F456479

General Info

Members Datasets Scaffolds Average Seq Length
506 235 506 137

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_11414362|Ga0070681_114143621
Length 139
Sequence MYTHQIEERVRYGETDRMGYLYYGNYAQYYEVGRVEALRNLGLRYKDMEDSGILMPVLDLVSTFVKPALYDQLLTIRTTVTTMPTVRMFFSYEIENEEKELINYGKTTLIFFDGNKRRPCRAPAYLLEKLLPYFENKMQ

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
152 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
153 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
154 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
155 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
156 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
157 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
158 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
159 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
211 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
218 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
219 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
220 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
222 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
223 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
224 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
225 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
226 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
227 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
228 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
229 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
230 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
232 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
233 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.93
Nodule 0
Rhizoplane 0.59
Rhizosphere 87.75
Stem 0
Stem Tuber 0
Unclassified 5.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007063 3300001979 Bacteria 4603
2 JGI25154J39366_1017064 3300002738 Bacteria 727
3 rootH1_10092153 3300003316 Bacteria 4275
4 rootH2_10003376 3300003320 Bacteria 4304
5 rootH2_10008932 3300003320 Bacteria 37271
6 rootH2_10020101 3300003320 Bacteria 5955
7 rootH2_10041861 3300003320 Bacteria 17793
8 rootH2_10198091 3300003320 Bacteria 2922
9 rootL2_10031008 3300003322 Bacteria 3017
10 rootL2_10244506 3300003322 Bacteria 2781
11 rootL2_10356615 3300003322 Bacteria 1800
12 rootH1_10035779 3300003323 Bacteria 4223
13 JGI25160J50197_1001100 3300003354 Bacteria 13814
14 Ga0070658_10002849 3300005327 Bacteria 14369
15 Ga0070676_10001904 3300005328 Bacteria 10604
16 Ga0070676_10460159 3300005328 Bacteria 896
17 Ga0070683_100006532 3300005329 Bacteria 9793
18 Ga0070690_100308722 3300005330 Bacteria 1136
19 Ga0070690_100322034 3300005330 Bacteria 1114
20 Ga0070690_100682264 3300005330 Bacteria 787
21 Ga0070670_100210781 3300005331 Unclassified 1689
22 Ga0070670_100480412 3300005331 Bacteria 1103
23 Ga0070670_100645837 3300005331 Bacteria 949
24 Ga0070670_100788857 3300005331 Bacteria 857
25 Ga0070670_100884307 3300005331 Bacteria 809
26 Ga0070677_10101659 3300005333 Bacteria 1268
27 Ga0068869_100079850 3300005334 Bacteria 2439
28 Ga0068869_100738860 3300005334 Bacteria 842
29 Ga0070666_10000028 3300005335 Bacteria 144796
30 Ga0070666_10000885 3300005335 Bacteria 18201
31 Ga0070666_10044926 3300005335 Bacteria 2961
32 Ga0070680_100002380 3300005336 Bacteria 13907
33 Ga0070680_100288952 3300005336 Bacteria 1389
34 Ga0070682_100007128 3300005337 Bacteria 6294
35 Ga0070682_100013688 3300005337 Unclassified 4674
36 Ga0070682_101823490 3300005337 Unclassified 531
37 Ga0068868_100000075 3300005338 Bacteria 58452
38 Ga0068868_100014908 3300005338 Bacteria 5739
39 Ga0068868_102333825 3300005338 Bacteria 510
40 Ga0070660_100153155 3300005339 Unclassified 1855
41 Ga0070689_100220951 3300005340 Bacteria 1554
42 Ga0070689_101085193 3300005340 Bacteria 715
43 Ga0070691_10009538 3300005341 Bacteria 4432
44 Ga0070691_10023899 3300005341 Bacteria 2839
45 Ga0070691_10549262 3300005341 Unclassified 675
46 Ga0070668_100000859 3300005347 Bacteria 21121
47 Ga0070675_100034074 3300005354 Bacteria 4131
48 Ga0070675_100160092 3300005354 Bacteria 1935
49 Ga0070675_101482557 3300005354 Unclassified 626
50 Ga0070675_101767967 3300005354 Unclassified 570
51 Ga0070671_100050909 3300005355 Bacteria 3445
52 Ga0070671_100679687 3300005355 Bacteria 892
53 Ga0070674_100113758 3300005356 Bacteria 1992
54 Ga0070673_100000448 3300005364 Bacteria 21839
55 Ga0070673_100006749 3300005364 Bacteria 7490
56 Ga0070688_100073351 3300005365 Bacteria 2195
57 Ga0070688_101576252 3300005365 Bacteria 536
58 Ga0070659_100009989 3300005366 Bacteria 6982
59 Ga0070667_100000482 3300005367 Bacteria 40557
60 Ga0070667_100200810 3300005367 Bacteria 1769
61 Ga0070667_100305837 3300005367 Bacteria 1432
62 Ga0070667_101796270 3300005367 Bacteria 577
63 Ga0070713_100492155 3300005436 Unclassified 1156
64 Ga0070700_101976788 3300005441 Bacteria 505
65 Ga0070663_100355385 3300005455 Bacteria 1187
66 Ga0070678_100015835 3300005456 Unclassified 4804
67 Ga0070678_100027799 3300005456 Bacteria 3846
68 Ga0070678_100832510 3300005456 Bacteria 840
69 Ga0070678_101511778 3300005456 Unclassified 629
70 Ga0070681_10037887 3300005458 Bacteria 4835
71 Ga0070681_10048304 3300005458 Bacteria 4253
72 Ga0070681_10152052 3300005458 Bacteria 2241
73 Ga0070681_11414362 3300005458 Unclassified 619
74 Ga0068867_100013182 3300005459 Bacteria 5855
75 Ga0068867_101504481 3300005459 Bacteria 627
76 Ga0068867_101605048 3300005459 Unclassified 608
77 Ga0070685_10032691 3300005466 Bacteria 2915
78 Ga0070679_100031244 3300005530 Bacteria 5260
79 Ga0070679_100032277 3300005530 Bacteria 5178
80 Ga0070684_100002043 3300005535 Bacteria 14865
81 Ga0070684_100103525 3300005535 Bacteria 2546
82 Ga0068853_100006239 3300005539 Bacteria 9446
83 Ga0068853_100006774 3300005539 Bacteria 9130
84 Ga0068853_100029608 3300005539 Bacteria 4618
85 Ga0068853_100050294 3300005539 Bacteria 3585
86 Ga0068853_100358567 3300005539 Unclassified 1358
87 Ga0070672_100000758 3300005543 Bacteria 19232
88 Ga0070672_100098509 3300005543 Bacteria 2368
89 Ga0070672_100183801 3300005543 Unclassified 1743
90 Ga0070672_100284397 3300005543 Bacteria 1399
91 Ga0070672_100392161 3300005543 Bacteria 1189
92 Ga0070672_101002778 3300005543 Bacteria 740
93 Ga0070693_100013591 3300005547 Unclassified 4151
94 Ga0070665_100000001 3300005548 Bacteria 1083363
95 Ga0070665_100002163 3300005548 Bacteria 21925
96 Ga0070665_100782773 3300005548 Bacteria 967
97 Ga0068855_100000089 3300005563 Bacteria 110845
98 Ga0068855_100047714 3300005563 Bacteria 5059
99 Ga0068855_100050054 3300005563 Bacteria 4925
100 Ga0068855_100138482 3300005563 Unclassified 2776
101 Ga0068855_100266374 3300005563 Bacteria 1907
102 Ga0068855_100349208 3300005563 Bacteria 1630
103 Ga0070664_100023115 3300005564 Bacteria 5132
104 Ga0070664_100057753 3300005564 Bacteria 3299
105 Ga0070664_100708467 3300005564 Bacteria 938
106 Ga0068857_100010174 3300005577 Bacteria 8177
107 Ga0068857_100259917 3300005577 Unclassified 1593
108 Ga0068854_100013828 3300005578 Bacteria 5308
109 Ga0068854_100037722 3300005578 Unclassified 3394
110 Ga0068854_100054903 3300005578 Bacteria 2867
111 Ga0068854_100213830 3300005578 Bacteria 1522
112 Ga0068854_100417952 3300005578 Bacteria 1113
113 Ga0068854_100587028 3300005578 Unclassified 949
114 Ga0068856_100008851 3300005614 Bacteria 9797
115 Ga0068856_100076515 3300005614 Bacteria 3316
116 Ga0068856_100079385 3300005614 Bacteria 3254
117 Ga0068856_100315928 3300005614 Bacteria 1579
118 Ga0068852_100000488 3300005616 Bacteria 25890
119 Ga0068852_100018236 3300005616 Bacteria 5527
120 Ga0068852_100097578 3300005616 Bacteria 2644
121 Ga0068852_100306250 3300005616 Bacteria 1539
122 Ga0068852_100381467 3300005616 Bacteria 1383
123 Ga0068852_100508344 3300005616 Bacteria 1201
124 Ga0068852_101220022 3300005616 Bacteria 773
125 Ga0068852_101305214 3300005616 Unclassified 747
126 Ga0068852_101509686 3300005616 Bacteria 694
127 Ga0068852_101712624 3300005616 Unclassified 651
128 Ga0068859_100000012 3300005617 Bacteria 300376
129 Ga0068859_100027733 3300005617 Bacteria 5680
130 Ga0068859_100487586 3300005617 Bacteria 1328
131 Ga0068859_102364348 3300005617 Unclassified 586
132 Ga0068864_100034417 3300005618 Bacteria 4309
133 Ga0068864_100119280 3300005618 Bacteria 2357
134 Ga0068864_100400092 3300005618 Unclassified 1305
135 Ga0068864_100567040 3300005618 Bacteria 1099
136 Ga0068864_100620449 3300005618 Bacteria 1051
137 Ga0068866_10397269 3300005718 Bacteria 888
138 Ga0068861_100005861 3300005719 Bacteria 8349
139 Ga0068861_100330046 3300005719 Unclassified 1331
140 Ga0068851_10001706 3300005834 Bacteria 9614
141 Ga0068851_10009442 3300005834 Bacteria 4537
142 Ga0068851_10030811 3300005834 Bacteria 2662
143 Ga0068863_100001512 3300005841 Bacteria 22973
144 Ga0068863_100002125 3300005841 Bacteria 19657
145 Ga0068863_100012779 3300005841 Bacteria 8096
146 Ga0068863_100678348 3300005841 Bacteria 1023
147 Ga0068863_101313033 3300005841 Bacteria 730
148 Ga0068858_100001413 3300005842 Bacteria 24658
149 Ga0068858_100088249 3300005842 Bacteria 2885
150 Ga0068858_100456777 3300005842 Bacteria 1231
151 Ga0068860_100002836 3300005843 Bacteria 18019
152 Ga0068860_100012660 3300005843 Bacteria 8298
153 Ga0068860_100080155 3300005843 Unclassified 3105
154 Ga0068860_100081331 3300005843 Bacteria 3081
155 Ga0068860_100155985 3300005843 Bacteria 2200
156 Ga0068862_100986915 3300005844 Bacteria 832
157 Ga0081540_1029496 3300005983 Bacteria 3054
158 Ga0081539_10000337 3300005985 Bacteria 103868
159 Ga0070715_10429160 3300006163 Unclassified 741
160 Ga0075366_10070147 3300006195 Bacteria 2087
161 Ga0075366_10250892 3300006195 Bacteria 1079
162 Ga0075366_10336226 3300006195 Bacteria 926
163 Ga0097621_100003845 3300006237 Bacteria 10402
164 Ga0097621_100004135 3300006237 Bacteria 10062
165 Ga0097621_100037246 3300006237 Bacteria 3895
166 Ga0097621_100320116 3300006237 Bacteria 1374
167 Ga0097621_100490020 3300006237 Unclassified 1112
168 Ga0068871_100000981 3300006358 Bacteria 19104
169 Ga0068871_100008715 3300006358 Bacteria 7295
170 Ga0068871_100060621 3300006358 Unclassified 3087
171 Ga0068871_100072892 3300006358 Bacteria 2830
172 Ga0068871_100287925 3300006358 Unclassified 1439
173 Ga0068871_100319534 3300006358 Unclassified 1367
174 Ga0068871_100735237 3300006358 Bacteria 906
175 Ga0068865_100000413 3300006881 Bacteria 23842
176 Ga0068865_100112252 3300006881 Bacteria 2013
177 Ga0097620_100000012 3300006931 Bacteria 300376
178 Ga0097620_100027729 3300006931 Bacteria 5680
179 Ga0097620_100487562 3300006931 Bacteria 1328
180 Ga0097620_102364883 3300006931 Unclassified 586
181 Ga0105240_10003016 3300009093 Bacteria 26478
182 Ga0105240_10005940 3300009093 Bacteria 18085
183 Ga0105240_10025898 3300009093 Bacteria 7702
184 Ga0105240_10035594 3300009093 Bacteria 6414
185 Ga0105240_10079750 3300009093 Unclassified 4028
186 Ga0105240_10105967 3300009093 Bacteria 3411
187 Ga0105240_10246368 3300009093 Unclassified 2069
188 Ga0105245_10063832 3300009098 Bacteria 3327
189 Ga0105245_10592713 3300009098 Unclassified 1134
190 Ga0105241_10000619 3300009174 Bacteria 26737
191 Ga0105241_10003218 3300009174 Bacteria 12152
192 Ga0105241_10577895 3300009174 Bacteria 1012
193 Ga0105241_10583492 3300009174 Bacteria 1008
194 Ga0105248_10165075 3300009177 Bacteria 2497
195 Ga0105237_10002854 3300009545 Bacteria 21014
196 Ga0105237_10004335 3300009545 Bacteria 16445
197 Ga0105237_10008089 3300009545 Bacteria 11432
198 Ga0105237_10016648 3300009545 Bacteria 7636
199 Ga0105237_10044083 3300009545 Bacteria 4492
200 Ga0105237_10226734 3300009545 Bacteria 1869
201 Ga0105237_10348034 3300009545 Unclassified 1486
202 Ga0105237_10368992 3300009545 Archaea 1440
203 Ga0105237_10478580 3300009545 Bacteria 1251
204 Ga0105238_10004631 3300009551 Bacteria 13617
205 Ga0105238_10192895 3300009551 Bacteria 2013
206 Ga0105238_10277545 3300009551 Unclassified 1657
207 Ga0105249_10726768 3300009553 Bacteria 1054
208 Ga0105239_10000905 3300010375 Bacteria 42180
209 Ga0105239_10002298 3300010375 Bacteria 24404
210 Ga0105239_10004164 3300010375 Bacteria 17372
211 Ga0105239_10005517 3300010375 Bacteria 14819
212 Ga0105239_10128588 3300010375 Bacteria 2816
213 Ga0105239_10193214 3300010375 Unclassified 2279
214 Ga0105239_10214043 3300010375 Bacteria 2160
215 Ga0105239_10299388 3300010375 Unclassified 1811
216 Ga0105239_10395022 3300010375 Bacteria 1565
217 Ga0105239_11536912 3300010375 Unclassified 769
218 Ga0157373_10076517 3300013100 Bacteria 2361
219 Ga0157371_10081651 3300013102 Bacteria 2289
220 Ga0157371_10311278 3300013102 Bacteria 1141
221 Ga0157371_10371068 3300013102 Bacteria 1044
222 Ga0157370_10010896 3300013104 Bacteria 9549
223 Ga0157370_10195689 3300013104 Bacteria 1876
224 Ga0157370_10645765 3300013104 Bacteria 967
225 Ga0157370_10883211 3300013104 Bacteria 812
226 Ga0157369_10008242 3300013105 Bacteria 11946
227 Ga0157369_10042894 3300013105 Bacteria 4934
228 Ga0157369_10086327 3300013105 Unclassified 3351
229 Ga0157374_10000001 3300013296 Bacteria 1077351
230 Ga0157374_10002589 3300013296 Bacteria 15240
231 Ga0157374_10005519 3300013296 Bacteria 10633
232 Ga0157374_10018369 3300013296 Bacteria 6169
233 Ga0157374_10093356 3300013296 Bacteria 2873
234 Ga0157374_10137592 3300013296 Bacteria 2369
235 Ga0157378_10006348 3300013297 Bacteria 10343
236 Ga0157378_10128879 3300013297 Bacteria 2340
237 Ga0157378_10260104 3300013297 Bacteria 1665
238 Ga0157378_10602014 3300013297 Bacteria 1110
239 Ga0163162_10000377 3300013306 Bacteria 40533
240 Ga0163162_10000448 3300013306 Bacteria 38173
241 Ga0163162_10000634 3300013306 Bacteria 32545
242 Ga0163162_10001972 3300013306 Bacteria 19287
243 Ga0163162_10031603 3300013306 Bacteria 5252
244 Ga0163162_10269152 3300013306 Bacteria 1835
245 Ga0157372_10001344 3300013307 Bacteria 26596
246 Ga0157372_10002881 3300013307 Bacteria 18600
247 Ga0157372_10032732 3300013307 Bacteria 5704
248 Ga0157372_10095147 3300013307 Bacteria 3393
249 Ga0157372_10131249 3300013307 Bacteria 2882
250 Ga0157372_10140939 3300013307 Unclassified 2777
251 Ga0157372_10277296 3300013307 Bacteria 1949
252 Ga0157372_10572666 3300013307 Unclassified 1316
253 Ga0157372_10842445 3300013307 Bacteria 1065
254 Ga0157375_10000989 3300013308 Bacteria 24572
255 Ga0157375_10335179 3300013308 Bacteria 1678
256 Ga0157375_10392828 3300013308 Bacteria 1554
257 Ga0157375_12202165 3300013308 Unclassified 657
258 Ga0163163_10000752 3300014325 Bacteria 27543
259 Ga0163163_10647837 3300014325 Bacteria 1120
260 Ga0163163_12190509 3300014325 Unclassified 612
261 Ga0157380_10001033 3300014326 Bacteria 17764
262 Ga0157379_10000440 3300014968 Bacteria 33697
263 Ga0157379_10031736 3300014968 Bacteria 4706
264 Ga0157379_10169285 3300014968 Bacteria 1972
265 Ga0157379_10516026 3300014968 Bacteria 1109
266 Ga0157376_10000381 3300014969 Bacteria 28821
267 Ga0157376_10001182 3300014969 Bacteria 17205
268 Ga0157376_10002491 3300014969 Bacteria 12466
269 Ga0157376_10205195 3300014969 Bacteria 1816
270 Ga0157376_10309716 3300014969 Bacteria 1498
271 Ga0157376_10386594 3300014969 Unclassified 1349
272 Ga0157376_10532740 3300014969 Bacteria 1160
273 Ga0157376_10554247 3300014969 Unclassified 1138
274 Ga0213876_10015475 3300021384 Bacteria 4036
275 Ga0209646_1001770 3300025246 Bacteria 5417
276 Ga0207426_1000023 3300025302 Bacteria 545465
277 Ga0207656_10151806 3300025321 Bacteria 1097
278 Ga0207682_10254445 3300025893 Bacteria 818
279 Ga0207680_10080059 3300025903 Bacteria 2050
280 Ga0207654_10046381 3300025911 Bacteria 2478
281 Ga0207654_10543089 3300025911 Bacteria 825
282 Ga0207654_10550543 3300025911 Bacteria 819
283 Ga0207707_10013305 3300025912 Bacteria 7172
284 Ga0207707_10025996 3300025912 Bacteria 5119
285 Ga0207707_10234688 3300025912 Bacteria 1596
286 Ga0207707_10667624 3300025912 Unclassified 875
287 Ga0207695_10000071 3300025913 Bacteria 315568
288 Ga0207695_10000084 3300025913 Bacteria 282392
289 Ga0207695_10002195 3300025913 Bacteria 29420
290 Ga0207695_10006026 3300025913 Bacteria 15840
291 Ga0207695_10008205 3300025913 Bacteria 13116
292 Ga0207695_10015773 3300025913 Bacteria 8877
293 Ga0207695_10024694 3300025913 Bacteria 6752
294 Ga0207671_10067982 3300025914 Bacteria 2654
295 Ga0207671_10193844 3300025914 Bacteria 1585
296 Ga0207671_10494546 3300025914 Bacteria 975
297 Ga0207671_11047444 3300025914 Unclassified 642
298 Ga0207660_10013039 3300025917 Bacteria 5443
299 Ga0207657_10005086 3300025919 Bacteria 13782
300 Ga0207657_10298334 3300025919 Unclassified 1277
301 Ga0207652_10008417 3300025921 Bacteria 8302
302 Ga0207681_10573754 3300025923 Bacteria 930
303 Ga0207694_10193818 3300025924 Bacteria 1652
304 Ga0207650_10078318 3300025925 Unclassified 2501
305 Ga0207650_10206710 3300025925 Unclassified 1575
306 Ga0207659_10045229 3300025926 Bacteria 3102
307 Ga0207700_10637190 3300025928 Unclassified 950
308 Ga0207644_10087315 3300025931 Bacteria 2318
309 Ga0207644_10438269 3300025931 Bacteria 1072
310 Ga0207644_10662468 3300025931 Bacteria 869
311 Ga0207690_10475549 3300025932 Bacteria 1008
312 Ga0207706_10015444 3300025933 Bacteria 6898
313 Ga0207686_10338277 3300025934 Bacteria 1130
314 Ga0207670_10957940 3300025936 Bacteria 719
315 Ga0207669_11424522 3300025937 Bacteria 590
316 Ga0207704_10041366 3300025938 Bacteria 2702
317 Ga0207691_10045364 3300025940 Unclassified 4041
318 Ga0207691_10216771 3300025940 Bacteria 1661
319 Ga0207691_10335631 3300025940 Bacteria 1294
320 Ga0207691_11753945 3300025940 Bacteria 501
321 Ga0207689_10370668 3300025942 Bacteria 1191
322 Ga0207689_10870660 3300025942 Bacteria 760
323 Ga0207661_10011018 3300025944 Bacteria 6534
324 Ga0207667_10000177 3300025949 Bacteria 92852
325 Ga0207667_10017709 3300025949 Bacteria 8014
326 Ga0207667_10022196 3300025949 Bacteria 7019
327 Ga0207667_10055650 3300025949 Bacteria 4158
328 Ga0207667_10113006 3300025949 Unclassified 2800
329 Ga0207651_10056467 3300025960 Bacteria 2702
330 Ga0207651_11397716 3300025960 Unclassified 630
331 Ga0207640_10029200 3300025981 Unclassified 3382
332 Ga0207640_10064004 3300025981 Bacteria 2447
333 Ga0207640_10186571 3300025981 Bacteria 1560
334 Ga0207640_10240389 3300025981 Bacteria 1399
335 Ga0207658_10603337 3300025986 Unclassified 986
336 Ga0207677_10012864 3300026023 Bacteria 4831
337 Ga0207677_10019483 3300026023 Bacteria 4098
338 Ga0207703_10437898 3300026035 Bacteria 1219
339 Ga0207703_11930225 3300026035 Unclassified 567
340 Ga0207639_10088106 3300026041 Bacteria 2476
341 Ga0207639_10115315 3300026041 Unclassified 2197
342 Ga0207639_10460275 3300026041 Bacteria 1156
343 Ga0207639_10548962 3300026041 Bacteria 1061
344 Ga0207639_11964304 3300026041 Unclassified 546
345 Ga0207702_10029222 3300026078 Bacteria 4586
346 Ga0207702_10280242 3300026078 Bacteria 1576
347 Ga0207641_10071422 3300026088 Bacteria 2986
348 Ga0207641_10124919 3300026088 Bacteria 2302
349 Ga0207641_11910643 3300026088 Unclassified 595
350 Ga0207648_10224805 3300026089 Bacteria 1669
351 Ga0207648_10939299 3300026089 Unclassified 809
352 Ga0207676_10299788 3300026095 Unclassified 1467
353 Ga0207676_10970159 3300026095 Unclassified 836
354 Ga0207674_10284681 3300026116 Unclassified 1601
355 Ga0207675_100256482 3300026118 Bacteria 1694
356 Ga0207683_10031758 3300026121 Unclassified 4585
357 Ga0207683_10339901 3300026121 Bacteria 1377
358 Ga0207698_10032709 3300026142 Bacteria 3771
359 Ga0207698_10228028 3300026142 Bacteria 1689
360 Ga0207698_10261487 3300026142 Bacteria 1590
361 Ga0207698_11566532 3300026142 Unclassified 674
362 Ga0268266_10000038 3300028379 Bacteria 325729
363 Ga0268264_10000167 3300028381 Bacteria 146190
364 Ga0268264_10011712 3300028381 Bacteria 7232
365 Ga0268264_10025631 3300028381 Bacteria 4817
366 Ga0268264_10271863 3300028381 Bacteria 1583
367 Ga0268264_11942754 3300028381 Bacteria 598
368 Ga0307515_10000039 3300028794 Bacteria 323229
369 Ga0307515_10548216 3300028794 Bacteria 766
370 Ga0265338_10246535 3300028800 Bacteria 1320
371 Ga0265324_10048398 3300029957 Bacteria 1462
372 Ga0307511_10003621 3300030521 Bacteria 15822
373 Ga0265327_10306130 3300031251 Unclassified 699
374 Ga0307513_10312479 3300031456 Bacteria 1333
375 Ga0307513_10365218 3300031456 Bacteria 1187
376 Ga0307509_10151057 3300031507 Bacteria 2238
377 Ga0307508_10266851 3300031616 Bacteria 1306
378 Ga0307516_10095407 3300031730 Unclassified 2797
379 Ga0307507_10193150 3300033179 Bacteria 1426
380 Ga0307510_10000528 3300033180 Bacteria 38156
381 Ga0373944_0183128 3300035089 Unclassified 752
382 Ga0373943_0341932 3300035170 Bacteria 856
383 Ga0373935_0173590 3300035692 Bacteria 1476
384 Ga0373935_0583332 3300035692 Bacteria 817
385 Ga0373937_0074630 3300036401 Bacteria 3130
386 Ga0373937_1946524 3300036401 Bacteria 534
387 Ga0373925_0352005 3300037068 Unclassified 1196
388 Ga0373925_0814840 3300037068 Bacteria 770
389 Ga0395899_0285597 3300037312 Unclassified 1121
390 Ga0395901_0861103 3300038443 Bacteria 891
391 Ga0395901_0937462 3300038443 Unclassified 845
392 Ga0436365_1107423 3300039437 Bacteria 15965
393 Ga0436365_1715184 3300039437 Bacteria 1561
394 Ga0439439_0017796 3300041406 Bacteria 1751
395 Ga0451798_0192664 3300041458 Bacteria 521
396 Ga0451800_1552141 3300041459 Bacteria 683
397 Ga0451839_0520964 3300041496 Unclassified 617
398 Ga0451851_0290747 3300041507 Bacteria 601
399 Ga0451851_0544823 3300041507 Unclassified 1023
400 Ga0439449_0047559 3300042007 Bacteria 1588
401 Ga0439455_0230035 3300042012 Bacteria 540
402 Ga0439457_003645 3300042014 Bacteria 4163
403 Ga0439457_149347 3300042014 Bacteria 562
404 Ga0439462_0012746 3300042015 Bacteria 2150
405 Ga0451577_1352815 3300042876 Bacteria 632
406 Ga0466969_0000746 3300044656 Bacteria 17610
407 Ga0466972_0000004 3300044658 Bacteria 314413
408 Ga0466972_0000038 3300044658 Bacteria 135937
409 Ga0466972_0042946 3300044658 Bacteria 2196
410 Ga0466972_0281822 3300044658 Bacteria 777
411 Ga0466966_0001759 3300044684 Bacteria 14029
412 Ga0466964_0862073 3300044706 Unclassified 516
413 Ga0466971_0049048 3300044719 Unclassified 1899
414 Ga0466970_0001727 3300044765 Bacteria 10525
415 Ga0466970_0028363 3300044765 Unclassified 2940
416 Ga0466957_0001679 3300044842 Bacteria 11631
417 Ga0466957_0094917 3300044842 Bacteria 1873
418 Ga0466959_0000056 3300045049 Bacteria 78465
419 Ga0466959_0002096 3300045049 Bacteria 12611
420 Ga0495629_0055163 3300046459 Bacteria 2779
421 Ga0495638_0021712 3300046460 Bacteria 4223
422 Ga0495638_0190953 3300046460 Bacteria 1162
423 Ga0495662_0048235 3300046476 Bacteria 2056
424 Ga0495606_0083515 3300046507 Bacteria 1980
425 Ga0495628_0282321 3300046516 Bacteria 1233
426 Ga0495630_0127460 3300046517 Bacteria 1932
427 Ga0495632_0230178 3300046519 Bacteria 836
428 Ga0495648_0001092 3300046524 Bacteria 27599
429 Ga0495665_0088063 3300046531 Bacteria 1632
430 Ga0495633_0032150 3300046558 Bacteria 2537
431 Ga0495668_0002497 3300046616 Bacteria 15047
432 Ga0495634_0776850 3300046642 Unclassified 547
433 Ga0495611_0042739 3300046648 Bacteria 2024
434 Ga0495625_0260277 3300046660 Bacteria 1123
435 Ga0495635_0146062 3300046663 Bacteria 1610
436 Ga0495658_0021382 3300046683 Bacteria 3410
437 Ga0495658_0374843 3300046683 Bacteria 906
438 Ga0495613_0157097 3300046689 Bacteria 1620
439 Ga0495670_0113617 3300046691 Bacteria 1403
440 Ga0495649_0040228 3300046694 Bacteria 2561
441 Ga0495600_0149724 3300046809 Bacteria 1511
442 Ga0495604_0077659 3300047317 Bacteria 2495
443 Ga0495674_0030716 3300047319 Bacteria 4883
444 Ga0495674_0262514 3300047319 Bacteria 1419
445 Ga0495674_0461317 3300047319 Unclassified 1020
446 Ga0495674_1274188 3300047319 Unclassified 553
447 Ga0495684_0082936 3300047471 Bacteria 2432
448 Ga0495686_0000004 3300047472 Bacteria 869019
449 Ga0496105_0460551 3300048908 Bacteria 1003
450 Ga0496126_0811103 3300048929 Unclassified 717
451 Ga0501036_1274885 3300049572 Bacteria 598
452 Ga0501038_0562889 3300049574 Unclassified 866
453 Ga0501039_0487627 3300049575 Bacteria 968
454 Ga0501043_0507142 3300049579 Bacteria 901
455 Ga0501043_0571647 3300049579 Bacteria 838
456 Ga0501043_1034296 3300049579 Bacteria 583
457 Ga0501046_0337260 3300049580 Bacteria 1096
458 Ga0501047_0024102 3300049581 Bacteria 5845
459 Ga0501047_0032242 3300049581 Bacteria 5057
460 Ga0501047_0212024 3300049581 Bacteria 1795
461 Ga0501047_0606706 3300049581 Unclassified 916
462 Ga0501067_0080889 3300049583 Unclassified 1801
463 Ga0501069_0067667 3300049585 Unclassified 1998
464 Ga0501070_0111821 3300049586 Unclassified 2257
465 Ga0501071_0151180 3300049587 Unclassified 1732
466 Ga0501073_0060903 3300049589 Unclassified 2634
467 Ga0501074_0399064 3300049590 Bacteria 975
468 Ga0501219_000469 3300049703 Bacteria 6364
469 Ga0501080_0489801 3300049742 Unclassified 1099
470 Ga0501083_0075085 3300049744 Unclassified 2245
471 Ga0501241_130425 3300049758 Bacteria 566
472 Ga0501280_061553 3300049776 Unclassified 654
473 Ga0501044_0003293 3300049823 Bacteria 18191
474 Ga0501044_0020810 3300049823 Bacteria 7002
475 Ga0501044_0477872 3300049823 Bacteria 1150
476 Ga0501284_00029 3300050005 Bacteria 74818
477 nmdc:mga0k408_29233_c1 3300050493 Bacteria 3136
478 nmdc:mga05p37_4450_c1 3300050507 Bacteria 16377
479 nmdc:mga08y16_130270_c1 3300050511 Bacteria 2616
480 nmdc:mga08y16_368132_c1 3300050511 Bacteria 1474
481 Ga0500578_0019869 3300053086 Bacteria 4316
482 Ga0500646_0070535 3300053090 Bacteria 1047
483 Ga0500646_0088034 3300053090 Unclassified 957
484 Ga0500647_0145543 3300053091 Bacteria 1109
485 Ga0500583_0000047 3300053092 Bacteria 78958
486 Ga0500583_0024358 3300053092 Bacteria 2566
487 Ga0500583_0116992 3300053092 Unclassified 1317
488 Ga0500651_0327372 3300053093 Bacteria 874
489 Ga0500650_0397273 3300053098 Bacteria 597
490 Ga0500556_0305456 3300053104 Bacteria 621
491 Ga0500557_197618 3300053105 Unclassified 648
492 Ga0500642_0351008 3300053130 Unclassified 654
493 Ga0500658_0226274 3300053134 Bacteria 858
494 Ga0500658_0429518 3300053134 Bacteria 603
495 Ga0500559_0357263 3300053136 Bacteria 683
496 Ga0500559_0482294 3300053136 Bacteria 571
497 Ga0500568_0129303 3300053139 Bacteria 939
498 Ga0500573_0441182 3300053140 Unclassified 604
499 Ga0500604_0022496 3300053151 Unclassified 1790
500 Ga0500622_0002825 3300053156 Bacteria 12178
501 Ga0500622_0130827 3300053156 Bacteria 1206
502 Ga0500639_129917 3300053163 Bacteria 1195
503 Ga0500637_0142902 3300053178 Bacteria 1385
504 Ga0500637_0516504 3300053178 Bacteria 588
505 Ga0501082_0117161 3300060353 Unclassified 2307
506 Ga0466962_0075362 3300061719 Bacteria 1612

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0285597 Ga0395899_0285597_270_629 118
2 3300038443 Ga0395901_0937462 Ga0395901_0937462_467_826 118
3 3300003316 rootH1_10092153 rootH1_100921534 135
4 3300005327 Ga0070658_10002849 Ga0070658_1000284912 135
5 3300005328 Ga0070676_10001904 Ga0070676_100019045 135
6 3300005330 Ga0070690_100308722 Ga0070690_1003087222 135
7 3300005330 Ga0070690_100322034 Ga0070690_1003220342 135
8 3300005331 Ga0070670_100788857 Ga0070670_1007888572 135
9 3300005333 Ga0070677_10101659 Ga0070677_101016592 135
10 3300005334 Ga0068869_100079850 Ga0068869_1000798503 135
11 3300005335 Ga0070666_10000028 Ga0070666_1000002831 135
12 3300005335 Ga0070666_10000885 Ga0070666_1000088511 135
13 3300005337 Ga0070682_101823490 Ga0070682_1018234901 135
14 3300005338 Ga0068868_100000075 Ga0068868_10000007516 135
15 3300005338 Ga0068868_102333825 Ga0068868_1023338251 135
16 3300005340 Ga0070689_100220951 Ga0070689_1002209513 135
17 3300005347 Ga0070668_100000859 Ga0070668_1000008597 135
18 3300005354 Ga0070675_100160092 Ga0070675_1001600923 135
19 3300005355 Ga0070671_100050909 Ga0070671_1000509095 135
20 3300005364 Ga0070673_100000448 Ga0070673_1000004485 135
21 3300005365 Ga0070688_100073351 Ga0070688_1000733512 135
22 3300005367 Ga0070667_100000482 Ga0070667_10000048233 135
23 3300005367 Ga0070667_100200810 Ga0070667_1002008102 135
24 3300005441 Ga0070700_101976788 Ga0070700_1019767881 135
25 3300005455 Ga0070663_100355385 Ga0070663_1003553851 135
26 3300005456 Ga0070678_100027799 Ga0070678_1000277992 135
27 3300005456 Ga0070678_100832510 Ga0070678_1008325102 135
28 3300005458 Ga0070681_11414362 Ga0070681_114143621 135
29 3300005459 Ga0068867_100013182 Ga0068867_1000131825 135
30 3300005530 Ga0070679_100031244 Ga0070679_1000312443 135
31 3300005539 Ga0068853_100029608 Ga0068853_1000296084 135
32 3300005543 Ga0070672_100000758 Ga0070672_1000007582 135
33 3300005543 Ga0070672_100183801 Ga0070672_1001838013 135
34 3300005548 Ga0070665_100002163 Ga0070665_10000216313 135
35 3300005548 Ga0070665_100782773 Ga0070665_1007827731 135
36 3300005563 Ga0068855_100050054 Ga0068855_1000500542 135
37 3300005564 Ga0070664_100057753 Ga0070664_1000577533 135
38 3300005577 Ga0068857_100010174 Ga0068857_1000101742 135
39 3300005578 Ga0068854_100054903 Ga0068854_1000549032 135
40 3300005614 Ga0068856_100076515 Ga0068856_1000765154 135
41 3300005616 Ga0068852_100000488 Ga0068852_10000048815 135
42 3300005616 Ga0068852_100097578 Ga0068852_1000975782 135
43 3300005616 Ga0068852_100306250 Ga0068852_1003062501 135
44 3300005616 Ga0068852_101220022 Ga0068852_1012200222 135
45 3300005617 Ga0068859_100000012 Ga0068859_100000012213 135
46 3300005618 Ga0068864_100034417 Ga0068864_1000344173 135
47 3300005618 Ga0068864_100119280 Ga0068864_1001192803 135
48 3300005718 Ga0068866_10397269 Ga0068866_103972691 135
49 3300005719 Ga0068861_100005861 Ga0068861_1000058614 135
50 3300005834 Ga0068851_10001706 Ga0068851_100017064 135
51 3300005841 Ga0068863_100001512 Ga0068863_10000151216 135
52 3300005841 Ga0068863_100012779 Ga0068863_1000127796 135
53 3300005841 Ga0068863_101313033 Ga0068863_1013130332 135
54 3300005842 Ga0068858_100001413 Ga0068858_10000141316 135
55 3300005842 Ga0068858_100088249 Ga0068858_1000882491 135
56 3300005843 Ga0068860_100002836 Ga0068860_1000028369 135
57 3300005843 Ga0068860_100012660 Ga0068860_1000126606 135
58 3300006237 Ga0097621_100004135 Ga0097621_1000041352 135
59 3300006358 Ga0068871_100000981 Ga0068871_1000009818 135
60 3300006358 Ga0068871_100319534 Ga0068871_1003195342 135
61 3300006881 Ga0068865_100000413 Ga0068865_1000004132 135
62 3300006931 Ga0097620_100000012 Ga0097620_100000012213 135
63 3300009093 Ga0105240_10035594 Ga0105240_100355944 135
64 3300009093 Ga0105240_10105967 Ga0105240_101059673 135
65 3300009098 Ga0105245_10063832 Ga0105245_100638323 135
66 3300009098 Ga0105245_10592713 Ga0105245_105927132 135
67 3300009174 Ga0105241_10000619 Ga0105241_1000061918 135
68 3300009177 Ga0105248_10165075 Ga0105248_101650754 135
69 3300009545 Ga0105237_10348034 Ga0105237_103480342 135
70 3300009545 Ga0105237_10478580 Ga0105237_104785803 135
71 3300009551 Ga0105238_10004631 Ga0105238_100046312 135
72 3300010375 Ga0105239_10128588 Ga0105239_101285883 135
73 3300010375 Ga0105239_10395022 Ga0105239_103950223 135
74 3300013105 Ga0157369_10042894 Ga0157369_100428944 135
75 3300013296 Ga0157374_10002589 Ga0157374_1000258913 135
76 3300013296 Ga0157374_10093356 Ga0157374_100933562 135
77 3300013297 Ga0157378_10006348 Ga0157378_100063484 135
78 3300013297 Ga0157378_10128879 Ga0157378_101288793 135
79 3300013297 Ga0157378_10602014 Ga0157378_106020142 135
80 3300013306 Ga0163162_10000377 Ga0163162_1000037713 135
81 3300013306 Ga0163162_10000634 Ga0163162_1000063411 135
82 3300013307 Ga0157372_10002881 Ga0157372_1000288113 135
83 3300013307 Ga0157372_10277296 Ga0157372_102772963 135
84 3300013307 Ga0157372_10572666 Ga0157372_105726661 135
85 3300013308 Ga0157375_10000989 Ga0157375_100009892 135
86 3300014325 Ga0163163_10000752 Ga0163163_100007529 135
87 3300014968 Ga0157379_10000440 Ga0157379_1000044012 135
88 3300014968 Ga0157379_10169285 Ga0157379_101692853 135
89 3300014969 Ga0157376_10000381 Ga0157376_1000038113 135
90 3300025912 Ga0207707_10667624 Ga0207707_106676242 135
91 3300028381 Ga0268264_11942754 Ga0268264_119427541 135
92 3300042876 Ga0451577_1352815 Ga0451577_1352815_130_543 135
93 3300001979 JGI24740J21852_10007063 JGI24740J21852_100070631 136
94 3300002738 JGI25154J39366_1017064 JGI25154J39366_10170641 136
95 3300003320 rootH2_10003376 rootH2_100033763 136
96 3300003320 rootH2_10008932 rootH2_1000893230 136
97 3300003320 rootH2_10020101 rootH2_100201014 136
98 3300003320 rootH2_10041861 rootH2_100418612 136
99 3300003320 rootH2_10198091 rootH2_101980912 136
100 3300003322 rootL2_10031008 rootL2_100310081 136
101 3300003322 rootL2_10244506 rootL2_102445063 136
102 3300003322 rootL2_10356615 rootL2_103566152 136
103 3300003323 rootH1_10035779 rootH1_100357794 136
104 3300003354 JGI25160J50197_1001100 JGI25160J50197_100110012 136
105 3300005328 Ga0070676_10460159 Ga0070676_104601592 136
106 3300005329 Ga0070683_100006532 Ga0070683_1000065324 136
107 3300005330 Ga0070690_100682264 Ga0070690_1006822642 136
108 3300005331 Ga0070670_100210781 Ga0070670_1002107812 136
109 3300005331 Ga0070670_100480412 Ga0070670_1004804121 136
110 3300005331 Ga0070670_100645837 Ga0070670_1006458371 136
111 3300005331 Ga0070670_100884307 Ga0070670_1008843072 136
112 3300005334 Ga0068869_100738860 Ga0068869_1007388602 136
113 3300005335 Ga0070666_10044926 Ga0070666_100449262 136
114 3300005336 Ga0070680_100002380 Ga0070680_1000023809 136
115 3300005336 Ga0070680_100288952 Ga0070680_1002889523 136
116 3300005337 Ga0070682_100007128 Ga0070682_1000071285 136
117 3300005337 Ga0070682_100013688 Ga0070682_1000136883 136
118 3300005338 Ga0068868_100014908 Ga0068868_1000149084 136
119 3300005339 Ga0070660_100153155 Ga0070660_1001531551 136
120 3300005340 Ga0070689_101085193 Ga0070689_1010851931 136
121 3300005341 Ga0070691_10009538 Ga0070691_100095383 136
122 3300005341 Ga0070691_10023899 Ga0070691_100238992 136
123 3300005341 Ga0070691_10549262 Ga0070691_105492621 136
124 3300005354 Ga0070675_100034074 Ga0070675_1000340742 136
125 3300005354 Ga0070675_101482557 Ga0070675_1014825571 136
126 3300005354 Ga0070675_101767967 Ga0070675_1017679671 136
127 3300005355 Ga0070671_100679687 Ga0070671_1006796871 136
128 3300005356 Ga0070674_100113758 Ga0070674_1001137582 136
129 3300005364 Ga0070673_100006749 Ga0070673_1000067495 136
130 3300005365 Ga0070688_101576252 Ga0070688_1015762521 136
131 3300005366 Ga0070659_100009989 Ga0070659_1000099896 136
132 3300005367 Ga0070667_100305837 Ga0070667_1003058372 136
133 3300005367 Ga0070667_101796270 Ga0070667_1017962701 136
134 3300005436 Ga0070713_100492155 Ga0070713_1004921552 136
135 3300005456 Ga0070678_100015835 Ga0070678_1000158352 136
136 3300005456 Ga0070678_101511778 Ga0070678_1015117782 136
137 3300005458 Ga0070681_10037887 Ga0070681_100378873 136
138 3300005458 Ga0070681_10048304 Ga0070681_100483043 136
139 3300005458 Ga0070681_10152052 Ga0070681_101520523 136
140 3300005459 Ga0068867_101504481 Ga0068867_1015044811 136
141 3300005459 Ga0068867_101605048 Ga0068867_1016050482 136
142 3300005466 Ga0070685_10032691 Ga0070685_100326913 136
143 3300005530 Ga0070679_100032277 Ga0070679_1000322774 136
144 3300005535 Ga0070684_100002043 Ga0070684_1000020434 136
145 3300005535 Ga0070684_100103525 Ga0070684_1001035252 136
146 3300005539 Ga0068853_100006239 Ga0068853_1000062399 136
147 3300005539 Ga0068853_100006774 Ga0068853_1000067745 136
148 3300005539 Ga0068853_100050294 Ga0068853_1000502944 136
149 3300005539 Ga0068853_100358567 Ga0068853_1003585672 136
150 3300005543 Ga0070672_100098509 Ga0070672_1000985093 136
151 3300005543 Ga0070672_100284397 Ga0070672_1002843972 136
152 3300005543 Ga0070672_100392161 Ga0070672_1003921612 136
153 3300005543 Ga0070672_101002778 Ga0070672_1010027781 136
154 3300005547 Ga0070693_100013591 Ga0070693_1000135913 136
155 3300005548 Ga0070665_100000001 Ga0070665_100000001610 136
156 3300005563 Ga0068855_100000089 Ga0068855_10000008972 136
157 3300005563 Ga0068855_100047714 Ga0068855_1000477143 136
158 3300005563 Ga0068855_100138482 Ga0068855_1001384822 136
159 3300005563 Ga0068855_100266374 Ga0068855_1002663742 136
160 3300005563 Ga0068855_100349208 Ga0068855_1003492083 136
161 3300005564 Ga0070664_100023115 Ga0070664_1000231156 136
162 3300005564 Ga0070664_100708467 Ga0070664_1007084672 136
163 3300005577 Ga0068857_100259917 Ga0068857_1002599172 136
164 3300005578 Ga0068854_100013828 Ga0068854_1000138286 136
165 3300005578 Ga0068854_100037722 Ga0068854_1000377222 136
166 3300005578 Ga0068854_100213830 Ga0068854_1002138302 136
167 3300005578 Ga0068854_100417952 Ga0068854_1004179522 136
168 3300005578 Ga0068854_100587028 Ga0068854_1005870281 136
169 3300005614 Ga0068856_100008851 Ga0068856_1000088517 136
170 3300005614 Ga0068856_100079385 Ga0068856_1000793852 136
171 3300005614 Ga0068856_100315928 Ga0068856_1003159282 136
172 3300005616 Ga0068852_100018236 Ga0068852_1000182362 136
173 3300005616 Ga0068852_100381467 Ga0068852_1003814671 136
174 3300005616 Ga0068852_100508344 Ga0068852_1005083442 136
175 3300005616 Ga0068852_101305214 Ga0068852_1013052141 136
176 3300005616 Ga0068852_101509686 Ga0068852_1015096861 136
177 3300005616 Ga0068852_101712624 Ga0068852_1017126242 136
178 3300005617 Ga0068859_100027733 Ga0068859_1000277332 136
179 3300005617 Ga0068859_100487586 Ga0068859_1004875861 136
180 3300005617 Ga0068859_102364348 Ga0068859_1023643482 136
181 3300005618 Ga0068864_100400092 Ga0068864_1004000922 136
182 3300005618 Ga0068864_100567040 Ga0068864_1005670403 136
183 3300005618 Ga0068864_100620449 Ga0068864_1006204492 136
184 3300005719 Ga0068861_100330046 Ga0068861_1003300463 136
185 3300005834 Ga0068851_10009442 Ga0068851_100094423 136
186 3300005834 Ga0068851_10030811 Ga0068851_100308114 136
187 3300005841 Ga0068863_100002125 Ga0068863_1000021254 136
188 3300005841 Ga0068863_100678348 Ga0068863_1006783482 136
189 3300005842 Ga0068858_100456777 Ga0068858_1004567772 136
190 3300005843 Ga0068860_100080155 Ga0068860_1000801553 136
191 3300005843 Ga0068860_100081331 Ga0068860_1000813312 136
192 3300005843 Ga0068860_100155985 Ga0068860_1001559853 136
193 3300005844 Ga0068862_100986915 Ga0068862_1009869152 136
194 3300005983 Ga0081540_1029496 Ga0081540_10294963 136
195 3300005985 Ga0081539_10000337 Ga0081539_1000033791 136
196 3300006163 Ga0070715_10429160 Ga0070715_104291602 136
197 3300006195 Ga0075366_10070147 Ga0075366_100701472 136
198 3300006195 Ga0075366_10250892 Ga0075366_102508921 136
199 3300006195 Ga0075366_10336226 Ga0075366_103362261 136
200 3300006237 Ga0097621_100003845 Ga0097621_1000038454 136
201 3300006237 Ga0097621_100037246 Ga0097621_1000372462 136
202 3300006237 Ga0097621_100320116 Ga0097621_1003201162 136
203 3300006237 Ga0097621_100490020 Ga0097621_1004900202 136
204 3300006358 Ga0068871_100008715 Ga0068871_1000087153 136
205 3300006358 Ga0068871_100060621 Ga0068871_1000606212 136
206 3300006358 Ga0068871_100072892 Ga0068871_1000728923 136
207 3300006358 Ga0068871_100287925 Ga0068871_1002879251 136
208 3300006358 Ga0068871_100735237 Ga0068871_1007352372 136
209 3300006881 Ga0068865_100112252 Ga0068865_1001122522 136
210 3300006931 Ga0097620_100027729 Ga0097620_1000277292 136
211 3300006931 Ga0097620_100487562 Ga0097620_1004875621 136
212 3300006931 Ga0097620_102364883 Ga0097620_1023648832 136
213 3300009093 Ga0105240_10003016 Ga0105240_100030163 136
214 3300009093 Ga0105240_10005940 Ga0105240_100059408 136
215 3300009093 Ga0105240_10025898 Ga0105240_100258988 136
216 3300009093 Ga0105240_10079750 Ga0105240_100797504 136
217 3300009093 Ga0105240_10246368 Ga0105240_102463681 136
218 3300009174 Ga0105241_10003218 Ga0105241_100032183 136
219 3300009174 Ga0105241_10577895 Ga0105241_105778952 136
220 3300009174 Ga0105241_10583492 Ga0105241_105834922 136
221 3300009545 Ga0105237_10002854 Ga0105237_1000285414 136
222 3300009545 Ga0105237_10004335 Ga0105237_1000433512 136
223 3300009545 Ga0105237_10008089 Ga0105237_100080899 136
224 3300009545 Ga0105237_10016648 Ga0105237_100166482 136
225 3300009545 Ga0105237_10044083 Ga0105237_100440833 136
226 3300009545 Ga0105237_10226734 Ga0105237_102267342 136
227 3300009545 Ga0105237_10368992 Ga0105237_103689922 136
228 3300009551 Ga0105238_10192895 Ga0105238_101928952 136
229 3300009551 Ga0105238_10277545 Ga0105238_102775453 136
230 3300009553 Ga0105249_10726768 Ga0105249_107267682 136
231 3300010375 Ga0105239_10000905 Ga0105239_1000090519 136
232 3300010375 Ga0105239_10002298 Ga0105239_100022984 136
233 3300010375 Ga0105239_10004164 Ga0105239_1000416413 136
234 3300010375 Ga0105239_10005517 Ga0105239_100055175 136
235 3300010375 Ga0105239_10193214 Ga0105239_101932143 136
236 3300010375 Ga0105239_10214043 Ga0105239_102140433 136
237 3300010375 Ga0105239_10299388 Ga0105239_102993882 136
238 3300010375 Ga0105239_11536912 Ga0105239_115369122 136
239 3300013100 Ga0157373_10076517 Ga0157373_100765171 136
240 3300013102 Ga0157371_10081651 Ga0157371_100816513 136
241 3300013102 Ga0157371_10311278 Ga0157371_103112783 136
242 3300013102 Ga0157371_10371068 Ga0157371_103710682 136
243 3300013104 Ga0157370_10010896 Ga0157370_100108966 136
244 3300013104 Ga0157370_10195689 Ga0157370_101956893 136
245 3300013104 Ga0157370_10645765 Ga0157370_106457651 136
246 3300013104 Ga0157370_10883211 Ga0157370_108832112 136
247 3300013105 Ga0157369_10008242 Ga0157369_100082425 136
248 3300013105 Ga0157369_10086327 Ga0157369_100863273 136
249 3300013296 Ga0157374_10000001 Ga0157374_10000001311 136
250 3300013296 Ga0157374_10005519 Ga0157374_100055197 136
251 3300013296 Ga0157374_10018369 Ga0157374_100183696 136
252 3300013296 Ga0157374_10137592 Ga0157374_101375923 136
253 3300013297 Ga0157378_10260104 Ga0157378_102601042 136
254 3300013306 Ga0163162_10000448 Ga0163162_1000044824 136
255 3300013306 Ga0163162_10001972 Ga0163162_100019725 136
256 3300013306 Ga0163162_10031603 Ga0163162_100316034 136
257 3300013306 Ga0163162_10269152 Ga0163162_102691522 136
258 3300013307 Ga0157372_10001344 Ga0157372_1000134412 136
259 3300013307 Ga0157372_10032732 Ga0157372_100327323 136
260 3300013307 Ga0157372_10095147 Ga0157372_100951473 136
261 3300013307 Ga0157372_10131249 Ga0157372_101312492 136
262 3300013307 Ga0157372_10140939 Ga0157372_101409392 136
263 3300013307 Ga0157372_10842445 Ga0157372_108424452 136
264 3300013308 Ga0157375_10335179 Ga0157375_103351792 136
265 3300013308 Ga0157375_10392828 Ga0157375_103928283 136
266 3300013308 Ga0157375_12202165 Ga0157375_122021651 136
267 3300014325 Ga0163163_10647837 Ga0163163_106478372 136
268 3300014325 Ga0163163_12190509 Ga0163163_121905091 136
269 3300014326 Ga0157380_10001033 Ga0157380_100010337 136
270 3300014968 Ga0157379_10031736 Ga0157379_100317362 136
271 3300014968 Ga0157379_10516026 Ga0157379_105160262 136
272 3300014969 Ga0157376_10001182 Ga0157376_1000118211 136
273 3300014969 Ga0157376_10002491 Ga0157376_100024917 136
274 3300014969 Ga0157376_10205195 Ga0157376_102051952 136
275 3300014969 Ga0157376_10309716 Ga0157376_103097162 136
276 3300014969 Ga0157376_10386594 Ga0157376_103865942 136
277 3300014969 Ga0157376_10532740 Ga0157376_105327402 136
278 3300014969 Ga0157376_10554247 Ga0157376_105542471 136
279 3300021384 Ga0213876_10015475 Ga0213876_100154752 136
280 3300025246 Ga0209646_1001770 Ga0209646_10017704 136
281 3300025302 Ga0207426_1000023 Ga0207426_1000023156 136
282 3300025321 Ga0207656_10151806 Ga0207656_101518061 136
283 3300025893 Ga0207682_10254445 Ga0207682_102544451 136
284 3300025903 Ga0207680_10080059 Ga0207680_100800591 136
285 3300025911 Ga0207654_10046381 Ga0207654_100463811 136
286 3300025911 Ga0207654_10543089 Ga0207654_105430891 136
287 3300025911 Ga0207654_10550543 Ga0207654_105505432 136
288 3300025912 Ga0207707_10013305 Ga0207707_100133053 136
289 3300025912 Ga0207707_10025996 Ga0207707_100259963 136
290 3300025912 Ga0207707_10234688 Ga0207707_102346882 136
291 3300025913 Ga0207695_10000071 Ga0207695_10000071166 136
292 3300025913 Ga0207695_10000084 Ga0207695_10000084114 136
293 3300025913 Ga0207695_10002195 Ga0207695_100021958 136
294 3300025913 Ga0207695_10006026 Ga0207695_100060265 136
295 3300025913 Ga0207695_10008205 Ga0207695_100082059 136
296 3300025913 Ga0207695_10015773 Ga0207695_100157732 136
297 3300025913 Ga0207695_10024694 Ga0207695_100246942 136
298 3300025914 Ga0207671_10067982 Ga0207671_100679823 136
299 3300025914 Ga0207671_10193844 Ga0207671_101938442 136
300 3300025914 Ga0207671_10494546 Ga0207671_104945462 136
301 3300025914 Ga0207671_11047444 Ga0207671_110474442 136
302 3300025917 Ga0207660_10013039 Ga0207660_100130393 136
303 3300025919 Ga0207657_10005086 Ga0207657_1000508610 136
304 3300025919 Ga0207657_10298334 Ga0207657_102983341 136
305 3300025921 Ga0207652_10008417 Ga0207652_100084172 136
306 3300025923 Ga0207681_10573754 Ga0207681_105737542 136
307 3300025924 Ga0207694_10193818 Ga0207694_101938182 136
308 3300025925 Ga0207650_10078318 Ga0207650_100783182 136
309 3300025925 Ga0207650_10206710 Ga0207650_102067102 136
310 3300025926 Ga0207659_10045229 Ga0207659_100452292 136
311 3300025928 Ga0207700_10637190 Ga0207700_106371902 136
312 3300025931 Ga0207644_10087315 Ga0207644_100873151 136
313 3300025931 Ga0207644_10438269 Ga0207644_104382692 136
314 3300025931 Ga0207644_10662468 Ga0207644_106624681 136
315 3300025932 Ga0207690_10475549 Ga0207690_104755492 136
316 3300025933 Ga0207706_10015444 Ga0207706_100154443 136
317 3300025934 Ga0207686_10338277 Ga0207686_103382772 136
318 3300025936 Ga0207670_10957940 Ga0207670_109579401 136
319 3300025937 Ga0207669_11424522 Ga0207669_114245221 136
320 3300025938 Ga0207704_10041366 Ga0207704_100413663 136
321 3300025940 Ga0207691_10045364 Ga0207691_100453644 136
322 3300025940 Ga0207691_10216771 Ga0207691_102167712 136
323 3300025940 Ga0207691_10335631 Ga0207691_103356312 136
324 3300025940 Ga0207691_11753945 Ga0207691_117539451 136
325 3300025942 Ga0207689_10370668 Ga0207689_103706682 136
326 3300025942 Ga0207689_10870660 Ga0207689_108706602 136
327 3300025944 Ga0207661_10011018 Ga0207661_100110184 136
328 3300025949 Ga0207667_10000177 Ga0207667_1000017787 136
329 3300025949 Ga0207667_10017709 Ga0207667_100177092 136
330 3300025949 Ga0207667_10022196 Ga0207667_100221967 136
331 3300025949 Ga0207667_10055650 Ga0207667_100556504 136
332 3300025949 Ga0207667_10113006 Ga0207667_101130063 136
333 3300025960 Ga0207651_10056467 Ga0207651_100564673 136
334 3300025960 Ga0207651_11397716 Ga0207651_113977161 136
335 3300025981 Ga0207640_10029200 Ga0207640_100292002 136
336 3300025981 Ga0207640_10064004 Ga0207640_100640041 136
337 3300025981 Ga0207640_10186571 Ga0207640_101865712 136
338 3300025981 Ga0207640_10240389 Ga0207640_102403892 136
339 3300025986 Ga0207658_10603337 Ga0207658_106033371 136
340 3300026023 Ga0207677_10012864 Ga0207677_100128643 136
341 3300026023 Ga0207677_10019483 Ga0207677_100194834 136
342 3300026035 Ga0207703_10437898 Ga0207703_104378982 136
343 3300026035 Ga0207703_11930225 Ga0207703_119302252 136
344 3300026041 Ga0207639_10088106 Ga0207639_100881063 136
345 3300026041 Ga0207639_10115315 Ga0207639_101153153 136
346 3300026041 Ga0207639_10460275 Ga0207639_104602753 136
347 3300026041 Ga0207639_10548962 Ga0207639_105489622 136
348 3300026041 Ga0207639_11964304 Ga0207639_119643041 136
349 3300026078 Ga0207702_10029222 Ga0207702_100292222 136
350 3300026078 Ga0207702_10280242 Ga0207702_102802422 136
351 3300026088 Ga0207641_10071422 Ga0207641_100714223 136
352 3300026088 Ga0207641_10124919 Ga0207641_101249194 136
353 3300026088 Ga0207641_11910643 Ga0207641_119106432 136
354 3300026089 Ga0207648_10224805 Ga0207648_102248052 136
355 3300026089 Ga0207648_10939299 Ga0207648_109392992 136
356 3300026095 Ga0207676_10299788 Ga0207676_102997882 136
357 3300026095 Ga0207676_10970159 Ga0207676_109701592 136
358 3300026116 Ga0207674_10284681 Ga0207674_102846812 136
359 3300026118 Ga0207675_100256482 Ga0207675_1002564824 136
360 3300026121 Ga0207683_10031758 Ga0207683_100317582 136
361 3300026121 Ga0207683_10339901 Ga0207683_103399012 136
362 3300026142 Ga0207698_10032709 Ga0207698_100327094 136
363 3300026142 Ga0207698_10228028 Ga0207698_102280283 136
364 3300026142 Ga0207698_10261487 Ga0207698_102614872 136
365 3300026142 Ga0207698_11566532 Ga0207698_115665321 136
366 3300028379 Ga0268266_10000038 Ga0268266_1000003831 136
367 3300028381 Ga0268264_10000167 Ga0268264_10000167120 136
368 3300028381 Ga0268264_10011712 Ga0268264_100117126 136
369 3300028381 Ga0268264_10025631 Ga0268264_100256313 136
370 3300028381 Ga0268264_10271863 Ga0268264_102718632 136
371 3300028794 Ga0307515_10000039 Ga0307515_10000039142 136
372 3300028794 Ga0307515_10548216 Ga0307515_105482162 136
373 3300028800 Ga0265338_10246535 Ga0265338_102465352 136
374 3300029957 Ga0265324_10048398 Ga0265324_100483982 136
375 3300030521 Ga0307511_10003621 Ga0307511_100036219 136
376 3300031251 Ga0265327_10306130 Ga0265327_103061301 136
377 3300031456 Ga0307513_10312479 Ga0307513_103124792 136
378 3300031456 Ga0307513_10365218 Ga0307513_103652182 136
379 3300031507 Ga0307509_10151057 Ga0307509_101510572 136
380 3300031616 Ga0307508_10266851 Ga0307508_102668512 136
381 3300031730 Ga0307516_10095407 Ga0307516_100954073 136
382 3300033179 Ga0307507_10193150 Ga0307507_101931503 136
383 3300033180 Ga0307510_10000528 Ga0307510_1000052822 136
384 3300035089 Ga0373944_0183128 Ga0373944_0183128_94_504 136
385 3300035170 Ga0373943_0341932 Ga0373943_0341932_301_720 136
386 3300035692 Ga0373935_0173590 Ga0373935_0173590_453_875 136
387 3300035692 Ga0373935_0583332 Ga0373935_0583332_202_621 136
388 3300036401 Ga0373937_0074630 Ga0373937_0074630_679_1089 136
389 3300036401 Ga0373937_1946524 Ga0373937_1946524_25_444 136
390 3300037068 Ga0373925_0352005 Ga0373925_0352005_161_571 136
391 3300037068 Ga0373925_0814840 Ga0373925_0814840_266_685 136
392 3300038443 Ga0395901_0861103 Ga0395901_0861103_370_783 136
393 3300039437 Ga0436365_1107423 Ga0436365_1107423_703_1119 136
394 3300039437 Ga0436365_1715184 Ga0436365_1715184_453_869 136
395 3300041406 Ga0439439_0017796 Ga0439439_0017796_93_506 136
396 3300041458 Ga0451798_0192664 Ga0451798_0192664_75_488 136
397 3300041459 Ga0451800_1552141 Ga0451800_1552141_71_484 136
398 3300041496 Ga0451839_0520964 Ga0451839_0520964_189_602 136
399 3300041507 Ga0451851_0290747 Ga0451851_0290747_86_499 136
400 3300041507 Ga0451851_0544823 Ga0451851_0544823_543_956 136
401 3300042007 Ga0439449_0047559 Ga0439449_0047559_1069_1482 136
402 3300042012 Ga0439455_0230035 Ga0439455_0230035_34_447 136
403 3300042014 Ga0439457_003645 Ga0439457_003645_1399_1812 136
404 3300042014 Ga0439457_149347 Ga0439457_149347_96_509 136
405 3300042015 Ga0439462_0012746 Ga0439462_0012746_203_616 136
406 3300044656 Ga0466969_0000746 Ga0466969_0000746_6513_6923 136
407 3300044658 Ga0466972_0000004 Ga0466972_0000004_251487_251909 136
408 3300044658 Ga0466972_0000038 Ga0466972_0000038_129742_130152 136
409 3300044658 Ga0466972_0042946 Ga0466972_0042946_489_1091 136
410 3300044658 Ga0466972_0281822 Ga0466972_0281822_171_581 136
411 3300044684 Ga0466966_0001759 Ga0466966_0001759_9788_10198 136
412 3300044706 Ga0466964_0862073 Ga0466964_0862073_42_455 136
413 3300044719 Ga0466971_0049048 Ga0466971_0049048_1285_1722 136
414 3300044765 Ga0466970_0001727 Ga0466970_0001727_2308_2730 136
415 3300044765 Ga0466970_0028363 Ga0466970_0028363_1238_1675 136
416 3300044842 Ga0466957_0001679 Ga0466957_0001679_8167_8586 136
417 3300044842 Ga0466957_0094917 Ga0466957_0094917_1418_1831 136
418 3300045049 Ga0466959_0000056 Ga0466959_0000056_16116_16526 136
419 3300045049 Ga0466959_0002096 Ga0466959_0002096_2351_2788 136
420 3300046459 Ga0495629_0055163 Ga0495629_0055163_347_766 136
421 3300046460 Ga0495638_0021712 Ga0495638_0021712_2330_2746 136
422 3300046460 Ga0495638_0190953 Ga0495638_0190953_554_964 136
423 3300046476 Ga0495662_0048235 Ga0495662_0048235_1601_2020 136
424 3300046507 Ga0495606_0083515 Ga0495606_0083515_1292_1702 136
425 3300046516 Ga0495628_0282321 Ga0495628_0282321_625_1044 136
426 3300046517 Ga0495630_0127460 Ga0495630_0127460_1450_1869 136
427 3300046519 Ga0495632_0230178 Ga0495632_0230178_184_597 136
428 3300046524 Ga0495648_0001092 Ga0495648_0001092_24920_25336 136
429 3300046531 Ga0495665_0088063 Ga0495665_0088063_1083_1502 136
430 3300046558 Ga0495633_0032150 Ga0495633_0032150_171_581 136
431 3300046616 Ga0495668_0002497 Ga0495668_0002497_1542_1955 136
432 3300046642 Ga0495634_0776850 Ga0495634_0776850_112_531 136
433 3300046648 Ga0495611_0042739 Ga0495611_0042739_257_673 136
434 3300046660 Ga0495625_0260277 Ga0495625_0260277_680_1105 136
435 3300046663 Ga0495635_0146062 Ga0495635_0146062_233_652 136
436 3300046683 Ga0495658_0021382 Ga0495658_0021382_2086_2505 136
437 3300046683 Ga0495658_0374843 Ga0495658_0374843_424_834 136
438 3300046689 Ga0495613_0157097 Ga0495613_0157097_267_686 136
439 3300046691 Ga0495670_0113617 Ga0495670_0113617_274_684 136
440 3300046694 Ga0495649_0040228 Ga0495649_0040228_1913_2347 136
441 3300046809 Ga0495600_0149724 Ga0495600_0149724_176_595 136
442 3300047317 Ga0495604_0077659 Ga0495604_0077659_624_1043 136
443 3300047319 Ga0495674_0030716 Ga0495674_0030716_3037_3456 136
444 3300047319 Ga0495674_0262514 Ga0495674_0262514_225_644 136
445 3300047319 Ga0495674_0461317 Ga0495674_0461317_262_729 136
446 3300047319 Ga0495674_1274188 Ga0495674_1274188_53_499 136
447 3300047471 Ga0495684_0082936 Ga0495684_0082936_456_875 136
448 3300047472 Ga0495686_0000004 Ga0495686_0000004_313337_313747 136
449 3300048908 Ga0496105_0460551 Ga0496105_0460551_435_854 136
450 3300048929 Ga0496126_0811103 Ga0496126_0811103_61_498 136
451 3300049572 Ga0501036_1274885 Ga0501036_1274885_56_469 136
452 3300049574 Ga0501038_0562889 Ga0501038_0562889_63_476 136
453 3300049575 Ga0501039_0487627 Ga0501039_0487627_108_521 136
454 3300049579 Ga0501043_0507142 Ga0501043_0507142_106_516 136
455 3300049579 Ga0501043_0571647 Ga0501043_0571647_168_581 136
456 3300049579 Ga0501043_1034296 Ga0501043_1034296_153_563 136
457 3300049580 Ga0501046_0337260 Ga0501046_0337260_306_719 136
458 3300049581 Ga0501047_0024102 Ga0501047_0024102_2979_3404 136
459 3300049581 Ga0501047_0032242 Ga0501047_0032242_650_1060 136
460 3300049581 Ga0501047_0212024 Ga0501047_0212024_1152_1565 136
461 3300049581 Ga0501047_0606706 Ga0501047_0606706_354_767 136
462 3300049583 Ga0501067_0080889 Ga0501067_0080889_1158_1571 136
463 3300049585 Ga0501069_0067667 Ga0501069_0067667_1177_1590 136
464 3300049586 Ga0501070_0111821 Ga0501070_0111821_1058_1471 136
465 3300049587 Ga0501071_0151180 Ga0501071_0151180_939_1352 136
466 3300049589 Ga0501073_0060903 Ga0501073_0060903_282_695 136
467 3300049590 Ga0501074_0399064 Ga0501074_0399064_384_797 136
468 3300049703 Ga0501219_000469 Ga0501219_000469_3063_3482 136
469 3300049742 Ga0501080_0489801 Ga0501080_0489801_418_831 136
470 3300049744 Ga0501083_0075085 Ga0501083_0075085_1458_1871 136
471 3300049758 Ga0501241_130425 Ga0501241_130425_74_487 136
472 3300049776 Ga0501280_061553 Ga0501280_061553_77_496 136
473 3300049823 Ga0501044_0003293 Ga0501044_0003293_10584_10994 136
474 3300049823 Ga0501044_0020810 Ga0501044_0020810_3104_3514 136
475 3300049823 Ga0501044_0477872 Ga0501044_0477872_570_980 136
476 3300050005 Ga0501284_00029 Ga0501284_00029_60165_60584 136
477 3300050493 nmdc:mga0k408_29233_c1 nmdc:mga0k408_29233_c1_504_917 136
478 3300050507 nmdc:mga05p37_4450_c1 nmdc:mga05p37_4450_c1_9247_9663 136
479 3300050511 nmdc:mga08y16_130270_c1 nmdc:mga08y16_130270_c1_1361_1774 136
480 3300050511 nmdc:mga08y16_368132_c1 nmdc:mga08y16_368132_c1_808_1218 136
481 3300053086 Ga0500578_0019869 Ga0500578_0019869_682_1095 136
482 3300053090 Ga0500646_0070535 Ga0500646_0070535_515_928 136
483 3300053090 Ga0500646_0088034 Ga0500646_0088034_183_599 136
484 3300053091 Ga0500647_0145543 Ga0500647_0145543_375_788 136
485 3300053092 Ga0500583_0000047 Ga0500583_0000047_64498_64911 136
486 3300053092 Ga0500583_0024358 Ga0500583_0024358_1396_1812 136
487 3300053092 Ga0500583_0116992 Ga0500583_0116992_889_1299 136
488 3300053093 Ga0500651_0327372 Ga0500651_0327372_189_602 136
489 3300053098 Ga0500650_0397273 Ga0500650_0397273_139_552 136
490 3300053104 Ga0500556_0305456 Ga0500556_0305456_39_452 136
491 3300053105 Ga0500557_197618 Ga0500557_197618_95_511 136
492 3300053130 Ga0500642_0351008 Ga0500642_0351008_202_618 136
493 3300053134 Ga0500658_0226274 Ga0500658_0226274_157_573 136
494 3300053134 Ga0500658_0429518 Ga0500658_0429518_86_499 136
495 3300053136 Ga0500559_0357263 Ga0500559_0357263_187_600 136
496 3300053136 Ga0500559_0482294 Ga0500559_0482294_77_490 136
497 3300053139 Ga0500568_0129303 Ga0500568_0129303_100_525 136
498 3300053140 Ga0500573_0441182 Ga0500573_0441182_148_564 136
499 3300053151 Ga0500604_0022496 Ga0500604_0022496_1317_1727 136
500 3300053156 Ga0500622_0002825 Ga0500622_0002825_1814_2230 136
501 3300053156 Ga0500622_0130827 Ga0500622_0130827_658_1071 136
502 3300053163 Ga0500639_129917 Ga0500639_129917_291_704 136
503 3300053178 Ga0500637_0142902 Ga0500637_0142902_295_705 136
504 3300053178 Ga0500637_0516504 Ga0500637_0516504_53_466 136
505 3300060353 Ga0501082_0117161 Ga0501082_0117161_1673_2086 136
506 3300061719 Ga0466962_0075362 Ga0466962_0075362_834_1271 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

18

103

0.98

PF13279

4HBT_2

Thioesterase-like superfamily

10

130

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v10-assembly1.cif.gz_B-2 crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 0.9453 4 130
1z54-assembly1.cif.gz_C crystal structure of a hypothetical protein tt1821 from thermus thermophilus 0.9382 4 133
2egi-assembly1.cif.gz_C crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9371 4 131
2egi-assembly1.cif.gz_A crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9361 5 131
2egi-assembly1.cif.gz_G crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9352 4 126
ID Description Score Start End Superfamily
af_Q2FYS8_3_144_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9471 4 122 3.10.129.10
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9453 4 130 3.10.129.10
2egiG00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9352 4 126 3.10.129.10
1z54D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9319 2 133 3.10.129.10
5t06C00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9292 3 135 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A5B8VJP1-F1-model_v4 Acyl-CoA thioesterase 0.9871 1 135 GO:0047617
AF-A0A1K1QTQ3-F1-model_v4 Acyl-CoA thioester hydrolase 0.9855 2 136 GO:0047617
AF-A0A1H3ZKB3-F1-model_v4 Acyl-CoA thioester hydrolase 0.9849 1 135 GO:0047617
AF-A0A1I4XML4-F1-model_v4 Acyl-CoA thioester hydrolase 0.9829 2 136 GO:0047617
AF-A0A317M6C6-F1-model_v4 Acyl-CoA thioester hydrolase 0.9825 2 136 GO:0047617

Feature Viewer

pLDDT pTM Quality
95.9 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map