_100210781 | 3300005331 | Unclassified | 1689 |
| 22 | Ga0070670_100480412 | 3300005331 | Bacteria | 1103 |
| 23 | Ga0070670_100645837 | 3300005331 | Bacteria | 949 |
| 24 | Ga0070670_100788857 | 3300005331 | Bacteria | 857 |
| 25 | Ga0070670_100884307 | 3300005331 | Bacteria | 809 |
| 26 | Ga0070677_10101659 | 3300005333 | Bacteria | 1268 |
| 27 | Ga0068869_100079850 | 3300005334 | Bacteria | 2439 |
| 28 | Ga0068869_100738860 | 3300005334 | Bacteria | 842 |
| 29 | Ga0070666_10000028 | 3300005335 | Bacteria | 144796 |
| 30 | Ga0070666_10000885 | 3300005335 | Bacteria | 18201 |
| 31 | Ga0070666_10044926 | 3300005335 | Bacteria | 2961 |
| 32 | Ga0070680_100002380 | 3300005336 | Bacteria | 13907 |
| 33 | Ga0070680_100288952 | 3300005336 | Bacteria | 1389 |
| 34 | Ga0070682_100007128 | 3300005337 | Bacteria | 6294 |
| 35 | Ga0070682_100013688 | 3300005337 | Unclassified | 4674 |
| 36 | Ga0070682_101823490 | 3300005337 | Unclassified | 531 |
| 37 | Ga0068868_100000075 | 3300005338 | Bacteria | 58452 |
| 38 | Ga0068868_100014908 | 3300005338 | Bacteria | 5739 |
| 39 | Ga0068868_102333825 | 3300005338 | Bacteria | 510 |
| 40 | Ga0070660_100153155 | 3300005339 | Unclassified | 1855 |
| 41 | Ga0070689_100220951 | 3300005340 | Bacteria | 1554 |
| 42 | Ga0070689_101085193 | 3300005340 | Bacteria | 715 |
| 43 | Ga0070691_10009538 | 3300005341 | Bacteria | 4432 |
| 44 | Ga0070691_10023899 | 3300005341 | Bacteria | 2839 |
| 45 | Ga0070691_10549262 | 3300005341 | Unclassified | 675 |
| 46 | Ga0070668_100000859 | 3300005347 | Bacteria | 21121 |
| 47 | Ga0070675_100034074 | 3300005354 | Bacteria | 4131 |
| 48 | Ga0070675_100160092 | 3300005354 | Bacteria | 1935 |
| 49 | Ga0070675_101482557 | 3300005354 | Unclassified | 626 |
| 50 | Ga0070675_101767967 | 3300005354 | Unclassified | 570 |
| 51 | Ga0070671_100050909 | 3300005355 | Bacteria | 3445 |
| 52 | Ga0070671_100679687 | 3300005355 | Bacteria | 892 |
| 53 | Ga0070674_100113758 | 3300005356 | Bacteria | 1992 |
| 54 | Ga0070673_100000448 | 3300005364 | Bacteria | 21839 |
| 55 | Ga0070673_100006749 | 3300005364 | Bacteria | 7490 |
| 56 | Ga0070688_100073351 | 3300005365 | Bacteria | 2195 |
| 57 | Ga0070688_101576252 | 3300005365 | Bacteria | 536 |
| 58 | Ga0070659_100009989 | 3300005366 | Bacteria | 6982 |
| 59 | Ga0070667_100000482 | 3300005367 | Bacteria | 40557 |
| 60 | Ga0070667_100200810 | 3300005367 | Bacteria | 1769 |
| 61 | Ga0070667_100305837 | 3300005367 | Bacteria | 1432 |
| 62 | Ga0070667_101796270 | 3300005367 | Bacteria | 577 |
| 63 | Ga0070713_100492155 | 3300005436 | Unclassified | 1156 |
| 64 | Ga0070700_101976788 | 3300005441 | Bacteria | 505 |
| 65 | Ga0070663_100355385 | 3300005455 | Bacteria | 1187 |
| 66 | Ga0070678_100015835 | 3300005456 | Unclassified | 4804 |
| 67 | Ga0070678_100027799 | 3300005456 | Bacteria | 3846 |
| 68 | Ga0070678_100832510 | 3300005456 | Bacteria | 840 |
| 69 | Ga0070678_101511778 | 3300005456 | Unclassified | 629 |
| 70 | Ga0070681_10037887 | 3300005458 | Bacteria | 4835 |
| 71 | Ga0070681_10048304 | 3300005458 | Bacteria | 4253 |
| 72 | Ga0070681_10152052 | 3300005458 | Bacteria | 2241 |
| 73 | Ga0070681_11414362 | 3300005458 | Unclassified | 619 |
| 74 | Ga0068867_100013182 | 3300005459 | Bacteria | 5855 |
| 75 | Ga0068867_101504481 | 3300005459 | Bacteria | 627 |
| 76 | Ga0068867_101605048 | 3300005459 | Unclassified | 608 |
| 77 | Ga0070685_10032691 | 3300005466 | Bacteria | 2915 |
| 78 | Ga0070679_100031244 | 3300005530 | Bacteria | 5260 |
| 79 | Ga0070679_100032277 | 3300005530 | Bacteria | 5178 |
| 80 | Ga0070684_100002043 | 3300005535 | Bacteria | 14865 |
| 81 | Ga0070684_100103525 | 3300005535 | Bacteria | 2546 |
| 82 | Ga0068853_100006239 | 3300005539 | Bacteria | 9446 |
| 83 | Ga0068853_100006774 | 3300005539 | Bacteria | 9130 |
| 84 | Ga0068853_100029608 | 3300005539 | Bacteria | 4618 |
| 85 | Ga0068853_100050294 | 3300005539 | Bacteria | 3585 |
| 86 | Ga0068853_100358567 | 3300005539 | Unclassified | 1358 |
| 87 | Ga0070672_100000758 | 3300005543 | Bacteria | 19232 |
| 88 | Ga0070672_100098509 | 3300005543 | Bacteria | 2368 |
| 89 | Ga0070672_100183801 | 3300005543 | Unclassified | 1743 |
| 90 | Ga0070672_100284397 | 3300005543 | Bacteria | 1399 |
| 91 | Ga0070672_100392161 | 3300005543 | Bacteria | 1189 |
| 92 | Ga0070672_101002778 | 3300005543 | Bacteria | 740 |
| 93 | Ga0070693_100013591 | 3300005547 | Unclassified | 4151 |
| 94 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 95 | Ga0070665_100002163 | 3300005548 | Bacteria | 21925 |
| 96 | Ga0070665_100782773 | 3300005548 | Bacteria | 967 |
| 97 | Ga0068855_100000089 | 3300005563 | Bacteria | 110845 |
| 98 | Ga0068855_100047714 | 3300005563 | Bacteria | 5059 |
| 99 | Ga0068855_100050054 | 3300005563 | Bacteria | 4925 |
| 100 | Ga0068855_100138482 | 3300005563 | Unclassified | 2776 |
| 101 | Ga0068855_100266374 | 3300005563 | Bacteria | 1907 |
| 102 | Ga0068855_100349208 | 3300005563 | Bacteria | 1630 |
| 103 | Ga0070664_100023115 | 3300005564 | Bacteria | 5132 |
| 104 | Ga0070664_100057753 | 3300005564 | Bacteria | 3299 |
| 105 | Ga0070664_100708467 | 3300005564 | Bacteria | 938 |
| 106 | Ga0068857_100010174 | 3300005577 | Bacteria | 8177 |
| 107 | Ga0068857_100259917 | 3300005577 | Unclassified | 1593 |
| 108 | Ga0068854_100013828 | 3300005578 | Bacteria | 5308 |
| 109 | Ga0068854_100037722 | 3300005578 | Unclassified | 3394 |
| 110 | Ga0068854_100054903 | 3300005578 | Bacteria | 2867 |
| 111 | Ga0068854_100213830 | 3300005578 | Bacteria | 1522 |
| 112 | Ga0068854_100417952 | 3300005578 | Bacteria | 1113 |
| 113 | Ga0068854_100587028 | 3300005578 | Unclassified | 949 |
| 114 | Ga0068856_100008851 | 3300005614 | Bacteria | 9797 |
| 115 | Ga0068856_100076515 | 3300005614 | Bacteria | 3316 |
| 116 | Ga0068856_100079385 | 3300005614 | Bacteria | 3254 |
| 117 | Ga0068856_100315928 | 3300005614 | Bacteria | 1579 |
| 118 | Ga0068852_100000488 | 3300005616 | Bacteria | 25890 |
| 119 | Ga0068852_100018236 | 3300005616 | Bacteria | 5527 |
| 120 | Ga0068852_100097578 | 3300005616 | Bacteria | 2644 |
| 121 | Ga0068852_100306250 | 3300005616 | Bacteria | 1539 |
| 122 | Ga0068852_100381467 | 3300005616 | Bacteria | 1383 |
| 123 | Ga0068852_100508344 | 3300005616 | Bacteria | 1201 |
| 124 | Ga0068852_101220022 | 3300005616 | Bacteria | 773 |
| 125 | Ga0068852_101305214 | 3300005616 | Unclassified | 747 |
| 126 | Ga0068852_101509686 | 3300005616 | Bacteria | 694 |
| 127 | Ga0068852_101712624 | 3300005616 | Unclassified | 651 |
| 128 | Ga0068859_100000012 | 3300005617 | Bacteria | 300376 |
| 129 | Ga0068859_100027733 | 3300005617 | Bacteria | 5680 |
| 130 | Ga0068859_100487586 | 3300005617 | Bacteria | 1328 |
| 131 | Ga0068859_102364348 | 3300005617 | Unclassified | 586 |
| 132 | Ga0068864_100034417 | 3300005618 | Bacteria | 4309 |
| 133 | Ga0068864_100119280 | 3300005618 | Bacteria | 2357 |
| 134 | Ga0068864_100400092 | 3300005618 | Unclassified | 1305 |
| 135 | Ga0068864_100567040 | 3300005618 | Bacteria | 1099 |
| 136 | Ga0068864_100620449 | 3300005618 | Bacteria | 1051 |
| 137 | Ga0068866_10397269 | 3300005718 | Bacteria | 888 |
| 138 | Ga0068861_100005861 | 3300005719 | Bacteria | 8349 |
| 139 | Ga0068861_100330046 | 3300005719 | Unclassified | 1331 |
| 140 | Ga0068851_10001706 | 3300005834 | Bacteria | 9614 |
| 141 | Ga0068851_10009442 | 3300005834 | Bacteria | 4537 |
| 142 | Ga0068851_10030811 | 3300005834 | Bacteria | 2662 |
| 143 | Ga0068863_100001512 | 3300005841 | Bacteria | 22973 |
| 144 | Ga0068863_100002125 | 3300005841 | Bacteria | 19657 |
| 145 | Ga0068863_100012779 | 3300005841 | Bacteria | 8096 |
| 146 | Ga0068863_100678348 | 3300005841 | Bacteria | 1023 |
| 147 | Ga0068863_101313033 | 3300005841 | Bacteria | 730 |
| 148 | Ga0068858_100001413 | 3300005842 | Bacteria | 24658 |
| 149 | Ga0068858_100088249 | 3300005842 | Bacteria | 2885 |
| 150 | Ga0068858_100456777 | 3300005842 | Bacteria | 1231 |
| 151 | Ga0068860_100002836 | 3300005843 | Bacteria | 18019 |
| 152 | Ga0068860_100012660 | 3300005843 | Bacteria | 8298 |
| 153 | Ga0068860_100080155 | 3300005843 | Unclassified | 3105 |
| 154 | Ga0068860_100081331 | 3300005843 | Bacteria | 3081 |
| 155 | Ga0068860_100155985 | 3300005843 | Bacteria | 2200 |
| 156 | Ga0068862_100986915 | 3300005844 | Bacteria | 832 |
| 157 | Ga0081540_1029496 | 3300005983 | Bacteria | 3054 |
| 158 | Ga0081539_10000337 | 3300005985 | Bacteria | 103868 |
| 159 | Ga0070715_10429160 | 3300006163 | Unclassified | 741 |
| 160 | Ga0075366_10070147 | 3300006195 | Bacteria | 2087 |
| 161 | Ga0075366_10250892 | 3300006195 | Bacteria | 1079 |
| 162 | Ga0075366_10336226 | 3300006195 | Bacteria | 926 |
| 163 | Ga0097621_100003845 | 3300006237 | Bacteria | 10402 |
| 164 | Ga0097621_100004135 | 3300006237 | Bacteria | 10062 |
| 165 | Ga0097621_100037246 | 3300006237 | Bacteria | 3895 |
| 166 | Ga0097621_100320116 | 3300006237 | Bacteria | 1374 |
| 167 | Ga0097621_100490020 | 3300006237 | Unclassified | 1112 |
| 168 | Ga0068871_100000981 | 3300006358 | Bacteria | 19104 |
| 169 | Ga0068871_100008715 | 3300006358 | Bacteria | 7295 |
| 170 | Ga0068871_100060621 | 3300006358 | Unclassified | 3087 |
| 171 | Ga0068871_100072892 | 3300006358 | Bacteria | 2830 |
| 172 | Ga0068871_100287925 | 3300006358 | Unclassified | 1439 |
| 173 | Ga0068871_100319534 | 3300006358 | Unclassified | 1367 |
| 174 | Ga0068871_100735237 | 3300006358 | Bacteria | 906 |
| 175 | Ga0068865_100000413 | 3300006881 | Bacteria | 23842 |
| 176 | Ga0068865_100112252 | 3300006881 | Bacteria | 2013 |
| 177 | Ga0097620_100000012 | 3300006931 | Bacteria | 300376 |
| 178 | Ga0097620_100027729 | 3300006931 | Bacteria | 5680 |
| 179 | Ga0097620_100487562 | 3300006931 | Bacteria | 1328 |
| 180 | Ga0097620_102364883 | 3300006931 | Unclassified | 586 |
| 181 | Ga0105240_10003016 | 3300009093 | Bacteria | 26478 |
| 182 | Ga0105240_10005940 | 3300009093 | Bacteria | 18085 |
| 183 | Ga0105240_10025898 | 3300009093 | Bacteria | 7702 |
| 184 | Ga0105240_10035594 | 3300009093 | Bacteria | 6414 |
| 185 | Ga0105240_10079750 | 3300009093 | Unclassified | 4028 |
| 186 | Ga0105240_10105967 | 3300009093 | Bacteria | 3411 |
| 187 | Ga0105240_10246368 | 3300009093 | Unclassified | 2069 |
| 188 | Ga0105245_10063832 | 3300009098 | Bacteria | 3327 |
| 189 | Ga0105245_10592713 | 3300009098 | Unclassified | 1134 |
| 190 | Ga0105241_10000619 | 3300009174 | Bacteria | 26737 |
| 191 | Ga0105241_10003218 | 3300009174 | Bacteria | 12152 |
| 192 | Ga0105241_10577895 | 3300009174 | Bacteria | 1012 |
| 193 | Ga0105241_10583492 | 3300009174 | Bacteria | 1008 |
| 194 | Ga0105248_10165075 | 3300009177 | Bacteria | 2497 |
| 195 | Ga0105237_10002854 | 3300009545 | Bacteria | 21014 |
| 196 | Ga0105237_10004335 | 3300009545 | Bacteria | 16445 |
| 197 | Ga0105237_10008089 | 3300009545 | Bacteria | 11432 |
| 198 | Ga0105237_10016648 | 3300009545 | Bacteria | 7636 |
| 199 | Ga0105237_10044083 | 3300009545 | Bacteria | 4492 |
| 200 | Ga0105237_10226734 | 3300009545 | Bacteria | 1869 |
| 201 | Ga0105237_10348034 | 3300009545 | Unclassified | 1486 |
| 202 | Ga0105237_10368992 | 3300009545 | Archaea | 1440 |
| 203 | Ga0105237_10478580 | 3300009545 | Bacteria | 1251 |
| 204 | Ga0105238_10004631 | 3300009551 | Bacteria | 13617 |
| 205 | Ga0105238_10192895 | 3300009551 | Bacteria | 2013 |
| 206 | Ga0105238_10277545 | 3300009551 | Unclassified | 1657 |
| 207 | Ga0105249_10726768 | 3300009553 | Bacteria | 1054 |
| 208 | Ga0105239_10000905 | 3300010375 | Bacteria | 42180 |
| 209 | Ga0105239_10002298 | 3300010375 | Bacteria | 24404 |
| 210 | Ga0105239_10004164 | 3300010375 | Bacteria | 17372 |
| 211 | Ga0105239_10005517 | 3300010375 | Bacteria | 14819 |
| 212 | Ga0105239_10128588 | 3300010375 | Bacteria | 2816 |
| 213 | Ga0105239_10193214 | 3300010375 | Unclassified | 2279 |
| 214 | Ga0105239_10214043 | 3300010375 | Bacteria | 2160 |
| 215 | Ga0105239_10299388 | 3300010375 | Unclassified | 1811 |
| 216 | Ga0105239_10395022 | 3300010375 | Bacteria | 1565 |
| 217 | Ga0105239_11536912 | 3300010375 | Unclassified | 769 |
| 218 | Ga0157373_10076517 | 3300013100 | Bacteria | 2361 |
| 219 | Ga0157371_10081651 | 3300013102 | Bacteria | 2289 |
| 220 | Ga0157371_10311278 | 3300013102 | Bacteria | 1141 |
| 221 | Ga0157371_10371068 | 3300013102 | Bacteria | 1044 |
| 222 | Ga0157370_10010896 | 3300013104 | Bacteria | 9549 |
| 223 | Ga0157370_10195689 | 3300013104 | Bacteria | 1876 |
| 224 | Ga0157370_10645765 | 3300013104 | Bacteria | 967 |
| 225 | Ga0157370_10883211 | 3300013104 | Bacteria | 812 |
| 226 | Ga0157369_10008242 | 3300013105 | Bacteria | 11946 |
| 227 | Ga0157369_10042894 | 3300013105 | Bacteria | 4934 |
| 228 | Ga0157369_10086327 | 3300013105 | Unclassified | 3351 |
| 229 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 230 | Ga0157374_10002589 | 3300013296 | Bacteria | 15240 |
| 231 | Ga0157374_10005519 | 3300013296 | Bacteria | 10633 |
| 232 | Ga0157374_10018369 | 3300013296 | Bacteria | 6169 |
| 233 | Ga0157374_10093356 | 3300013296 | Bacteria | 2873 |
| 234 | Ga0157374_10137592 | 3300013296 | Bacteria | 2369 |
| 235 | Ga0157378_10006348 | 3300013297 | Bacteria | 10343 |
| 236 | Ga0157378_10128879 | 3300013297 | Bacteria | 2340 |
| 237 | Ga0157378_10260104 | 3300013297 | Bacteria | 1665 |
| 238 | Ga0157378_10602014 | 3300013297 | Bacteria | 1110 |
| 239 | Ga0163162_10000377 | 3300013306 | Bacteria | 40533 |
| 240 | Ga0163162_10000448 | 3300013306 | Bacteria | 38173 |
| 241 | Ga0163162_10000634 | 3300013306 | Bacteria | 32545 |
| 242 | Ga0163162_10001972 | 3300013306 | Bacteria | 19287 |
| 243 | Ga0163162_10031603 | 3300013306 | Bacteria | 5252 |
| 244 | Ga0163162_10269152 | 3300013306 | Bacteria | 1835 |
| 245 | Ga0157372_10001344 | 3300013307 | Bacteria | 26596 |
| 246 | Ga0157372_10002881 | 3300013307 | Bacteria | 18600 |
| 247 | Ga0157372_10032732 | 3300013307 | Bacteria | 5704 |
| 248 | Ga0157372_10095147 | 3300013307 | Bacteria | 3393 |
| 249 | Ga0157372_10131249 | 3300013307 | Bacteria | 2882 |
| 250 | Ga0157372_10140939 | 3300013307 | Unclassified | 2777 |
| 251 | Ga0157372_10277296 | 3300013307 | Bacteria | 1949 |
| 252 | Ga0157372_10572666 | 3300013307 | Unclassified | 1316 |
| 253 | Ga0157372_10842445 | 3300013307 | Bacteria | 1065 |
| 254 | Ga0157375_10000989 | 3300013308 | Bacteria | 24572 |
| 255 | Ga0157375_10335179 | 3300013308 | Bacteria | 1678 |
| 256 | Ga0157375_10392828 | 3300013308 | Bacteria | 1554 |
| 257 | Ga0157375_12202165 | 3300013308 | Unclassified | 657 |
| 258 | Ga0163163_10000752 | 3300014325 | Bacteria | 27543 |
| 259 | Ga0163163_10647837 | 3300014325 | Bacteria | 1120 |
| 260 | Ga0163163_12190509 | 3300014325 | Unclassified | 612 |
| 261 | Ga0157380_10001033 | 3300014326 | Bacteria | 17764 |
| 262 | Ga0157379_10000440 | 3300014968 | Bacteria | 33697 |
| 263 | Ga0157379_10031736 | 3300014968 | Bacteria | 4706 |
| 264 | Ga0157379_10169285 | 3300014968 | Bacteria | 1972 |
| 265 | Ga0157379_10516026 | 3300014968 | Bacteria | 1109 |
| 266 | Ga0157376_10000381 | 3300014969 | Bacteria | 28821 |
| 267 | Ga0157376_10001182 | 3300014969 | Bacteria | 17205 |
| 268 | Ga0157376_10002491 | 3300014969 | Bacteria | 12466 |
| 269 | Ga0157376_10205195 | 3300014969 | Bacteria | 1816 |
| 270 | Ga0157376_10309716 | 3300014969 | Bacteria | 1498 |
| 271 | Ga0157376_10386594 | 3300014969 | Unclassified | 1349 |
| 272 | Ga0157376_10532740 | 3300014969 | Bacteria | 1160 |
| 273 | Ga0157376_10554247 | 3300014969 | Unclassified | 1138 |
| 274 | Ga0213876_10015475 | 3300021384 | Bacteria | 4036 |
| 275 | Ga0209646_1001770 | 3300025246 | Bacteria | 5417 |
| 276 | Ga0207426_1000023 | 3300025302 | Bacteria | 545465 |
| 277 | Ga0207656_10151806 | 3300025321 | Bacteria | 1097 |
| 278 | Ga0207682_10254445 | 3300025893 | Bacteria | 818 |
| 279 | Ga0207680_10080059 | 3300025903 | Bacteria | 2050 |
| 280 | Ga0207654_10046381 | 3300025911 | Bacteria | 2478 |
| 281 | Ga0207654_10543089 | 3300025911 | Bacteria | 825 |
| 282 | Ga0207654_10550543 | 3300025911 | Bacteria | 819 |
| 283 | Ga0207707_10013305 | 3300025912 | Bacteria | 7172 |
| 284 | Ga0207707_10025996 | 3300025912 | Bacteria | 5119 |
| 285 | Ga0207707_10234688 | 3300025912 | Bacteria | 1596 |
| 286 | Ga0207707_10667624 | 3300025912 | Unclassified | 875 |
| 287 | Ga0207695_10000071 | 3300025913 | Bacteria | 315568 |
| 288 | Ga0207695_10000084 | 3300025913 | Bacteria | 282392 |
| 289 | Ga0207695_10002195 | 3300025913 | Bacteria | 29420 |
| 290 | Ga0207695_10006026 | 3300025913 | Bacteria | 15840 |
| 291 | Ga0207695_10008205 | 3300025913 | Bacteria | 13116 |
| 292 | Ga0207695_10015773 | 3300025913 | Bacteria | 8877 |
| 293 | Ga0207695_10024694 | 3300025913 | Bacteria | 6752 |
| 294 | Ga0207671_10067982 | 3300025914 | Bacteria | 2654 |
| 295 | Ga0207671_10193844 | 3300025914 | Bacteria | 1585 |
| 296 | Ga0207671_10494546 | 3300025914 | Bacteria | 975 |
| 297 | Ga0207671_11047444 | 3300025914 | Unclassified | 642 |
| 298 | Ga0207660_10013039 | 3300025917 | Bacteria | 5443 |
| 299 | Ga0207657_10005086 | 3300025919 | Bacteria | 13782 |
| 300 | Ga0207657_10298334 | 3300025919 | Unclassified | 1277 |
| 301 | Ga0207652_10008417 | 3300025921 | Bacteria | 8302 |
| 302 | Ga0207681_10573754 | 3300025923 | Bacteria | 930 |
| 303 | Ga0207694_10193818 | 3300025924 | Bacteria | 1652 |
| 304 | Ga0207650_10078318 | 3300025925 | Unclassified | 2501 |
| 305 | Ga0207650_10206710 | 3300025925 | Unclassified | 1575 |
| 306 | Ga0207659_10045229 | 3300025926 | Bacteria | 3102 |
| 307 | Ga0207700_10637190 | 3300025928 | Unclassified | 950 |
| 308 | Ga0207644_10087315 | 3300025931 | Bacteria | 2318 |
| 309 | Ga0207644_10438269 | 3300025931 | Bacteria | 1072 |
| 310 | Ga0207644_10662468 | 3300025931 | Bacteria | 869 |
| 311 | Ga0207690_10475549 | 3300025932 | Bacteria | 1008 |
| 312 | Ga0207706_10015444 | 3300025933 | Bacteria | 6898 |
| 313 | Ga0207686_10338277 | 3300025934 | Bacteria | 1130 |
| 314 | Ga0207670_10957940 | 3300025936 | Bacteria | 719 |
| 315 | Ga0207669_11424522 | 3300025937 | Bacteria | 590 |
| 316 | Ga0207704_10041366 | 3300025938 | Bacteria | 2702 |
| 317 | Ga0207691_10045364 | 3300025940 | Unclassified | 4041 |
| 318 | Ga0207691_10216771 | 3300025940 | Bacteria | 1661 |
| 319 | Ga0207691_10335631 | 3300025940 | Bacteria | 1294 |
| 320 | Ga0207691_11753945 | 3300025940 | Bacteria | 501 |
| 321 | Ga0207689_10370668 | 3300025942 | Bacteria | 1191 |
| 322 | Ga0207689_10870660 | 3300025942 | Bacteria | 760 |
| 323 | Ga0207661_10011018 | 3300025944 | Bacteria | 6534 |
| 324 | Ga0207667_10000177 | 3300025949 | Bacteria | 92852 |
| 325 | Ga0207667_10017709 | 3300025949 | Bacteria | 8014 |
| 326 | Ga0207667_10022196 | 3300025949 | Bacteria | 7019 |
| 327 | Ga0207667_10055650 | 3300025949 | Bacteria | 4158 |
| 328 | Ga0207667_10113006 | 3300025949 | Unclassified | 2800 |
| 329 | Ga0207651_10056467 | 3300025960 | Bacteria | 2702 |
| 330 | Ga0207651_11397716 | 3300025960 | Unclassified | 630 |
| 331 | Ga0207640_10029200 | 3300025981 | Unclassified | 3382 |
| 332 | Ga0207640_10064004 | 3300025981 | Bacteria | 2447 |
| 333 | Ga0207640_10186571 | 3300025981 | Bacteria | 1560 |
| 334 | Ga0207640_10240389 | 3300025981 | Bacteria | 1399 |
| 335 | Ga0207658_10603337 | 3300025986 | Unclassified | 986 |
| 336 | Ga0207677_10012864 | 3300026023 | Bacteria | 4831 |
| 337 | Ga0207677_10019483 | 3300026023 | Bacteria | 4098 |
| 338 | Ga0207703_10437898 | 3300026035 | Bacteria | 1219 |
| 339 | Ga0207703_11930225 | 3300026035 | Unclassified | 567 |
| 340 | Ga0207639_10088106 | 3300026041 | Bacteria | 2476 |
| 341 | Ga0207639_10115315 | 3300026041 | Unclassified | 2197 |
| 342 | Ga0207639_10460275 | 3300026041 | Bacteria | 1156 |
| 343 | Ga0207639_10548962 | 3300026041 | Bacteria | 1061 |
| 344 | Ga0207639_11964304 | 3300026041 | Unclassified | 546 |
| 345 | Ga0207702_10029222 | 3300026078 | Bacteria | 4586 |
| 346 | Ga0207702_10280242 | 3300026078 | Bacteria | 1576 |
| 347 | Ga0207641_10071422 | 3300026088 | Bacteria | 2986 |
| 348 | Ga0207641_10124919 | 3300026088 | Bacteria | 2302 |
| 349 | Ga0207641_11910643 | 3300026088 | Unclassified | 595 |
| 350 | Ga0207648_10224805 | 3300026089 | Bacteria | 1669 |
| 351 | Ga0207648_10939299 | 3300026089 | Unclassified | 809 |
| 352 | Ga0207676_10299788 | 3300026095 | Unclassified | 1467 |
| 353 | Ga0207676_10970159 | 3300026095 | Unclassified | 836 |
| 354 | Ga0207674_10284681 | 3300026116 | Unclassified | 1601 |
| 355 | Ga0207675_100256482 | 3300026118 | Bacteria | 1694 |
| 356 | Ga0207683_10031758 | 3300026121 | Unclassified | 4585 |
| 357 | Ga0207683_10339901 | 3300026121 | Bacteria | 1377 |
| 358 | Ga0207698_10032709 | 3300026142 | Bacteria | 3771 |
| 359 | Ga0207698_10228028 | 3300026142 | Bacteria | 1689 |
| 360 | Ga0207698_10261487 | 3300026142 | Bacteria | 1590 |
| 361 | Ga0207698_11566532 | 3300026142 | Unclassified | 674 |
| 362 | Ga0268266_10000038 | 3300028379 | Bacteria | 325729 |
| 363 | Ga0268264_10000167 | 3300028381 | Bacteria | 146190 |
| 364 | Ga0268264_10011712 | 3300028381 | Bacteria | 7232 |
| 365 | Ga0268264_10025631 | 3300028381 | Bacteria | 4817 |
| 366 | Ga0268264_10271863 | 3300028381 | Bacteria | 1583 |
| 367 | Ga0268264_11942754 | 3300028381 | Bacteria | 598 |
| 368 | Ga0307515_10000039 | 3300028794 | Bacteria | 323229 |
| 369 | Ga0307515_10548216 | 3300028794 | Bacteria | 766 |
| 370 | Ga0265338_10246535 | 3300028800 | Bacteria | 1320 |
| 371 | Ga0265324_10048398 | 3300029957 | Bacteria | 1462 |
| 372 | Ga0307511_10003621 | 3300030521 | Bacteria | 15822 |
| 373 | Ga0265327_10306130 | 3300031251 | Unclassified | 699 |
| 374 | Ga0307513_10312479 | 3300031456 | Bacteria | 1333 |
| 375 | Ga0307513_10365218 | 3300031456 | Bacteria | 1187 |
| 376 | Ga0307509_10151057 | 3300031507 | Bacteria | 2238 |
| 377 | Ga0307508_10266851 | 3300031616 | Bacteria | 1306 |
| 378 | Ga0307516_10095407 | 3300031730 | Unclassified | 2797 |
| 379 | Ga0307507_10193150 | 3300033179 | Bacteria | 1426 |
| 380 | Ga0307510_10000528 | 3300033180 | Bacteria | 38156 |
| 381 | Ga0373944_0183128 | 3300035089 | Unclassified | 752 |
| 382 | Ga0373943_0341932 | 3300035170 | Bacteria | 856 |
| 383 | Ga0373935_0173590 | 3300035692 | Bacteria | 1476 |
| 384 | Ga0373935_0583332 | 3300035692 | Bacteria | 817 |
| 385 | Ga0373937_0074630 | 3300036401 | Bacteria | 3130 |
| 386 | Ga0373937_1946524 | 3300036401 | Bacteria | 534 |
| 387 | Ga0373925_0352005 | 3300037068 | Unclassified | 1196 |
| 388 | Ga0373925_0814840 | 3300037068 | Bacteria | 770 |
| 389 | Ga0395899_0285597 | 3300037312 | Unclassified | 1121 |
| 390 | Ga0395901_0861103 | 3300038443 | Bacteria | 891 |
| 391 | Ga0395901_0937462 | 3300038443 | Unclassified | 845 |
| 392 | Ga0436365_1107423 | 3300039437 | Bacteria | 15965 |
| 393 | Ga0436365_1715184 | 3300039437 | Bacteria | 1561 |
| 394 | Ga0439439_0017796 | 3300041406 | Bacteria | 1751 |
| 395 | Ga0451798_0192664 | 3300041458 | Bacteria | 521 |
| 396 | Ga0451800_1552141 | 3300041459 | Bacteria | 683 |
| 397 | Ga0451839_0520964 | 3300041496 | Unclassified | 617 |
| 398 | Ga0451851_0290747 | 3300041507 | Bacteria | 601 |
| 399 | Ga0451851_0544823 | 3300041507 | Unclassified | 1023 |
| 400 | Ga0439449_0047559 | 3300042007 | Bacteria | 1588 |
| 401 | Ga0439455_0230035 | 3300042012 | Bacteria | 540 |
| 402 | Ga0439457_003645 | 3300042014 | Bacteria | 4163 |
| 403 | Ga0439457_149347 | 3300042014 | Bacteria | 562 |
| 404 | Ga0439462_0012746 | 3300042015 | Bacteria | 2150 |
| 405 | Ga0451577_1352815 | 3300042876 | Bacteria | 632 |
| 406 | Ga0466969_0000746 | 3300044656 | Bacteria | 17610 |
| 407 | Ga0466972_0000004 | 3300044658 | Bacteria | 314413 |
| 408 | Ga0466972_0000038 | 3300044658 | Bacteria | 135937 |
| 409 | Ga0466972_0042946 | 3300044658 | Bacteria | 2196 |
| 410 | Ga0466972_0281822 | 3300044658 | Bacteria | 777 |
| 411 | Ga0466966_0001759 | 3300044684 | Bacteria | 14029 |
| 412 | Ga0466964_0862073 | 3300044706 | Unclassified | 516 |
| 413 | Ga0466971_0049048 | 3300044719 | Unclassified | 1899 |
| 414 | Ga0466970_0001727 | 3300044765 | Bacteria | 10525 |
| 415 | Ga0466970_0028363 | 3300044765 | Unclassified | 2940 |
| 416 | Ga0466957_0001679 | 3300044842 | Bacteria | 11631 |
| 417 | Ga0466957_0094917 | 3300044842 | Bacteria | 1873 |
| 418 | Ga0466959_0000056 | 3300045049 | Bacteria | 78465 |
| 419 | Ga0466959_0002096 | 3300045049 | Bacteria | 12611 |
| 420 | Ga0495629_0055163 | 3300046459 | Bacteria | 2779 |
| 421 | Ga0495638_0021712 | 3300046460 | Bacteria | 4223 |
| 422 | Ga0495638_0190953 | 3300046460 | Bacteria | 1162 |
| 423 | Ga0495662_0048235 | 3300046476 | Bacteria | 2056 |
| 424 | Ga0495606_0083515 | 3300046507 | Bacteria | 1980 |
| 425 | Ga0495628_0282321 | 3300046516 | Bacteria | 1233 |
| 426 | Ga0495630_0127460 | 3300046517 | Bacteria | 1932 |
| 427 | Ga0495632_0230178 | 3300046519 | Bacteria | 836 |
| 428 | Ga0495648_0001092 | 3300046524 | Bacteria | 27599 |
| 429 | Ga0495665_0088063 | 3300046531 | Bacteria | 1632 |
| 430 | Ga0495633_0032150 | 3300046558 | Bacteria | 2537 |
| 431 | Ga0495668_0002497 | 3300046616 | Bacteria | 15047 |
| 432 | Ga0495634_0776850 | 3300046642 | Unclassified | 547 |
| 433 | Ga0495611_0042739 | 3300046648 | Bacteria | 2024 |
| 434 | Ga0495625_0260277 | 3300046660 | Bacteria | 1123 |
| 435 | Ga0495635_0146062 | 3300046663 | Bacteria | 1610 |
| 436 | Ga0495658_0021382 | 3300046683 | Bacteria | 3410 |
| 437 | Ga0495658_0374843 | 3300046683 | Bacteria | 906 |
| 438 | Ga0495613_0157097 | 3300046689 | Bacteria | 1620 |
| 439 | Ga0495670_0113617 | 3300046691 | Bacteria | 1403 |
| 440 | Ga0495649_0040228 | 3300046694 | Bacteria | 2561 |
| 441 | Ga0495600_0149724 | 3300046809 | Bacteria | 1511 |
| 442 | Ga0495604_0077659 | 3300047317 | Bacteria | 2495 |
| 443 | Ga0495674_0030716 | 3300047319 | Bacteria | 4883 |
| 444 | Ga0495674_0262514 | 3300047319 | Bacteria | 1419 |
| 445 | Ga0495674_0461317 | 3300047319 | Unclassified | 1020 |
| 446 | Ga0495674_1274188 | 3300047319 | Unclassified | 553 |
| 447 | Ga0495684_0082936 | 3300047471 | Bacteria | 2432 |
| 448 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 449 | Ga0496105_0460551 | 3300048908 | Bacteria | 1003 |
| 450 | Ga0496126_0811103 | 3300048929 | Unclassified | 717 |
| 451 | Ga0501036_1274885 | 3300049572 | Bacteria | 598 |
| 452 | Ga0501038_0562889 | 3300049574 | Unclassified | 866 |
| 453 | Ga0501039_0487627 | 3300049575 | Bacteria | 968 |
| 454 | Ga0501043_0507142 | 3300049579 | Bacteria | 901 |
| 455 | Ga0501043_0571647 | 3300049579 | Bacteria | 838 |
| 456 | Ga0501043_1034296 | 3300049579 | Bacteria | 583 |
| 457 | Ga0501046_0337260 | 3300049580 | Bacteria | 1096 |
| 458 | Ga0501047_0024102 | 3300049581 | Bacteria | 5845 |
| 459 | Ga0501047_0032242 | 3300049581 | Bacteria | 5057 |
| 460 | Ga0501047_0212024 | 3300049581 | Bacteria | 1795 |
| 461 | Ga0501047_0606706 | 3300049581 | Unclassified | 916 |
| 462 | Ga0501067_0080889 | 3300049583 | Unclassified | 1801 |
| 463 | Ga0501069_0067667 | 3300049585 | Unclassified | 1998 |
| 464 | Ga0501070_0111821 | 3300049586 | Unclassified | 2257 |
| 465 | Ga0501071_0151180 | 3300049587 | Unclassified | 1732 |
| 466 | Ga0501073_0060903 | 3300049589 | Unclassified | 2634 |
| 467 | Ga0501074_0399064 | 3300049590 | Bacteria | 975 |
| 468 | Ga0501219_000469 | 3300049703 | Bacteria | 6364 |
| 469 | Ga0501080_0489801 | 3300049742 | Unclassified | 1099 |
| 470 | Ga0501083_0075085 | 3300049744 | Unclassified | 2245 |
| 471 | Ga0501241_130425 | 3300049758 | Bacteria | 566 |
| 472 | Ga0501280_061553 | 3300049776 | Unclassified | 654 |
| 473 | Ga0501044_0003293 | 3300049823 | Bacteria | 18191 |
| 474 | Ga0501044_0020810 | 3300049823 | Bacteria | 7002 |
| 475 | Ga0501044_0477872 | 3300049823 | Bacteria | 1150 |
| 476 | Ga0501284_00029 | 3300050005 | Bacteria | 74818 |
| 477 | nmdc:mga0k408_29233_c1 | 3300050493 | Bacteria | 3136 |
| 478 | nmdc:mga05p37_4450_c1 | 3300050507 | Bacteria | 16377 |
| 479 | nmdc:mga08y16_130270_c1 | 3300050511 | Bacteria | 2616 |
| 480 | nmdc:mga08y16_368132_c1 | 3300050511 | Bacteria | 1474 |
| 481 | Ga0500578_0019869 | 3300053086 | Bacteria | 4316 |
| 482 | Ga0500646_0070535 | 3300053090 | Bacteria | 1047 |
| 483 | Ga0500646_0088034 | 3300053090 | Unclassified | 957 |
| 484 | Ga0500647_0145543 | 3300053091 | Bacteria | 1109 |
| 485 | Ga0500583_0000047 | 3300053092 | Bacteria | 78958 |
| 486 | Ga0500583_0024358 | 3300053092 | Bacteria | 2566 |
| 487 | Ga0500583_0116992 | 3300053092 | Unclassified | 1317 |
| 488 | Ga0500651_0327372 | 3300053093 | Bacteria | 874 |
| 489 | Ga0500650_0397273 | 3300053098 | Bacteria | 597 |
| 490 | Ga0500556_0305456 | 3300053104 | Bacteria | 621 |
| 491 | Ga0500557_197618 | 3300053105 | Unclassified | 648 |
| 492 | Ga0500642_0351008 | 3300053130 | Unclassified | 654 |
| 493 | Ga0500658_0226274 | 3300053134 | Bacteria | 858 |
| 494 | Ga0500658_0429518 | 3300053134 | Bacteria | 603 |
| 495 | Ga0500559_0357263 | 3300053136 | Bacteria | 683 |
| 496 | Ga0500559_0482294 | 3300053136 | Bacteria | 571 |
| 497 | Ga0500568_0129303 | 3300053139 | Bacteria | 939 |
| 498 | Ga0500573_0441182 | 3300053140 | Unclassified | 604 |
| 499 | Ga0500604_0022496 | 3300053151 | Unclassified | 1790 |
| 500 | Ga0500622_0002825 | 3300053156 | Bacteria | 12178 |
| 501 | Ga0500622_0130827 | 3300053156 | Bacteria | 1206 |
| 502 | Ga0500639_129917 | 3300053163 | Bacteria | 1195 |
| 503 | Ga0500637_0142902 | 3300053178 | Bacteria | 1385 |
| 504 | Ga0500637_0516504 | 3300053178 | Bacteria | 588 |
| 505 | Ga0501082_0117161 | 3300060353 | Unclassified | 2307 |
| 506 | Ga0466962_0075362 | 3300061719 | Bacteria | 1612 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037312 | Ga0395899_0285597 | Ga0395899_0285597_270_629 | 118 |
| 2 | 3300038443 | Ga0395901_0937462 | Ga0395901_0937462_467_826 | 118 |
| 3 | 3300003316 | rootH1_10092153 | rootH1_100921534 | 135 |
| 4 | 3300005327 | Ga0070658_10002849 | Ga0070658_1000284912 | 135 |
| 5 | 3300005328 | Ga0070676_10001904 | Ga0070676_100019045 | 135 |
| 6 | 3300005330 | Ga0070690_100308722 | Ga0070690_1003087222 | 135 |
| 7 | 3300005330 | Ga0070690_100322034 | Ga0070690_1003220342 | 135 |
| 8 | 3300005331 | Ga0070670_100788857 | Ga0070670_1007888572 | 135 |
| 9 | 3300005333 | Ga0070677_10101659 | Ga0070677_101016592 | 135 |
| 10 | 3300005334 | Ga0068869_100079850 | Ga0068869_1000798503 | 135 |
| 11 | 3300005335 | Ga0070666_10000028 | Ga0070666_1000002831 | 135 |
| 12 | 3300005335 | Ga0070666_10000885 | Ga0070666_1000088511 | 135 |
| 13 | 3300005337 | Ga0070682_101823490 | Ga0070682_1018234901 | 135 |
| 14 | 3300005338 | Ga0068868_100000075 | Ga0068868_10000007516 | 135 |
| 15 | 3300005338 | Ga0068868_102333825 | Ga0068868_1023338251 | 135 |
| 16 | 3300005340 | Ga0070689_100220951 | Ga0070689_1002209513 | 135 |
| 17 | 3300005347 | Ga0070668_100000859 | Ga0070668_1000008597 | 135 |
| 18 | 3300005354 | Ga0070675_100160092 | Ga0070675_1001600923 | 135 |
| 19 | 3300005355 | Ga0070671_100050909 | Ga0070671_1000509095 | 135 |
| 20 | 3300005364 | Ga0070673_100000448 | Ga0070673_1000004485 | 135 |
| 21 | 3300005365 | Ga0070688_100073351 | Ga0070688_1000733512 | 135 |
| 22 | 3300005367 | Ga0070667_100000482 | Ga0070667_10000048233 | 135 |
| 23 | 3300005367 | Ga0070667_100200810 | Ga0070667_1002008102 | 135 |
| 24 | 3300005441 | Ga0070700_101976788 | Ga0070700_1019767881 | 135 |
| 25 | 3300005455 | Ga0070663_100355385 | Ga0070663_1003553851 | 135 |
| 26 | 3300005456 | Ga0070678_100027799 | Ga0070678_1000277992 | 135 |
| 27 | 3300005456 | Ga0070678_100832510 | Ga0070678_1008325102 | 135 |
| 28 | 3300005458 | Ga0070681_11414362 | Ga0070681_114143621 | 135 |
| 29 | 3300005459 | Ga0068867_100013182 | Ga0068867_1000131825 | 135 |
| 30 | 3300005530 | Ga0070679_100031244 | Ga0070679_1000312443 | 135 |
| 31 | 3300005539 | Ga0068853_100029608 | Ga0068853_1000296084 | 135 |
| 32 | 3300005543 | Ga0070672_100000758 | Ga0070672_1000007582 | 135 |
| 33 | 3300005543 | Ga0070672_100183801 | Ga0070672_1001838013 | 135 |
| 34 | 3300005548 | Ga0070665_100002163 | Ga0070665_10000216313 | 135 |
| 35 | 3300005548 | Ga0070665_100782773 | Ga0070665_1007827731 | 135 |
| 36 | 3300005563 | Ga0068855_100050054 | Ga0068855_1000500542 | 135 |
| 37 | 3300005564 | Ga0070664_100057753 | Ga0070664_1000577533 | 135 |
| 38 | 3300005577 | Ga0068857_100010174 | Ga0068857_1000101742 | 135 |
| 39 | 3300005578 | Ga0068854_100054903 | Ga0068854_1000549032 | 135 |
| 40 | 3300005614 | Ga0068856_100076515 | Ga0068856_1000765154 | 135 |
| 41 | 3300005616 | Ga0068852_100000488 | Ga0068852_10000048815 | 135 |
| 42 | 3300005616 | Ga0068852_100097578 | Ga0068852_1000975782 | 135 |
| 43 | 3300005616 | Ga0068852_100306250 | Ga0068852_1003062501 | 135 |
| 44 | 3300005616 | Ga0068852_101220022 | Ga0068852_1012200222 | 135 |
| 45 | 3300005617 | Ga0068859_100000012 | Ga0068859_100000012213 | 135 |
| 46 | 3300005618 | Ga0068864_100034417 | Ga0068864_1000344173 | 135 |
| 47 | 3300005618 | Ga0068864_100119280 | Ga0068864_1001192803 | 135 |
| 48 | 3300005718 | Ga0068866_10397269 | Ga0068866_103972691 | 135 |
| 49 | 3300005719 | Ga0068861_100005861 | Ga0068861_1000058614 | 135 |
| 50 | 3300005834 | Ga0068851_10001706 | Ga0068851_100017064 | 135 |
| 51 | 3300005841 | Ga0068863_100001512 | Ga0068863_10000151216 | 135 |
| 52 | 3300005841 | Ga0068863_100012779 | Ga0068863_1000127796 | 135 |
| 53 | 3300005841 | Ga0068863_101313033 | Ga0068863_1013130332 | 135 |
| 54 | 3300005842 | Ga0068858_100001413 | Ga0068858_10000141316 | 135 |
| 55 | 3300005842 | Ga0068858_100088249 | Ga0068858_1000882491 | 135 |
| 56 | 3300005843 | Ga0068860_100002836 | Ga0068860_1000028369 | 135 |
| 57 | 3300005843 | Ga0068860_100012660 | Ga0068860_1000126606 | 135 |
| 58 | 3300006237 | Ga0097621_100004135 | Ga0097621_1000041352 | 135 |
| 59 | 3300006358 | Ga0068871_100000981 | Ga0068871_1000009818 | 135 |
| 60 | 3300006358 | Ga0068871_100319534 | Ga0068871_1003195342 | 135 |
| 61 | 3300006881 | Ga0068865_100000413 | Ga0068865_1000004132 | 135 |
| 62 | 3300006931 | Ga0097620_100000012 | Ga0097620_100000012213 | 135 |
| 63 | 3300009093 | Ga0105240_10035594 | Ga0105240_100355944 | 135 |
| 64 | 3300009093 | Ga0105240_10105967 | Ga0105240_101059673 | 135 |
| 65 | 3300009098 | Ga0105245_10063832 | Ga0105245_100638323 | 135 |
| 66 | 3300009098 | Ga0105245_10592713 | Ga0105245_105927132 | 135 |
| 67 | 3300009174 | Ga0105241_10000619 | Ga0105241_1000061918 | 135 |
| 68 | 3300009177 | Ga0105248_10165075 | Ga0105248_101650754 | 135 |
| 69 | 3300009545 | Ga0105237_10348034 | Ga0105237_103480342 | 135 |
| 70 | 3300009545 | Ga0105237_10478580 | Ga0105237_104785803 | 135 |
| 71 | 3300009551 | Ga0105238_10004631 | Ga0105238_100046312 | 135 |
| 72 | 3300010375 | Ga0105239_10128588 | Ga0105239_101285883 | 135 |
| 73 | 3300010375 | Ga0105239_10395022 | Ga0105239_103950223 | 135 |
| 74 | 3300013105 | Ga0157369_10042894 | Ga0157369_100428944 | 135 |
| 75 | 3300013296 | Ga0157374_10002589 | Ga0157374_1000258913 | 135 |
| 76 | 3300013296 | Ga0157374_10093356 | Ga0157374_100933562 | 135 |
| 77 | 3300013297 | Ga0157378_10006348 | Ga0157378_100063484 | 135 |
| 78 | 3300013297 | Ga0157378_10128879 | Ga0157378_101288793 | 135 |
| 79 | 3300013297 | Ga0157378_10602014 | Ga0157378_106020142 | 135 |
| 80 | 3300013306 | Ga0163162_10000377 | Ga0163162_1000037713 | 135 |
| 81 | 3300013306 | Ga0163162_10000634 | Ga0163162_1000063411 | 135 |
| 82 | 3300013307 | Ga0157372_10002881 | Ga0157372_1000288113 | 135 |
| 83 | 3300013307 | Ga0157372_10277296 | Ga0157372_102772963 | 135 |
| 84 | 3300013307 | Ga0157372_10572666 | Ga0157372_105726661 | 135 |
| 85 | 3300013308 | Ga0157375_10000989 | Ga0157375_100009892 | 135 |
| 86 | 3300014325 | Ga0163163_10000752 | Ga0163163_100007529 | 135 |
| 87 | 3300014968 | Ga0157379_10000440 | Ga0157379_1000044012 | 135 |
| 88 | 3300014968 | Ga0157379_10169285 | Ga0157379_101692853 | 135 |
| 89 | 3300014969 | Ga0157376_10000381 | Ga0157376_1000038113 | 135 |
| 90 | 3300025912 | Ga0207707_10667624 | Ga0207707_106676242 | 135 |
| 91 | 3300028381 | Ga0268264_11942754 | Ga0268264_119427541 | 135 |
| 92 | 3300042876 | Ga0451577_1352815 | Ga0451577_1352815_130_543 | 135 |
| 93 | 3300001979 | JGI24740J21852_10007063 | JGI24740J21852_100070631 | 136 |
| 94 | 3300002738 | JGI25154J39366_1017064 | JGI25154J39366_10170641 | 136 |
| 95 | 3300003320 | rootH2_10003376 | rootH2_100033763 | 136 |
| 96 | 3300003320 | rootH2_10008932 | rootH2_1000893230 | 136 |
| 97 | 3300003320 | rootH2_10020101 | rootH2_100201014 | 136 |
| 98 | 3300003320 | rootH2_10041861 | rootH2_100418612 | 136 |
| 99 | 3300003320 | rootH2_10198091 | rootH2_101980912 | 136 |
| 100 | 3300003322 | rootL2_10031008 | rootL2_100310081 | 136 |
| 101 | 3300003322 | rootL2_10244506 | rootL2_102445063 | 136 |
| 102 | 3300003322 | rootL2_10356615 | rootL2_103566152 | 136 |
| 103 | 3300003323 | rootH1_10035779 | rootH1_100357794 | 136 |
| 104 | 3300003354 | JGI25160J50197_1001100 | JGI25160J50197_100110012 | 136 |
| 105 | 3300005328 | Ga0070676_10460159 | Ga0070676_104601592 | 136 |
| 106 | 3300005329 | Ga0070683_100006532 | Ga0070683_1000065324 | 136 |
| 107 | 3300005330 | Ga0070690_100682264 | Ga0070690_1006822642 | 136 |
| 108 | 3300005331 | Ga0070670_100210781 | Ga0070670_1002107812 | 136 |
| 109 | 3300005331 | Ga0070670_100480412 | Ga0070670_1004804121 | 136 |
| 110 | 3300005331 | Ga0070670_100645837 | Ga0070670_1006458371 | 136 |
| 111 | 3300005331 | Ga0070670_100884307 | Ga0070670_1008843072 | 136 |
| 112 | 3300005334 | Ga0068869_100738860 | Ga0068869_1007388602 | 136 |
| 113 | 3300005335 | Ga0070666_10044926 | Ga0070666_100449262 | 136 |
| 114 | 3300005336 | Ga0070680_100002380 | Ga0070680_1000023809 | 136 |
| 115 | 3300005336 | Ga0070680_100288952 | Ga0070680_1002889523 | 136 |
| 116 | 3300005337 | Ga0070682_100007128 | Ga0070682_1000071285 | 136 |
| 117 | 3300005337 | Ga0070682_100013688 | Ga0070682_1000136883 | 136 |
| 118 | 3300005338 | Ga0068868_100014908 | Ga0068868_1000149084 | 136 |
| 119 | 3300005339 | Ga0070660_100153155 | Ga0070660_1001531551 | 136 |
| 120 | 3300005340 | Ga0070689_101085193 | Ga0070689_1010851931 | 136 |
| 121 | 3300005341 | Ga0070691_10009538 | Ga0070691_100095383 | 136 |
| 122 | 3300005341 | Ga0070691_10023899 | Ga0070691_100238992 | 136 |
| 123 | 3300005341 | Ga0070691_10549262 | Ga0070691_105492621 | 136 |
| 124 | 3300005354 | Ga0070675_100034074 | Ga0070675_1000340742 | 136 |
| 125 | 3300005354 | Ga0070675_101482557 | Ga0070675_1014825571 | 136 |
| 126 | 3300005354 | Ga0070675_101767967 | Ga0070675_1017679671 | 136 |
| 127 | 3300005355 | Ga0070671_100679687 | Ga0070671_1006796871 | 136 |
| 128 | 3300005356 | Ga0070674_100113758 | Ga0070674_1001137582 | 136 |
| 129 | 3300005364 | Ga0070673_100006749 | Ga0070673_1000067495 | 136 |
| 130 | 3300005365 | Ga0070688_101576252 | Ga0070688_1015762521 | 136 |
| 131 | 3300005366 | Ga0070659_100009989 | Ga0070659_1000099896 | 136 |
| 132 | 3300005367 | Ga0070667_100305837 | Ga0070667_1003058372 | 136 |
| 133 | 3300005367 | Ga0070667_101796270 | Ga0070667_1017962701 | 136 |
| 134 | 3300005436 | Ga0070713_100492155 | Ga0070713_1004921552 | 136 |
| 135 | 3300005456 | Ga0070678_100015835 | Ga0070678_1000158352 | 136 |
| 136 | 3300005456 | Ga0070678_101511778 | Ga0070678_1015117782 | 136 |
| 137 | 3300005458 | Ga0070681_10037887 | Ga0070681_100378873 | 136 |
| 138 | 3300005458 | Ga0070681_10048304 | Ga0070681_100483043 | 136 |
| 139 | 3300005458 | Ga0070681_10152052 | Ga0070681_101520523 | 136 |
| 140 | 3300005459 | Ga0068867_101504481 | Ga0068867_1015044811 | 136 |
| 141 | 3300005459 | Ga0068867_101605048 | Ga0068867_1016050482 | 136 |
| 142 | 3300005466 | Ga0070685_10032691 | Ga0070685_100326913 | 136 |
| 143 | 3300005530 | Ga0070679_100032277 | Ga0070679_1000322774 | 136 |
| 144 | 3300005535 | Ga0070684_100002043 | Ga0070684_1000020434 | 136 |
| 145 | 3300005535 | Ga0070684_100103525 | Ga0070684_1001035252 | 136 |
| 146 | 3300005539 | Ga0068853_100006239 | Ga0068853_1000062399 | 136 |
| 147 | 3300005539 | Ga0068853_100006774 | Ga0068853_1000067745 | 136 |
| 148 | 3300005539 | Ga0068853_100050294 | Ga0068853_1000502944 | 136 |
| 149 | 3300005539 | Ga0068853_100358567 | Ga0068853_1003585672 | 136 |
| 150 | 3300005543 | Ga0070672_100098509 | Ga0070672_1000985093 | 136 |
| 151 | 3300005543 | Ga0070672_100284397 | Ga0070672_1002843972 | 136 |
| 152 | 3300005543 | Ga0070672_100392161 | Ga0070672_1003921612 | 136 |
| 153 | 3300005543 | Ga0070672_101002778 | Ga0070672_1010027781 | 136 |
| 154 | 3300005547 | Ga0070693_100013591 | Ga0070693_1000135913 | 136 |
| 155 | 3300005548 | Ga0070665_100000001 | Ga0070665_100000001610 | 136 |
| 156 | 3300005563 | Ga0068855_100000089 | Ga0068855_10000008972 | 136 |
| 157 | 3300005563 | Ga0068855_100047714 | Ga0068855_1000477143 | 136 |
| 158 | 3300005563 | Ga0068855_100138482 | Ga0068855_1001384822 | 136 |
| 159 | 3300005563 | Ga0068855_100266374 | Ga0068855_1002663742 | 136 |
| 160 | 3300005563 | Ga0068855_100349208 | Ga0068855_1003492083 | 136 |
| 161 | 3300005564 | Ga0070664_100023115 | Ga0070664_1000231156 | 136 |
| 162 | 3300005564 | Ga0070664_100708467 | Ga0070664_1007084672 | 136 |
| 163 | 3300005577 | Ga0068857_100259917 | Ga0068857_1002599172 | 136 |
| 164 | 3300005578 | Ga0068854_100013828 | Ga0068854_1000138286 | 136 |
| 165 | 3300005578 | Ga0068854_100037722 | Ga0068854_1000377222 | 136 |
| 166 | 3300005578 | Ga0068854_100213830 | Ga0068854_1002138302 | 136 |
| 167 | 3300005578 | Ga0068854_100417952 | Ga0068854_1004179522 | 136 |
| 168 | 3300005578 | Ga0068854_100587028 | Ga0068854_1005870281 | 136 |
| 169 | 3300005614 | Ga0068856_100008851 | Ga0068856_1000088517 | 136 |
| 170 | 3300005614 | Ga0068856_100079385 | Ga0068856_1000793852 | 136 |
| 171 | 3300005614 | Ga0068856_100315928 | Ga0068856_1003159282 | 136 |
| 172 | 3300005616 | Ga0068852_100018236 | Ga0068852_1000182362 | 136 |
| 173 | 3300005616 | Ga0068852_100381467 | Ga0068852_1003814671 | 136 |
| 174 | 3300005616 | Ga0068852_100508344 | Ga0068852_1005083442 | 136 |
| 175 | 3300005616 | Ga0068852_101305214 | Ga0068852_1013052141 | 136 |
| 176 | 3300005616 | Ga0068852_101509686 | Ga0068852_1015096861 | 136 |
| 177 | 3300005616 | Ga0068852_101712624 | Ga0068852_1017126242 | 136 |
| 178 | 3300005617 | Ga0068859_100027733 | Ga0068859_1000277332 | 136 |
| 179 | 3300005617 | Ga0068859_100487586 | Ga0068859_1004875861 | 136 |
| 180 | 3300005617 | Ga0068859_102364348 | Ga0068859_1023643482 | 136 |
| 181 | 3300005618 | Ga0068864_100400092 | Ga0068864_1004000922 | 136 |
| 182 | 3300005618 | Ga0068864_100567040 | Ga0068864_1005670403 | 136 |
| 183 | 3300005618 | Ga0068864_100620449 | Ga0068864_1006204492 | 136 |
| 184 | 3300005719 | Ga0068861_100330046 | Ga0068861_1003300463 | 136 |
| 185 | 3300005834 | Ga0068851_10009442 | Ga0068851_100094423 | 136 |
| 186 | 3300005834 | Ga0068851_10030811 | Ga0068851_100308114 | 136 |
| 187 | 3300005841 | Ga0068863_100002125 | Ga0068863_1000021254 | 136 |
| 188 | 3300005841 | Ga0068863_100678348 | Ga0068863_1006783482 | 136 |
| 189 | 3300005842 | Ga0068858_100456777 | Ga0068858_1004567772 | 136 |
| 190 | 3300005843 | Ga0068860_100080155 | Ga0068860_1000801553 | 136 |
| 191 | 3300005843 | Ga0068860_100081331 | Ga0068860_1000813312 | 136 |
| 192 | 3300005843 | Ga0068860_100155985 | Ga0068860_1001559853 | 136 |
| 193 | 3300005844 | Ga0068862_100986915 | Ga0068862_1009869152 | 136 |
| 194 | 3300005983 | Ga0081540_1029496 | Ga0081540_10294963 | 136 |
| 195 | 3300005985 | Ga0081539_10000337 | Ga0081539_1000033791 | 136 |
| 196 | 3300006163 | Ga0070715_10429160 | Ga0070715_104291602 | 136 |
| 197 | 3300006195 | Ga0075366_10070147 | Ga0075366_100701472 | 136 |
| 198 | 3300006195 | Ga0075366_10250892 | Ga0075366_102508921 | 136 |
| 199 | 3300006195 | Ga0075366_10336226 | Ga0075366_103362261 | 136 |
| 200 | 3300006237 | Ga0097621_100003845 | Ga0097621_1000038454 | 136 |
| 201 | 3300006237 | Ga0097621_100037246 | Ga0097621_1000372462 | 136 |
| 202 | 3300006237 | Ga0097621_100320116 | Ga0097621_1003201162 | 136 |
| 203 | 3300006237 | Ga0097621_100490020 | Ga0097621_1004900202 | 136 |
| 204 | 3300006358 | Ga0068871_100008715 | Ga0068871_1000087153 | 136 |
| 205 | 3300006358 | Ga0068871_100060621 | Ga0068871_1000606212 | 136 |
| 206 | 3300006358 | Ga0068871_100072892 | Ga0068871_1000728923 | 136 |
| 207 | 3300006358 | Ga0068871_100287925 | Ga0068871_1002879251 | 136 |
| 208 | 3300006358 | Ga0068871_100735237 | Ga0068871_1007352372 | 136 |
| 209 | 3300006881 | Ga0068865_100112252 | Ga0068865_1001122522 | 136 |
| 210 | 3300006931 | Ga0097620_100027729 | Ga0097620_1000277292 | 136 |
| 211 | 3300006931 | Ga0097620_100487562 | Ga0097620_1004875621 | 136 |
| 212 | 3300006931 | Ga0097620_102364883 | Ga0097620_1023648832 | 136 |
| 213 | 3300009093 | Ga0105240_10003016 | Ga0105240_100030163 | 136 |
| 214 | 3300009093 | Ga0105240_10005940 | Ga0105240_100059408 | 136 |
| 215 | 3300009093 | Ga0105240_10025898 | Ga0105240_100258988 | 136 |
| 216 | 3300009093 | Ga0105240_10079750 | Ga0105240_100797504 | 136 |
| 217 | 3300009093 | Ga0105240_10246368 | Ga0105240_102463681 | 136 |
| 218 | 3300009174 | Ga0105241_10003218 | Ga0105241_100032183 | 136 |
| 219 | 3300009174 | Ga0105241_10577895 | Ga0105241_105778952 | 136 |
| 220 | 3300009174 | Ga0105241_10583492 | Ga0105241_105834922 | 136 |
| 221 | 3300009545 | Ga0105237_10002854 | Ga0105237_1000285414 | 136 |
| 222 | 3300009545 | Ga0105237_10004335 | Ga0105237_1000433512 | 136 |
| 223 | 3300009545 | Ga0105237_10008089 | Ga0105237_100080899 | 136 |
| 224 | 3300009545 | Ga0105237_10016648 | Ga0105237_100166482 | 136 |
| 225 | 3300009545 | Ga0105237_10044083 | Ga0105237_100440833 | 136 |
| 226 | 3300009545 | Ga0105237_10226734 | Ga0105237_102267342 | 136 |
| 227 | 3300009545 | Ga0105237_10368992 | Ga0105237_103689922 | 136 |
| 228 | 3300009551 | Ga0105238_10192895 | Ga0105238_101928952 | 136 |
| 229 | 3300009551 | Ga0105238_10277545 | Ga0105238_102775453 | 136 |
| 230 | 3300009553 | Ga0105249_10726768 | Ga0105249_107267682 | 136 |
| 231 | 3300010375 | Ga0105239_10000905 | Ga0105239_1000090519 | 136 |
| 232 | 3300010375 | Ga0105239_10002298 | Ga0105239_100022984 | 136 |
| 233 | 3300010375 | Ga0105239_10004164 | Ga0105239_1000416413 | 136 |
| 234 | 3300010375 | Ga0105239_10005517 | Ga0105239_100055175 | 136 |
| 235 | 3300010375 | Ga0105239_10193214 | Ga0105239_101932143 | 136 |
| 236 | 3300010375 | Ga0105239_10214043 | Ga0105239_102140433 | 136 |
| 237 | 3300010375 | Ga0105239_10299388 | Ga0105239_102993882 | 136 |
| 238 | 3300010375 | Ga0105239_11536912 | Ga0105239_115369122 | 136 |
| 239 | 3300013100 | Ga0157373_10076517 | Ga0157373_100765171 | 136 |
| 240 | 3300013102 | Ga0157371_10081651 | Ga0157371_100816513 | 136 |
| 241 | 3300013102 | Ga0157371_10311278 | Ga0157371_103112783 | 136 |
| 242 | 3300013102 | Ga0157371_10371068 | Ga0157371_103710682 | 136 |
| 243 | 3300013104 | Ga0157370_10010896 | Ga0157370_100108966 | 136 |
| 244 | 3300013104 | Ga0157370_10195689 | Ga0157370_101956893 | 136 |
| 245 | 3300013104 | Ga0157370_10645765 | Ga0157370_106457651 | 136 |
| 246 | 3300013104 | Ga0157370_10883211 | Ga0157370_108832112 | 136 |
| 247 | 3300013105 | Ga0157369_10008242 | Ga0157369_100082425 | 136 |
| 248 | 3300013105 | Ga0157369_10086327 | Ga0157369_100863273 | 136 |
| 249 | 3300013296 | Ga0157374_10000001 | Ga0157374_10000001311 | 136 |
| 250 | 3300013296 | Ga0157374_10005519 | Ga0157374_100055197 | 136 |
| 251 | 3300013296 | Ga0157374_10018369 | Ga0157374_100183696 | 136 |
| 252 | 3300013296 | Ga0157374_10137592 | Ga0157374_101375923 | 136 |
| 253 | 3300013297 | Ga0157378_10260104 | Ga0157378_102601042 | 136 |
| 254 | 3300013306 | Ga0163162_10000448 | Ga0163162_1000044824 | 136 |
| 255 | 3300013306 | Ga0163162_10001972 | Ga0163162_100019725 | 136 |
| 256 | 3300013306 | Ga0163162_10031603 | Ga0163162_100316034 | 136 |
| 257 | 3300013306 | Ga0163162_10269152 | Ga0163162_102691522 | 136 |
| 258 | 3300013307 | Ga0157372_10001344 | Ga0157372_1000134412 | 136 |
| 259 | 3300013307 | Ga0157372_10032732 | Ga0157372_100327323 | 136 |
| 260 | 3300013307 | Ga0157372_10095147 | Ga0157372_100951473 | 136 |
| 261 | 3300013307 | Ga0157372_10131249 | Ga0157372_101312492 | 136 |
| 262 | 3300013307 | Ga0157372_10140939 | Ga0157372_101409392 | 136 |
| 263 | 3300013307 | Ga0157372_10842445 | Ga0157372_108424452 | 136 |
| 264 | 3300013308 | Ga0157375_10335179 | Ga0157375_103351792 | 136 |
| 265 | 3300013308 | Ga0157375_10392828 | Ga0157375_103928283 | 136 |
| 266 | 3300013308 | Ga0157375_12202165 | Ga0157375_122021651 | 136 |
| 267 | 3300014325 | Ga0163163_10647837 | Ga0163163_106478372 | 136 |
| 268 | 3300014325 | Ga0163163_12190509 | Ga0163163_121905091 | 136 |
| 269 | 3300014326 | Ga0157380_10001033 | Ga0157380_100010337 | 136 |
| 270 | 3300014968 | Ga0157379_10031736 | Ga0157379_100317362 | 136 |
| 271 | 3300014968 | Ga0157379_10516026 | Ga0157379_105160262 | 136 |
| 272 | 3300014969 | Ga0157376_10001182 | Ga0157376_1000118211 | 136 |
| 273 | 3300014969 | Ga0157376_10002491 | Ga0157376_100024917 | 136 |
| 274 | 3300014969 | Ga0157376_10205195 | Ga0157376_102051952 | 136 |
| 275 | 3300014969 | Ga0157376_10309716 | Ga0157376_103097162 | 136 |
| 276 | 3300014969 | Ga0157376_10386594 | Ga0157376_103865942 | 136 |
| 277 | 3300014969 | Ga0157376_10532740 | Ga0157376_105327402 | 136 |
| 278 | 3300014969 | Ga0157376_10554247 | Ga0157376_105542471 | 136 |
| 279 | 3300021384 | Ga0213876_10015475 | Ga0213876_100154752 | 136 |
| 280 | 3300025246 | Ga0209646_1001770 | Ga0209646_10017704 | 136 |
| 281 | 3300025302 | Ga0207426_1000023 | Ga0207426_1000023156 | 136 |
| 282 | 3300025321 | Ga0207656_10151806 | Ga0207656_101518061 | 136 |
| 283 | 3300025893 | Ga0207682_10254445 | Ga0207682_102544451 | 136 |
| 284 | 3300025903 | Ga0207680_10080059 | Ga0207680_100800591 | 136 |
| 285 | 3300025911 | Ga0207654_10046381 | Ga0207654_100463811 | 136 |
| 286 | 3300025911 | Ga0207654_10543089 | Ga0207654_105430891 | 136 |
| 287 | 3300025911 | Ga0207654_10550543 | Ga0207654_105505432 | 136 |
| 288 | 3300025912 | Ga0207707_10013305 | Ga0207707_100133053 | 136 |
| 289 | 3300025912 | Ga0207707_10025996 | Ga0207707_100259963 | 136 |
| 290 | 3300025912 | Ga0207707_10234688 | Ga0207707_102346882 | 136 |
| 291 | 3300025913 | Ga0207695_10000071 | Ga0207695_10000071166 | 136 |
| 292 | 3300025913 | Ga0207695_10000084 | Ga0207695_10000084114 | 136 |
| 293 | 3300025913 | Ga0207695_10002195 | Ga0207695_100021958 | 136 |
| 294 | 3300025913 | Ga0207695_10006026 | Ga0207695_100060265 | 136 |
| 295 | 3300025913 | Ga0207695_10008205 | Ga0207695_100082059 | 136 |
| 296 | 3300025913 | Ga0207695_10015773 | Ga0207695_100157732 | 136 |
| 297 | 3300025913 | Ga0207695_10024694 | Ga0207695_100246942 | 136 |
| 298 | 3300025914 | Ga0207671_10067982 | Ga0207671_100679823 | 136 |
| 299 | 3300025914 | Ga0207671_10193844 | Ga0207671_101938442 | 136 |
| 300 | 3300025914 | Ga0207671_10494546 | Ga0207671_104945462 | 136 |
| 301 | 3300025914 | Ga0207671_11047444 | Ga0207671_110474442 | 136 |
| 302 | 3300025917 | Ga0207660_10013039 | Ga0207660_100130393 | 136 |
| 303 | 3300025919 | Ga0207657_10005086 | Ga0207657_1000508610 | 136 |
| 304 | 3300025919 | Ga0207657_10298334 | Ga0207657_102983341 | 136 |
| 305 | 3300025921 | Ga0207652_10008417 | Ga0207652_100084172 | 136 |
| 306 | 3300025923 | Ga0207681_10573754 | Ga0207681_105737542 | 136 |
| 307 | 3300025924 | Ga0207694_10193818 | Ga0207694_101938182 | 136 |
| 308 | 3300025925 | Ga0207650_10078318 | Ga0207650_100783182 | 136 |
| 309 | 3300025925 | Ga0207650_10206710 | Ga0207650_102067102 | 136 |
| 310 | 3300025926 | Ga0207659_10045229 | Ga0207659_100452292 | 136 |
| 311 | 3300025928 | Ga0207700_10637190 | Ga0207700_106371902 | 136 |
| 312 | 3300025931 | Ga0207644_10087315 | Ga0207644_100873151 | 136 |
| 313 | 3300025931 | Ga0207644_10438269 | Ga0207644_104382692 | 136 |
| 314 | 3300025931 | Ga0207644_10662468 | Ga0207644_106624681 | 136 |
| 315 | 3300025932 | Ga0207690_10475549 | Ga0207690_104755492 | 136 |
| 316 | 3300025933 | Ga0207706_10015444 | Ga0207706_100154443 | 136 |
| 317 | 3300025934 | Ga0207686_10338277 | Ga0207686_103382772 | 136 |
| 318 | 3300025936 | Ga0207670_10957940 | Ga0207670_109579401 | 136 |
| 319 | 3300025937 | Ga0207669_11424522 | Ga0207669_114245221 | 136 |
| 320 | 3300025938 | Ga0207704_10041366 | Ga0207704_100413663 | 136 |
| 321 | 3300025940 | Ga0207691_10045364 | Ga0207691_100453644 | 136 |
| 322 | 3300025940 | Ga0207691_10216771 | Ga0207691_102167712 | 136 |
| 323 | 3300025940 | Ga0207691_10335631 | Ga0207691_103356312 | 136 |
| 324 | 3300025940 | Ga0207691_11753945 | Ga0207691_117539451 | 136 |
| 325 | 3300025942 | Ga0207689_10370668 | Ga0207689_103706682 | 136 |
| 326 | 3300025942 | Ga0207689_10870660 | Ga0207689_108706602 | 136 |
| 327 | 3300025944 | Ga0207661_10011018 | Ga0207661_100110184 | 136 |
| 328 | 3300025949 | Ga0207667_10000177 | Ga0207667_1000017787 | 136 |
| 329 | 3300025949 | Ga0207667_10017709 | Ga0207667_100177092 | 136 |
| 330 | 3300025949 | Ga0207667_10022196 | Ga0207667_100221967 | 136 |
| 331 | 3300025949 | Ga0207667_10055650 | Ga0207667_100556504 | 136 |
| 332 | 3300025949 | Ga0207667_10113006 | Ga0207667_101130063 | 136 |
| 333 | 3300025960 | Ga0207651_10056467 | Ga0207651_100564673 | 136 |
| 334 | 3300025960 | Ga0207651_11397716 | Ga0207651_113977161 | 136 |
| 335 | 3300025981 | Ga0207640_10029200 | Ga0207640_100292002 | 136 |
| 336 | 3300025981 | Ga0207640_10064004 | Ga0207640_100640041 | 136 |
| 337 | 3300025981 | Ga0207640_10186571 | Ga0207640_101865712 | 136 |
| 338 | 3300025981 | Ga0207640_10240389 | Ga0207640_102403892 | 136 |
| 339 | 3300025986 | Ga0207658_10603337 | Ga0207658_106033371 | 136 |
| 340 | 3300026023 | Ga0207677_10012864 | Ga0207677_100128643 | 136 |
| 341 | 3300026023 | Ga0207677_10019483 | Ga0207677_100194834 | 136 |
| 342 | 3300026035 | Ga0207703_10437898 | Ga0207703_104378982 | 136 |
| 343 | 3300026035 | Ga0207703_11930225 | Ga0207703_119302252 | 136 |
| 344 | 3300026041 | Ga0207639_10088106 | Ga0207639_100881063 | 136 |
| 345 | 3300026041 | Ga0207639_10115315 | Ga0207639_101153153 | 136 |
| 346 | 3300026041 | Ga0207639_10460275 | Ga0207639_104602753 | 136 |
| 347 | 3300026041 | Ga0207639_10548962 | Ga0207639_105489622 | 136 |
| 348 | 3300026041 | Ga0207639_11964304 | Ga0207639_119643041 | 136 |
| 349 | 3300026078 | Ga0207702_10029222 | Ga0207702_100292222 | 136 |
| 350 | 3300026078 | Ga0207702_10280242 | Ga0207702_102802422 | 136 |
| 351 | 3300026088 | Ga0207641_10071422 | Ga0207641_100714223 | 136 |
| 352 | 3300026088 | Ga0207641_10124919 | Ga0207641_101249194 | 136 |
| 353 | 3300026088 | Ga0207641_11910643 | Ga0207641_119106432 | 136 |
| 354 | 3300026089 | Ga0207648_10224805 | Ga0207648_102248052 | 136 |
| 355 | 3300026089 | Ga0207648_10939299 | Ga0207648_109392992 | 136 |
| 356 | 3300026095 | Ga0207676_10299788 | Ga0207676_102997882 | 136 |
| 357 | 3300026095 | Ga0207676_10970159 | Ga0207676_109701592 | 136 |
| 358 | 3300026116 | Ga0207674_10284681 | Ga0207674_102846812 | 136 |
| 359 | 3300026118 | Ga0207675_100256482 | Ga0207675_1002564824 | 136 |
| 360 | 3300026121 | Ga0207683_10031758 | Ga0207683_100317582 | 136 |
| 361 | 3300026121 | Ga0207683_10339901 | Ga0207683_103399012 | 136 |
| 362 | 3300026142 | Ga0207698_10032709 | Ga0207698_100327094 | 136 |
| 363 | 3300026142 | Ga0207698_10228028 | Ga0207698_102280283 | 136 |
| 364 | 3300026142 | Ga0207698_10261487 | Ga0207698_102614872 | 136 |
| 365 | 3300026142 | Ga0207698_11566532 | Ga0207698_115665321 | 136 |
| 366 | 3300028379 | Ga0268266_10000038 | Ga0268266_1000003831 | 136 |
| 367 | 3300028381 | Ga0268264_10000167 | Ga0268264_10000167120 | 136 |
| 368 | 3300028381 | Ga0268264_10011712 | Ga0268264_100117126 | 136 |
| 369 | 3300028381 | Ga0268264_10025631 | Ga0268264_100256313 | 136 |
| 370 | 3300028381 | Ga0268264_10271863 | Ga0268264_102718632 | 136 |
| 371 | 3300028794 | Ga0307515_10000039 | Ga0307515_10000039142 | 136 |
| 372 | 3300028794 | Ga0307515_10548216 | Ga0307515_105482162 | 136 |
| 373 | 3300028800 | Ga0265338_10246535 | Ga0265338_102465352 | 136 |
| 374 | 3300029957 | Ga0265324_10048398 | Ga0265324_100483982 | 136 |
| 375 | 3300030521 | Ga0307511_10003621 | Ga0307511_100036219 | 136 |
| 376 | 3300031251 | Ga0265327_10306130 | Ga0265327_103061301 | 136 |
| 377 | 3300031456 | Ga0307513_10312479 | Ga0307513_103124792 | 136 |
| 378 | 3300031456 | Ga0307513_10365218 | Ga0307513_103652182 | 136 |
| 379 | 3300031507 | Ga0307509_10151057 | Ga0307509_101510572 | 136 |
| 380 | 3300031616 | Ga0307508_10266851 | Ga0307508_102668512 | 136 |
| 381 | 3300031730 | Ga0307516_10095407 | Ga0307516_100954073 | 136 |
| 382 | 3300033179 | Ga0307507_10193150 | Ga0307507_101931503 | 136 |
| 383 | 3300033180 | Ga0307510_10000528 | Ga0307510_1000052822 | 136 |
| 384 | 3300035089 | Ga0373944_0183128 | Ga0373944_0183128_94_504 | 136 |
| 385 | 3300035170 | Ga0373943_0341932 | Ga0373943_0341932_301_720 | 136 |
| 386 | 3300035692 | Ga0373935_0173590 | Ga0373935_0173590_453_875 | 136 |
| 387 | 3300035692 | Ga0373935_0583332 | Ga0373935_0583332_202_621 | 136 |
| 388 | 3300036401 | Ga0373937_0074630 | Ga0373937_0074630_679_1089 | 136 |
| 389 | 3300036401 | Ga0373937_1946524 | Ga0373937_1946524_25_444 | 136 |
| 390 | 3300037068 | Ga0373925_0352005 | Ga0373925_0352005_161_571 | 136 |
| 391 | 3300037068 | Ga0373925_0814840 | Ga0373925_0814840_266_685 | 136 |
| 392 | 3300038443 | Ga0395901_0861103 | Ga0395901_0861103_370_783 | 136 |
| 393 | 3300039437 | Ga0436365_1107423 | Ga0436365_1107423_703_1119 | 136 |
| 394 | 3300039437 | Ga0436365_1715184 | Ga0436365_1715184_453_869 | 136 |
| 395 | 3300041406 | Ga0439439_0017796 | Ga0439439_0017796_93_506 | 136 |
| 396 | 3300041458 | Ga0451798_0192664 | Ga0451798_0192664_75_488 | 136 |
| 397 | 3300041459 | Ga0451800_1552141 | Ga0451800_1552141_71_484 | 136 |
| 398 | 3300041496 | Ga0451839_0520964 | Ga0451839_0520964_189_602 | 136 |
| 399 | 3300041507 | Ga0451851_0290747 | Ga0451851_0290747_86_499 | 136 |
| 400 | 3300041507 | Ga0451851_0544823 | Ga0451851_0544823_543_956 | 136 |
| 401 | 3300042007 | Ga0439449_0047559 | Ga0439449_0047559_1069_1482 | 136 |
| 402 | 3300042012 | Ga0439455_0230035 | Ga0439455_0230035_34_447 | 136 |
| 403 | 3300042014 | Ga0439457_003645 | Ga0439457_003645_1399_1812 | 136 |
| 404 | 3300042014 | Ga0439457_149347 | Ga0439457_149347_96_509 | 136 |
| 405 | 3300042015 | Ga0439462_0012746 | Ga0439462_0012746_203_616 | 136 |
| 406 | 3300044656 | Ga0466969_0000746 | Ga0466969_0000746_6513_6923 | 136 |
| 407 | 3300044658 | Ga0466972_0000004 | Ga0466972_0000004_251487_251909 | 136 |
| 408 | 3300044658 | Ga0466972_0000038 | Ga0466972_0000038_129742_130152 | 136 |
| 409 | 3300044658 | Ga0466972_0042946 | Ga0466972_0042946_489_1091 | 136 |
| 410 | 3300044658 | Ga0466972_0281822 | Ga0466972_0281822_171_581 | 136 |
| 411 | 3300044684 | Ga0466966_0001759 | Ga0466966_0001759_9788_10198 | 136 |
| 412 | 3300044706 | Ga0466964_0862073 | Ga0466964_0862073_42_455 | 136 |
| 413 | 3300044719 | Ga0466971_0049048 | Ga0466971_0049048_1285_1722 | 136 |
| 414 | 3300044765 | Ga0466970_0001727 | Ga0466970_0001727_2308_2730 | 136 |
| 415 | 3300044765 | Ga0466970_0028363 | Ga0466970_0028363_1238_1675 | 136 |
| 416 | 3300044842 | Ga0466957_0001679 | Ga0466957_0001679_8167_8586 | 136 |
| 417 | 3300044842 | Ga0466957_0094917 | Ga0466957_0094917_1418_1831 | 136 |
| 418 | 3300045049 | Ga0466959_0000056 | Ga0466959_0000056_16116_16526 | 136 |
| 419 | 3300045049 | Ga0466959_0002096 | Ga0466959_0002096_2351_2788 | 136 |
| 420 | 3300046459 | Ga0495629_0055163 | Ga0495629_0055163_347_766 | 136 |
| 421 | 3300046460 | Ga0495638_0021712 | Ga0495638_0021712_2330_2746 | 136 |
| 422 | 3300046460 | Ga0495638_0190953 | Ga0495638_0190953_554_964 | 136 |
| 423 | 3300046476 | Ga0495662_0048235 | Ga0495662_0048235_1601_2020 | 136 |
| 424 | 3300046507 | Ga0495606_0083515 | Ga0495606_0083515_1292_1702 | 136 |
| 425 | 3300046516 | Ga0495628_0282321 | Ga0495628_0282321_625_1044 | 136 |
| 426 | 3300046517 | Ga0495630_0127460 | Ga0495630_0127460_1450_1869 | 136 |
| 427 | 3300046519 | Ga0495632_0230178 | Ga0495632_0230178_184_597 | 136 |
| 428 | 3300046524 | Ga0495648_0001092 | Ga0495648_0001092_24920_25336 | 136 |
| 429 | 3300046531 | Ga0495665_0088063 | Ga0495665_0088063_1083_1502 | 136 |
| 430 | 3300046558 | Ga0495633_0032150 | Ga0495633_0032150_171_581 | 136 |
| 431 | 3300046616 | Ga0495668_0002497 | Ga0495668_0002497_1542_1955 | 136 |
| 432 | 3300046642 | Ga0495634_0776850 | Ga0495634_0776850_112_531 | 136 |
| 433 | 3300046648 | Ga0495611_0042739 | Ga0495611_0042739_257_673 | 136 |
| 434 | 3300046660 | Ga0495625_0260277 | Ga0495625_0260277_680_1105 | 136 |
| 435 | 3300046663 | Ga0495635_0146062 | Ga0495635_0146062_233_652 | 136 |
| 436 | 3300046683 | Ga0495658_0021382 | Ga0495658_0021382_2086_2505 | 136 |
| 437 | 3300046683 | Ga0495658_0374843 | Ga0495658_0374843_424_834 | 136 |
| 438 | 3300046689 | Ga0495613_0157097 | Ga0495613_0157097_267_686 | 136 |
| 439 | 3300046691 | Ga0495670_0113617 | Ga0495670_0113617_274_684 | 136 |
| 440 | 3300046694 | Ga0495649_0040228 | Ga0495649_0040228_1913_2347 | 136 |
| 441 | 3300046809 | Ga0495600_0149724 | Ga0495600_0149724_176_595 | 136 |
| 442 | 3300047317 | Ga0495604_0077659 | Ga0495604_0077659_624_1043 | 136 |
| 443 | 3300047319 | Ga0495674_0030716 | Ga0495674_0030716_3037_3456 | 136 |
| 444 | 3300047319 | Ga0495674_0262514 | Ga0495674_0262514_225_644 | 136 |
| 445 | 3300047319 | Ga0495674_0461317 | Ga0495674_0461317_262_729 | 136 |
| 446 | 3300047319 | Ga0495674_1274188 | Ga0495674_1274188_53_499 | 136 |
| 447 | 3300047471 | Ga0495684_0082936 | Ga0495684_0082936_456_875 | 136 |
| 448 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_313337_313747 | 136 |
| 449 | 3300048908 | Ga0496105_0460551 | Ga0496105_0460551_435_854 | 136 |
| 450 | 3300048929 | Ga0496126_0811103 | Ga0496126_0811103_61_498 | 136 |
| 451 | 3300049572 | Ga0501036_1274885 | Ga0501036_1274885_56_469 | 136 |
| 452 | 3300049574 | Ga0501038_0562889 | Ga0501038_0562889_63_476 | 136 |
| 453 | 3300049575 | Ga0501039_0487627 | Ga0501039_0487627_108_521 | 136 |
| 454 | 3300049579 | Ga0501043_0507142 | Ga0501043_0507142_106_516 | 136 |
| 455 | 3300049579 | Ga0501043_0571647 | Ga0501043_0571647_168_581 | 136 |
| 456 | 3300049579 | Ga0501043_1034296 | Ga0501043_1034296_153_563 | 136 |
| 457 | 3300049580 | Ga0501046_0337260 | Ga0501046_0337260_306_719 | 136 |
| 458 | 3300049581 | Ga0501047_0024102 | Ga0501047_0024102_2979_3404 | 136 |
| 459 | 3300049581 | Ga0501047_0032242 | Ga0501047_0032242_650_1060 | 136 |
| 460 | 3300049581 | Ga0501047_0212024 | Ga0501047_0212024_1152_1565 | 136 |
| 461 | 3300049581 | Ga0501047_0606706 | Ga0501047_0606706_354_767 | 136 |
| 462 | 3300049583 | Ga0501067_0080889 | Ga0501067_0080889_1158_1571 | 136 |
| 463 | 3300049585 | Ga0501069_0067667 | Ga0501069_0067667_1177_1590 | 136 |
| 464 | 3300049586 | Ga0501070_0111821 | Ga0501070_0111821_1058_1471 | 136 |
| 465 | 3300049587 | Ga0501071_0151180 | Ga0501071_0151180_939_1352 | 136 |
| 466 | 3300049589 | Ga0501073_0060903 | Ga0501073_0060903_282_695 | 136 |
| 467 | 3300049590 | Ga0501074_0399064 | Ga0501074_0399064_384_797 | 136 |
| 468 | 3300049703 | Ga0501219_000469 | Ga0501219_000469_3063_3482 | 136 |
| 469 | 3300049742 | Ga0501080_0489801 | Ga0501080_0489801_418_831 | 136 |
| 470 | 3300049744 | Ga0501083_0075085 | Ga0501083_0075085_1458_1871 | 136 |
| 471 | 3300049758 | Ga0501241_130425 | Ga0501241_130425_74_487 | 136 |
| 472 | 3300049776 | Ga0501280_061553 | Ga0501280_061553_77_496 | 136 |
| 473 | 3300049823 | Ga0501044_0003293 | Ga0501044_0003293_10584_10994 | 136 |
| 474 | 3300049823 | Ga0501044_0020810 | Ga0501044_0020810_3104_3514 | 136 |
| 475 | 3300049823 | Ga0501044_0477872 | Ga0501044_0477872_570_980 | 136 |
| 476 | 3300050005 | Ga0501284_00029 | Ga0501284_00029_60165_60584 | 136 |
| 477 | 3300050493 | nmdc:mga0k408_29233_c1 | nmdc:mga0k408_29233_c1_504_917 | 136 |
| 478 | 3300050507 | nmdc:mga05p37_4450_c1 | nmdc:mga05p37_4450_c1_9247_9663 | 136 |
| 479 | 3300050511 | nmdc:mga08y16_130270_c1 | nmdc:mga08y16_130270_c1_1361_1774 | 136 |
| 480 | 3300050511 | nmdc:mga08y16_368132_c1 | nmdc:mga08y16_368132_c1_808_1218 | 136 |
| 481 | 3300053086 | Ga0500578_0019869 | Ga0500578_0019869_682_1095 | 136 |
| 482 | 3300053090 | Ga0500646_0070535 | Ga0500646_0070535_515_928 | 136 |
| 483 | 3300053090 | Ga0500646_0088034 | Ga0500646_0088034_183_599 | 136 |
| 484 | 3300053091 | Ga0500647_0145543 | Ga0500647_0145543_375_788 | 136 |
| 485 | 3300053092 | Ga0500583_0000047 | Ga0500583_0000047_64498_64911 | 136 |
| 486 | 3300053092 | Ga0500583_0024358 | Ga0500583_0024358_1396_1812 | 136 |
| 487 | 3300053092 | Ga0500583_0116992 | Ga0500583_0116992_889_1299 | 136 |
| 488 | 3300053093 | Ga0500651_0327372 | Ga0500651_0327372_189_602 | 136 |
| 489 | 3300053098 | Ga0500650_0397273 | Ga0500650_0397273_139_552 | 136 |
| 490 | 3300053104 | Ga0500556_0305456 | Ga0500556_0305456_39_452 | 136 |
| 491 | 3300053105 | Ga0500557_197618 | Ga0500557_197618_95_511 | 136 |
| 492 | 3300053130 | Ga0500642_0351008 | Ga0500642_0351008_202_618 | 136 |
| 493 | 3300053134 | Ga0500658_0226274 | Ga0500658_0226274_157_573 | 136 |
| 494 | 3300053134 | Ga0500658_0429518 | Ga0500658_0429518_86_499 | 136 |
| 495 | 3300053136 | Ga0500559_0357263 | Ga0500559_0357263_187_600 | 136 |
| 496 | 3300053136 | Ga0500559_0482294 | Ga0500559_0482294_77_490 | 136 |
| 497 | 3300053139 | Ga0500568_0129303 | Ga0500568_0129303_100_525 | 136 |
| 498 | 3300053140 | Ga0500573_0441182 | Ga0500573_0441182_148_564 | 136 |
| 499 | 3300053151 | Ga0500604_0022496 | Ga0500604_0022496_1317_1727 | 136 |
| 500 | 3300053156 | Ga0500622_0002825 | Ga0500622_0002825_1814_2230 | 136 |
| 501 | 3300053156 | Ga0500622_0130827 | Ga0500622_0130827_658_1071 | 136 |
| 502 | 3300053163 | Ga0500639_129917 | Ga0500639_129917_291_704 | 136 |
| 503 | 3300053178 | Ga0500637_0142902 | Ga0500637_0142902_295_705 | 136 |
| 504 | 3300053178 | Ga0500637_0516504 | Ga0500637_0516504_53_466 | 136 |
| 505 | 3300060353 | Ga0501082_0117161 | Ga0501082_0117161_1673_2086 | 136 |
| 506 | 3300061719 | Ga0466962_0075362 | Ga0466962_0075362_834_1271 | 136 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5v10-assembly1.cif.gz_B-2 | crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 | 0.9453 | 4 | 130 |
| 1z54-assembly1.cif.gz_C | crystal structure of a hypothetical protein tt1821 from thermus thermophilus | 0.9382 | 4 | 133 |
| 2egi-assembly1.cif.gz_C | crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus | 0.9371 | 4 | 131 |
| 2egi-assembly1.cif.gz_A | crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus | 0.9361 | 5 | 131 |
| 2egi-assembly1.cif.gz_G | crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus | 0.9352 | 4 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FYS8_3_144_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9471 | 4 | 122 | 3.10.129.10 |
| 5v10B00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9453 | 4 | 130 | 3.10.129.10 |
| 2egiG00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9352 | 4 | 126 | 3.10.129.10 |
| 1z54D00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9319 | 2 | 133 | 3.10.129.10 |
| 5t06C00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9292 | 3 | 135 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5B8VJP1-F1-model_v4 | Acyl-CoA thioesterase | 0.9871 | 1 | 135 |
GO:0047617
|
| AF-A0A1K1QTQ3-F1-model_v4 | Acyl-CoA thioester hydrolase | 0.9855 | 2 | 136 |
GO:0047617
|
| AF-A0A1H3ZKB3-F1-model_v4 | Acyl-CoA thioester hydrolase | 0.9849 | 1 | 135 |
GO:0047617
|
| AF-A0A1I4XML4-F1-model_v4 | Acyl-CoA thioester hydrolase | 0.9829 | 2 | 136 |
GO:0047617
|
| AF-A0A317M6C6-F1-model_v4 | Acyl-CoA thioester hydrolase | 0.9825 | 2 | 136 |
GO:0047617
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar