F456476

General Info

Members Datasets Scaffolds Average Seq Length
506 379 1012 367

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100050220|Ga0070713_1000502202
Length 441
Sequence VEKATFCRGFRASRAIFAYPSQPQQKARLAFVAPPLADNAVFHAALTAQLYPGTLSISSGRPRNGKWLAPSVIPNSKMTQAPVSSAFTQFVTATASRNMTRAAYLAVAIGVAAMVALSVSPSFYWADAMLWACLAFFAFEWVVRLRHSAKTGRPYLFTGRGLLDSAGVIAVPIAFLLGAEPRTAWLLAVLWFVKVIPGIXXXXQLRRVMFLESGALLSVLVLFLMVLFLGSVAEYFLERDAQPQTFGNVPSALWWAVVTLTTTGYGDVVPVTPLGRLVAAMVMISGLGVFGLWTGILATGFAAETRRDNFLKTWESVSKVPFFATLGPSAIADVTHMLRTIDLPPRVTIIRKGTQGDCMYFLASGEVEVDLPGKKIQLVDGAFFGEMALLGNNTRNANITTTKLSKLLVLDLVDFRLLMARHPDLAETIDAEAKRRALENK

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
97 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
109 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
133 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
205 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
206 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
207 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
208 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
209 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
210 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
211 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
212 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
215 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
216 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
217 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
218 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
219 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
220 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
223 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
224 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
225 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
226 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
227 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
228 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
229 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
230 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
231 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
232 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
233 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
234 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
235 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
236 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
237 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
238 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
239 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
240 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
241 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
242 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
243 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
244 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
245 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
246 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
247 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
248 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
249 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
250 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
251 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
252 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
253 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
254 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
255 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
256 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
257 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
258 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
259 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
260 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
261 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
262 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
263 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
264 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
265 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
266 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
267 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
268 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
269 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
270 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
271 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
272 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
273 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
274 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
275 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
276 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
277 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
278 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
279 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
280 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
281 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
282 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
283 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
284 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
285 2922368715
286 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
287 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
288 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
289 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
290 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
291 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
292 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
293 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
294 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
295 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
296 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
297 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
298 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
299 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
300 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
301 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
302 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
303 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
304 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
305 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
306 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
307 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
308 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
309 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
310 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
311 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
312 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
313 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
314 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
315 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
316 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
317 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
318 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
319 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
320 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
321 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
322 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
323 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
324 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
325 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
326 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
327 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
328 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
329 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
330 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
331 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
332 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
333 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
334 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
335 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
336 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
337 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
338 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
339 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
340 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
341 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
342 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
343 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
344 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
345 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
346 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
347 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
348 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
349 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
350 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
351 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
352 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
353 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
354 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
355 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
356 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
357 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
358 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
359 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
360 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
361 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
362 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
363 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
364 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
365 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
366 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
367 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
368 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
369 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
370 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
371 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
372 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
373 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
374 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
375 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
376 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
377 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
378 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
379 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.71
Metatranscriptomes 0.2
Isolates 31.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.93
Nodule 24.7
Rhizoplane 4.74
Rhizosphere 52.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100050220 3300005436 Bacteria 3444
2 JGI24739J22299_10003545 3300001989 Bacteria 5962
3 rootL2_10150862 3300003322 Bacteria 2620
4 Ga0070683_100021806 3300005329 Bacteria 5718
5 Ga0070683_100347020 3300005329 Bacteria 1413
6 Ga0070680_100037747 3300005336 Bacteria 3904
7 Ga0070668_100132783 3300005347 Bacteria 1999
8 Ga0070674_100032602 3300005356 Bacteria 3460
9 Ga0070714_100105354 3300005435 Bacteria 2490
10 Ga0070713_100016400 3300005436 Bacteria 5570
11 Ga0070701_10017576 3300005438 Bacteria 3344
12 Ga0070662_100051594 3300005457 Bacteria 2971
13 Ga0070681_10062506 3300005458 Bacteria 3697
14 Ga0068867_100169772 3300005459 Bacteria 1727
15 Ga0070707_100333778 3300005468 Bacteria 1473
16 Ga0070698_100013452 3300005471 Bacteria 8661
17 Ga0070679_100070826 3300005530 Bacteria 3478
18 Ga0070679_100101135 3300005530 Bacteria 2869
19 Ga0070684_100001671 3300005535 Bacteria 16123
20 Ga0070684_100083459 3300005535 Bacteria 2831
21 Ga0068853_100029600 3300005539 Bacteria 4618
22 Ga0068853_100133144 3300005539 Bacteria 2227
23 Ga0070672_100072162 3300005543 Bacteria 2749
24 Ga0068855_100030860 3300005563 Bacteria 6406
25 Ga0068855_100044269 3300005563 Bacteria 5268
26 Ga0068855_100133397 3300005563 Bacteria 2834
27 Ga0068857_100007471 3300005577 Bacteria 9410
28 Ga0068857_100069700 3300005577 Bacteria 3131
29 Ga0068857_100150995 3300005577 Bacteria 2104
30 Ga0068857_100185979 3300005577 Bacteria 1891
31 Ga0068857_100335563 3300005577 Bacteria 1398
32 Ga0068854_100008434 3300005578 Bacteria 6625
33 Ga0068854_100010772 3300005578 Bacteria 5933
34 Ga0068854_100110891 3300005578 Bacteria 2069
35 Ga0068856_100066640 3300005614 Bacteria 3557
36 Ga0068856_100179897 3300005614 Bacteria 2127
37 Ga0068859_100044153 3300005617 Bacteria 4479
38 Ga0068866_10017272 3300005718 Bacteria 3242
39 Ga0068851_10005436 3300005834 Bacteria 5780
40 Ga0068851_10033696 3300005834 Bacteria 2554
41 Ga0068863_100068779 3300005841 Bacteria 3349
42 Ga0068858_100226771 3300005842 Bacteria 1770
43 Ga0068860_100000313 3300005843 Bacteria 66545
44 Ga0068860_100441557 3300005843 Bacteria 1292
45 Ga0068862_100124635 3300005844 Bacteria 2273
46 Ga0081540_1006515 3300005983 Bacteria 8484
47 Ga0081540_1006744 3300005983 Bacteria 8304
48 Ga0081539_10002599 3300005985 Bacteria 24763
49 Ga0070717_10001116 3300006028 Bacteria 18122
50 Ga0070716_100100367 3300006173 Bacteria 1773
51 Ga0070712_100096947 3300006175 Bacteria 2172
52 Ga0097621_100076542 3300006237 Bacteria 2776
53 Ga0097621_100077144 3300006237 Bacteria 2765
54 Ga0068865_100050981 3300006881 Bacteria 2862
55 Ga0097620_100044153 3300006931 Bacteria 4479
56 Ga0099795_10044290 3300007788 Bacteria 1595
57 Ga0105240_10001631 3300009093 Bacteria 38066
58 Ga0105240_10002788 3300009093 Bacteria 27630
59 Ga0105240_10107815 3300009093 Bacteria 3376
60 Ga0105240_10199056 3300009093 Bacteria 2349
61 Ga0105247_10161649 3300009101 Bacteria 1483
62 Ga0105243_10024514 3300009148 Bacteria 4602
63 Ga0105241_10101538 3300009174 Bacteria 2287
64 Ga0105242_10169226 3300009176 Bacteria 1919
65 Ga0105248_10028323 3300009177 Bacteria 6241
66 Ga0105237_10032859 3300009545 Bacteria 5253
67 Ga0105237_10136876 3300009545 Bacteria 2443
68 Ga0105237_10180362 3300009545 Bacteria 2112
69 Ga0105237_10413730 3300009545 Bacteria 1353
70 Ga0105238_10002394 3300009551 Bacteria 18807
71 Ga0105238_10006268 3300009551 Bacteria 11820
72 Ga0105238_10032718 3300009551 Bacteria 5292
73 Ga0105238_10119602 3300009551 Bacteria 2614
74 Ga0105239_10030726 3300010375 Bacteria 5908
75 Ga0105239_10070257 3300010375 Bacteria 3846
76 Ga0105239_10100495 3300010375 Bacteria 3199
77 Ga0105239_10395640 3300010375 Bacteria 1563
78 Ga0105246_10183919 3300011119 Bacteria 1612
79 Ga0157370_10013445 3300013104 Bacteria 8431
80 Ga0157369_10012181 3300013105 Bacteria 9761
81 Ga0157369_10037850 3300013105 Bacteria 5279
82 Ga0157369_10096088 3300013105 Bacteria 3162
83 Ga0157369_10153540 3300013105 Bacteria 2433
84 Ga0157378_10397856 3300013297 Bacteria 1357
85 Ga0163162_10056562 3300013306 Bacteria 3950
86 Ga0157375_10069684 3300013308 Bacteria 3524
87 Ga0157375_10078596 3300013308 Bacteria 3333
88 Ga0182008_10117250 3300014497 Bacteria 1322
89 Ga0163161_10080895 3300017792 Bacteria 2391
90 Ga0213875_10071605 3300021388 Bacteria 1618
91 Ga0209677_100685 3300025253 Bacteria 17344
92 Ga0209758_1004632 3300025297 Bacteria 11268
93 Ga0207656_10010552 3300025321 Bacteria 3465
94 Ga0207710_10007195 3300025900 Bacteria 4720
95 Ga0207688_10031733 3300025901 Bacteria 2918
96 Ga0207647_10000121 3300025904 Bacteria 61311
97 Ga0207645_10089315 3300025907 Bacteria 1981
98 Ga0207654_10000156 3300025911 Bacteria 43523
99 Ga0207707_10000143 3300025912 Bacteria 74226
100 Ga0207707_10206234 3300025912 Bacteria 1713
101 Ga0207707_10243997 3300025912 Bacteria 1561
102 Ga0207695_10001028 3300025913 Bacteria 49101
103 Ga0207695_10050546 3300025913 Bacteria 4372
104 Ga0207671_10051219 3300025914 Bacteria 3059
105 Ga0207660_10019489 3300025917 Bacteria 4535
106 Ga0207660_10044638 3300025917 Bacteria 3118
107 Ga0207660_10046251 3300025917 Bacteria 3070
108 Ga0207657_10005482 3300025919 Bacteria 13248
109 Ga0207657_10176087 3300025919 Bacteria 1731
110 Ga0207652_10026083 3300025921 Bacteria 4864
111 Ga0207646_10130984 3300025922 Bacteria 2257
112 Ga0207694_10000186 3300025924 Bacteria 63372
113 Ga0207694_10105140 3300025924 Bacteria 2241
114 Ga0207694_10178905 3300025924 Bacteria 1719
115 Ga0207687_10077201 3300025927 Bacteria 2395
116 Ga0207700_10012640 3300025928 Bacteria 5454
117 Ga0207700_10044587 3300025928 Bacteria 3266
118 Ga0207700_10395679 3300025928 Bacteria 1210
119 Ga0207664_10067186 3300025929 Bacteria 2876
120 Ga0207664_10075870 3300025929 Bacteria 2719
121 Ga0207706_10050702 3300025933 Bacteria 3667
122 Ga0207686_10038443 3300025934 Bacteria 2896
123 Ga0207665_10003561 3300025939 Bacteria 10406
124 Ga0207665_10052598 3300025939 Bacteria 2744
125 Ga0207665_10076173 3300025939 Bacteria 2300
126 Ga0207691_10127450 3300025940 Bacteria 2251
127 Ga0207711_10026666 3300025941 Bacteria 4850
128 Ga0207661_10014079 3300025944 Bacteria 5852
129 Ga0207661_10030099 3300025944 Bacteria 4177
130 Ga0207667_10068072 3300025949 Bacteria 3708
131 Ga0207667_10144689 3300025949 Bacteria 2447
132 Ga0207712_10085801 3300025961 Bacteria 2305
133 Ga0207668_10356471 3300025972 Bacteria 1224
134 Ga0207640_10056845 3300025981 Bacteria 2571
135 Ga0207703_10128553 3300026035 Bacteria 2185
136 Ga0207703_10246142 3300026035 Bacteria 1609
137 Ga0207639_10074678 3300026041 Bacteria 2663
138 Ga0207639_10096174 3300026041 Bacteria 2382
139 Ga0207639_10298989 3300026041 Bacteria 1422
140 Ga0207702_10000064 3300026078 Bacteria 120869
141 Ga0207702_10158103 3300026078 Bacteria 2068
142 Ga0207648_10097788 3300026089 Bacteria 2569
143 Ga0207674_10000946 3300026116 Bacteria 37958
144 Ga0207674_10001023 3300026116 Bacteria 36523
145 Ga0207674_10036150 3300026116 Bacteria 5150
146 Ga0207675_100018882 3300026118 Bacteria 6435
147 Ga0207683_10011518 3300026121 Bacteria 7550
148 Ga0207683_10020781 3300026121 Bacteria 5617
149 Ga0207698_10100177 3300026142 Bacteria 2399
150 Ga0207698_10152802 3300026142 Bacteria 2006
151 Ga0207698_10270859 3300026142 Bacteria 1565
152 Ga0209588_1005975 3300027671 Bacteria 3512
153 Ga0268264_10000356 3300028381 Bacteria 68810
154 Ga0268264_10487772 3300028381 Bacteria 1200
155 Ga0265334_10021711 3300028573 Bacteria 2621
156 Ga0307517_10000476 3300028786 Bacteria 68696
157 Ga0265330_10005365 3300031235 Bacteria 6389
158 Ga0265330_10016894 3300031235 Bacteria 3364
159 Ga0265328_10049147 3300031239 Bacteria 1549
160 Ga0265325_10024352 3300031241 Bacteria 3295
161 Ga0265339_10003456 3300031249 Bacteria 11055
162 Ga0265339_10050855 3300031249 Bacteria 2264
163 Ga0307509_10124109 3300031507 Bacteria 2553
164 Ga0307509_10238991 3300031507 Bacteria 1611
165 Ga0307508_10000715 3300031616 Bacteria 39415
166 Ga0307508_10034232 3300031616 Bacteria 4581
167 Ga0307508_10104560 3300031616 Bacteria 2428
168 Ga0265314_10012600 3300031711 Bacteria 6885
169 Ga0265342_10044703 3300031712 Bacteria 2669
170 Ga0307516_10034739 3300031730 Bacteria 5064
171 Ga0307510_10010517 3300033180 Bacteria 10993
172 Ga0316215_1000633 3300033544 Bacteria 3699
173 Ga0373938_0010796 3300034957 Bacteria 1687
174 Ga0373923_0026435 3300035111 Bacteria 2309
175 Ga0373936_0003405 3300035113 Bacteria 5962
176 Ga0373954_0037213 3300035118 Bacteria 2261
177 Ga0373954_0088945 3300035118 Bacteria 1481
178 Ga0373946_0001260 3300035171 Bacteria 8751
179 Ga0373924_0101931 3300035410 Bacteria 1235
180 Ga0373931_0044615 3300035691 Bacteria 2339
181 Ga0373935_0074295 3300035692 Bacteria 2197
182 Ga0373927_0000137 3300035695 Bacteria 56546
183 Ga0373927_0002991 3300035695 Bacteria 12261
184 Ga0373927_0003570 3300035695 Bacteria 11108
185 Ga0373927_0010284 3300035695 Bacteria 6248
186 Ga0373927_0025020 3300035695 Bacteria 3903
187 Ga0373927_0035530 3300035695 Bacteria 3240
188 Ga0373933_0034074 3300035724 Bacteria 2965
189 Ga0373933_0109881 3300035724 Bacteria 1719
190 Ga0373947_0000957 3300035725 Bacteria 17601
191 Ga0373947_0004448 3300035725 Bacteria 8219
192 Ga0373947_0021423 3300035725 Bacteria 3741
193 Ga0373937_0106258 3300036401 Bacteria 2609
194 Ga0372808_004016 3300036459 Bacteria 1847
195 Ga0373925_0006059 3300037068 Bacteria 8943
196 Ga0373925_0008802 3300037068 Bacteria 7350
197 Ga0373925_0042009 3300037068 Bacteria 3391
198 Ga0373925_0113909 3300037068 Bacteria 2092
199 Ga0395900_0127874 3300037418 Bacteria 2604
200 Ga0395898_0041792 3300037466 Bacteria 4526
201 Ga0395905_0038797 3300037471 Bacteria 4468
202 Ga0395905_0061369 3300037471 Bacteria 3517
203 Ga0436364_0694029 3300037853 Bacteria 3042
204 Ga0436364_0718815 3300037853 Bacteria 1163
205 Ga0436365_0485329 3300039437 Bacteria 17672
206 Ga0436365_1256973 3300039437 Bacteria 3688
207 Ga0436365_1520750 3300039437 Bacteria 2724
208 Ga0436363_0837537 3300039450 Bacteria 6224
209 Ga0466966_0001463 3300044684 Bacteria 15199
210 Ga0466961_0000601 3300044693 Bacteria 22652
211 Ga0466963_0023536 3300044694 Bacteria 3913
212 Ga0466968_0003565 3300044735 Bacteria 5756
213 Ga0495627_031115 3300046453 Bacteria 1688
214 Ga0495592_0070939 3300046454 Bacteria 2537
215 Ga0495603_0000029 3300046455 Bacteria 60872
216 Ga0495603_0006255 3300046455 Bacteria 7117
217 Ga0495629_0000029 3300046459 Bacteria 127000
218 Ga0495641_0002830 3300046461 Bacteria 13420
219 Ga0495651_0036737 3300046462 Bacteria 3813
220 Ga0495580_0000321 3300046472 Bacteria 39093
221 Ga0495580_0005864 3300046472 Bacteria 10082
222 Ga0495580_0193558 3300046472 Bacteria 1402
223 Ga0495582_0000024 3300046473 Bacteria 82444
224 Ga0495582_0018696 3300046473 Bacteria 3788
225 Ga0495639_0000006 3300046475 Bacteria 100361
226 Ga0495639_0027591 3300046475 Bacteria 2514
227 Ga0495662_0000068 3300046476 Bacteria 36559
228 Ga0495664_0047704 3300046477 Bacteria 2542
229 Ga0495594_0000170 3300046499 Bacteria 31295
230 Ga0495608_0137009 3300046511 Bacteria 1564
231 Ga0495618_0009287 3300046514 Bacteria 5934
232 Ga0495628_0001554 3300046516 Bacteria 21033
233 Ga0495628_0123317 3300046516 Bacteria 1986
234 Ga0495630_0000497 3300046517 Bacteria 29123
235 Ga0495630_0002513 3300046517 Bacteria 12716
236 Ga0495648_0003177 3300046524 Bacteria 14623
237 Ga0495652_0017109 3300046529 Bacteria 6473
238 Ga0495652_0042286 3300046529 Bacteria 3930
239 Ga0495665_0000158 3300046531 Bacteria 33789
240 Ga0495665_0037942 3300046531 Bacteria 2570
241 Ga0495640_0003686 3300046533 Bacteria 12313
242 Ga0495640_0014772 3300046533 Bacteria 5898
243 Ga0495640_0017074 3300046533 Bacteria 5416
244 Ga0495622_0002476 3300046557 Bacteria 8933
245 Ga0495667_0011949 3300046559 Bacteria 5883
246 Ga0495667_0033770 3300046559 Bacteria 3423
247 Ga0495634_0000354 3300046642 Bacteria 44714
248 Ga0495635_0000179 3300046663 Bacteria 40014
249 Ga0495635_0039370 3300046663 Bacteria 3270
250 Ga0495635_0128925 3300046663 Bacteria 1724
251 Ga0495588_0001137 3300046674 Bacteria 11460
252 Ga0495599_0051434 3300046678 Bacteria 2581
253 Ga0495646_0017593 3300046680 Bacteria 4532
254 Ga0495646_0019078 3300046680 Bacteria 4344
255 Ga0495647_0000068 3300046681 Bacteria 25521
256 Ga0495647_0024081 3300046681 Bacteria 2214
257 Ga0495658_0000428 3300046683 Bacteria 23516
258 Ga0495613_0001281 3300046689 Bacteria 19201
259 Ga0495613_0071952 3300046689 Bacteria 2520
260 Ga0495624_0000698 3300046690 Bacteria 26344
261 Ga0495600_0099019 3300046809 Bacteria 1900
262 Ga0495581_0000004 3300047315 Bacteria 84424
263 Ga0495581_0019684 3300047315 Bacteria 3918
264 Ga0495636_0037699 3300047318 Bacteria 1997
265 Ga0495674_0000415 3300047319 Bacteria 38235
266 Ga0495674_0018209 3300047319 Bacteria 6539
267 Ga0495672_0059232 3300047320 Bacteria 2216
268 Ga0495676_0005774 3300047321 Bacteria 11351
269 Ga0495680_0001065 3300047322 Bacteria 30372
270 Ga0495673_0026606 3300047469 Bacteria 2764
271 Ga0495684_0000721 3300047471 Bacteria 26637
272 Ga0495684_0014576 3300047471 Bacteria 6050
273 Ga0495593_0012010 3300047673 Bacteria 4963
274 Ga0495593_0057208 3300047673 Bacteria 2048
275 Ga0495602_0131270 3300048088 Bacteria 1997
276 Ga0496100_0074161 3300048903 Bacteria 2279
277 Ga0496100_0125959 3300048903 Bacteria 1798
278 Ga0496101_0155934 3300048904 Bacteria 1749
279 Ga0496103_0043437 3300048906 Bacteria 2767
280 Ga0496104_0044240 3300048907 Bacteria 4184
281 Ga0496104_0072526 3300048907 Bacteria 3274
282 Ga0496105_0097185 3300048908 Bacteria 2432
283 Ga0496105_0304596 3300048908 Bacteria 1280
284 Ga0496106_0001358 3300048909 Bacteria 18318
285 Ga0496106_0003717 3300048909 Bacteria 11385
286 Ga0496107_0009967 3300048910 Bacteria 6593
287 Ga0496108_0007465 3300048911 Bacteria 8863
288 Ga0496109_0000609 3300048912 Bacteria 29900
289 Ga0496110_0008924 3300048913 Bacteria 8082
290 Ga0496111_0015711 3300048914 Bacteria 5204
291 Ga0496112_0000035 3300048915 Bacteria 106983
292 Ga0496112_0002437 3300048915 Bacteria 14996
293 Ga0496112_0074510 3300048915 Bacteria 3356
294 Ga0496112_0129602 3300048915 Bacteria 2493
295 Ga0496113_0036807 3300048916 Bacteria 3587
296 Ga0496114_0097840 3300048917 Bacteria 2500
297 Ga0496114_0314518 3300048917 Bacteria 1383
298 Ga0496115_0124499 3300048918 Bacteria 2123
299 Ga0496115_0140567 3300048918 Bacteria 1992
300 Ga0496117_0005995 3300048920 Bacteria 12519
301 Ga0496118_0003027 3300048921 Bacteria 21693
302 Ga0496118_0047554 3300048921 Bacteria 3323
303 Ga0496119_0058770 3300048922 Bacteria 2315
304 Ga0496121_0001622 3300048924 Bacteria 37285
305 Ga0496121_0002689 3300048924 Bacteria 26584
306 Ga0496121_0094342 3300048924 Bacteria 2328
307 Ga0496121_0174410 3300048924 Bacteria 1558
308 Ga0496124_0002957 3300048927 Bacteria 21339
309 Ga0496126_0003803 3300048929 Bacteria 18741
310 Ga0496126_0158265 3300048929 Bacteria 1937
311 Ga0501047_0009870 3300049581 Bacteria 9023
312 Ga0501070_0058842 3300049586 Bacteria 3185
313 Ga0501080_0011624 3300049742 Bacteria 8062
314 nmdc:mga0n895_109284_c1 3300050512 Bacteria 2780
315 Ga0495601_0021499 3300053077 Bacteria 3952
316 Ga0495601_0182184 3300053077 Bacteria 1373
317 Ga0495612_0014144 3300053078 Bacteria 3212
318 Ga0500635_0016229 3300053080 Bacteria 2211
319 Ga0500635_0041013 3300053080 Bacteria 1546
320 Ga0495619_0007421 3300053085 Bacteria 6946
321 Ga0495619_0041451 3300053085 Bacteria 3011
322 Ga0500647_0042147 3300053091 Bacteria 2191
323 Ga0500566_0000126 3300053094 Bacteria 39286
324 Ga0500566_0062280 3300053094 Bacteria 2109
325 Ga0500640_001063 3300053095 Bacteria 7886
326 Ga0500554_000425 3300053102 Bacteria 8870
327 Ga0500572_000152 3300053111 Bacteria 24027
328 Ga0500572_002016 3300053111 Bacteria 5058
329 Ga0500595_000497 3300053119 Bacteria 23997
330 Ga0500595_009686 3300053119 Bacteria 3878
331 Ga0500595_012643 3300053119 Bacteria 3257
332 Ga0500614_003977 3300053123 Bacteria 3153
333 Ga0500655_020617 3300053133 Bacteria 1233
334 Ga0500559_0000230 3300053136 Bacteria 44504
335 Ga0500559_0003160 3300053136 Bacteria 8183
336 Ga0500568_0059759 3300053139 Bacteria 1478
337 Ga0500573_0004388 3300053140 Bacteria 7421
338 Ga0500590_073346 3300053148 Bacteria 1697
339 Ga0500603_001822 3300053150 Bacteria 4783
340 Ga0500630_000113 3300053159 Bacteria 26665
341 Ga0500639_000039 3300053163 Bacteria 65182
342 Ga0500639_019582 3300053163 Bacteria 3569
343 Ga0500637_0000131 3300053178 Bacteria 27270
344 Ga0500637_0008745 3300053178 Bacteria 5124
345 Ga0500596_001316 3300053735 Bacteria 5006
346 Ga0500596_003162 3300053735 Bacteria 3161
347 Ga0500596_005445 3300053735 Bacteria 2240
348 Ga0466962_0032010 3300061719 Bacteria 2518
349 2507505881 2507262055 Bacteria 8048963
350 2508540072 2508501009 Bacteria 7784016
351 2508696142 2508501042 Bacteria 8719808
352 2511396634 2511231028 Bacteria 8046582
353 2513638795 2513237094 Bacteria 8789602
354 2513649855 2513237095 Bacteria 8976980
355 2513715429 2513237104 Bacteria 10034502
356 2513877283 2513237139 Bacteria 8737671
357 2513891661 2513237141 Bacteria 8496279
358 2514011230 2513237161 Bacteria 8871253
359 2515631713 2515154112 Bacteria 8294334
360 2517105706 2517093001 Bacteria 9002274
361 2524435450 2524023205 Bacteria 8918781
362 2528851318 2528768022 Bacteria 10457665
363 2617347765 2617270735 Bacteria 9163226
364 2728753865 2728368998 Bacteria 8720350
365 2745081386 2744054633 Bacteria 8678936
366 2793061579 2791355196 Bacteria 7323613
367 2805916117 2802429603 Bacteria 8777136
368 2818240855 2816332527 Bacteria 8933356
369 2824663756 2824661429 Bacteria 9877870
370 2824676124 2824671348 Bacteria 8369588
371 2824680238 2824679649 Bacteria 8248951
372 2824692477 2824687955 Bacteria 8360029
373 2824699899 2824696289 Bacteria 8335049
374 2824706081 2824704595 Bacteria 9667483
375 2824760286 2824753945 Bacteria 9787441
376 2824771525 2824763712 Bacteria 9792355
377 2824775755 2824773399 Bacteria 8360218
378 2838125128 2838122688 Bacteria 8803140
379 2841945867 2841941048 Bacteria 8688029
380 2841956807 2841949485 Bacteria 8680857
381 2841965291 2841957949 Bacteria 8652217
382 2841973323 2841966195 Bacteria 8673214
383 2841979514 2841974524 Bacteria 8931498
384 2841989362 2841983080 Bacteria 8395090
385 2842044353 2842038055 Bacteria 8002051
386 2842051658 2842045827 Bacteria 8006841
387 2844321499 2844315083 Bacteria 8138177
388 2847939484 2847930680 Bacteria 9342022
389 2847941232 2847939898 Bacteria 8606328
390 2849082223 2849076700 Bacteria 7039503
391 2874620205 2874612657 Bacteria 8252029
392 2874622428 2874620515 Bacteria 8290088
393 2874633353 2874628541 Bacteria 8630250
394 2874650369 2874645413 Bacteria 8214782
395 2876761706 2876761206 Bacteria 10111113
396 2879091074 2879083081 Bacteria 8587928
397 2879106639 2879099564 Bacteria 10442239
398 2879128214 2879127579 Bacteria 8294491
399 2879143543 2879142872 Bacteria 8267021
400 2881670166 2881665667 Bacteria 8175609
401 2885367708 2885366525 Bacteria 8326213
402 2885418247 2885409591 Bacteria 9235467
403 2888387754 2888378607 Bacteria 9652610
404 2888389972 2888388044 Bacteria 7304136
405 2903727922 2903727486 Bacteria 8281579
406 2904671565 2904666416 Bacteria 8226587
407 2904718108 2904711408 Bacteria 9771557
408 2906602594 2906602504 Bacteria 8295279
409 2906631921 2906626472 Bacteria 8826946
410 2906648650 2906643746 Bacteria 8722424
411 2922366762 2922361189 Bacteria 7436256
412 2922377458
413 2922389332 2922386360 Bacteria 7017218
414 2922393366 2922393267 Bacteria 8285685
415 2929622251 2929615660 Bacteria 9193770
416 2929630102 2929624759 Bacteria 9339455
417 2932787965 2932784394 Bacteria 9704911
418 2932799501 2932794094 Bacteria 7915132
419 2932805193 2932801729 Bacteria 7987968
420 2932813340 2932809354 Bacteria 9135765
421 2932820037 2932818245 Bacteria 9955613
422 2932832899 2932828146 Bacteria 9745859
423 2933584135 2933577622 Bacteria 9116884
424 2935614305 2935608549 Bacteria 8203142
425 2935620384 2935616580 Bacteria 9032984
426 2935640708 2935638405 Bacteria 10015038
427 2935649333 2935648319 Bacteria 8801166
428 2935657895 2935656913 Bacteria 8965014
429 2935668900 2935665750 Bacteria 9571747
430 2935681375 2935675223 Bacteria 9928132
431 2935687208 2935684952 Bacteria 9590419
432 2935696820 2935694250 Bacteria 9291695
433 2935709088 2935703347 Bacteria 10242284
434 2935716896 2935713505 Bacteria 9608509
435 2935722979 2935722832 Bacteria 9608746
436 2935734536 2935732158 Bacteria 9706831
437 2935744673 2935741537 Bacteria 9707219
438 2935753174 2935750917 Bacteria 9590372
439 2935767579 2935760218 Bacteria 9817913
440 2935770172 2935769743 Bacteria 7878163
441 2935777798 2935777560 Bacteria 8077691
442 2935786774 2935785616 Bacteria 7962367
443 2935794828 2935793552 Bacteria 8012592
444 2935804818 2935801545 Bacteria 9301974
445 2935815967 2935810662 Bacteria 9401221
446 2935826523 2935819856 Bacteria 8261050
447 2935832215 2935827899 Bacteria 10038562
448 2935840955 2935837841 Bacteria 9454360
449 2935851183 2935847175 Bacteria 8228321
450 2935859270 2935855204 Bacteria 9035059
451 2935864454 2935864058 Bacteria 9784707
452 2935875194 2935873716 Bacteria 9632195
453 2935887717 2935883170 Bacteria 7964738
454 2935913232 2935908558 Bacteria 8568796
455 2935922654 2935916978 Bacteria 9113783
456 2935930843 2935926038 Bacteria 8601059
457 2935939823 2935934488 Bacteria 8602579
458 2935946772 2935942939 Bacteria 8599779
459 2935956027 2935951376 Bacteria 8602333
460 2935963895 2935959822 Bacteria 7869783
461 2935972820 2935967501 Bacteria 8603075
462 2935978263 2935975950 Bacteria 8347125
463 2935985609 2935984226 Bacteria 8302647
464 2935995831 2935992306 Bacteria 9802711
465 2936005742 2936002035 Bacteria 9362176
466 2936012114 2936011229 Bacteria 8801034
467 2936020805 2936019824 Bacteria 8804134
468 2936029407 2936028420 Bacteria 8965941
469 2936041870 2936037263 Bacteria 9446081
470 2936048269 2936046547 Bacteria 8903709
471 2936056620 2936055302 Bacteria 8785755
472 2940559087 2940556831 Bacteria 9590747
473 2941532079 2941531003 Bacteria 7653939
474 2941541783 2941538514 Bacteria 9402094
475 3005485829 3005483717 Bacteria 7877331
476 3005588818 3005587118 Bacteria 7794411
477 3005601865 3005594810 Bacteria 8716512
478 3005717604 3005710791 Bacteria 7622528
479 3005724653 3005718088 Bacteria 8283608
480 8006931603 8006926726 Bacteria 6749210
481 8016517304 8016511872 Bacteria 9921665
482 8016545221 8016539877 Bacteria 8155419
483 8016565217 8016557553 Bacteria 8154380
484 8016570301 8016566248 Bacteria 8158151
485 8016582849 8016575299 Bacteria 8154085
486 8016585458 8016583857 Bacteria 10421953
487 8016602861 8016595262 Bacteria 8149947
488 8016617638 8016613128 Bacteria 8794220
489 8016623932 8016622563 Bacteria 7999408
490 8016634936 8016630954 Bacteria 9217207
491 8017059293 8017057580 Bacteria 10023680
492 8019531829 8019530166 Bacteria 8155624
493 8019539699 8019538911 Bacteria 7872763
494 8019550950 8019547302 Bacteria 7996444
495 8019576338 8019576017 Bacteria 10049540
496 8019607354 8019597564 Bacteria 10041141
497 8019611163 8019608314 Bacteria 10042931
498 8019622008 8019619141 Bacteria 9218857
499 8019631314 8019629233 Bacteria 8687553
500 8019639309 8019638758 Bacteria 9062356
501 8019651727 8019648815 Bacteria 10014479
502 8019677583 8019668869 Bacteria 8791617
503 8019687365 8019678201 Bacteria 8863603
504 8019693341 8019687851 Bacteria 8712826
505 8055743500 8055742211 Bacteria 9226248
506 8056975375 8056967851 Bacteria 9038162
507 Ga0070713_100050220
508 JGI24739J22299_10003545
509 rootL2_10150862
510 Ga0070683_100021806
511 Ga0070683_100347020
512 Ga0070680_100037747
513 Ga0070668_100132783
514 Ga0070674_100032602
515 Ga0070714_100105354
516 Ga0070713_100016400
517 Ga0070701_10017576
518 Ga0070662_100051594
519 Ga0070681_10062506
520 Ga0068867_100169772
521 Ga0070707_100333778
522 Ga0070698_100013452
523 Ga0070679_100070826
524 Ga0070679_100101135
525 Ga0070684_100001671
526 Ga0070684_100083459
527 Ga0068853_100029600
528 Ga0068853_100133144
529 Ga0070672_100072162
530 Ga0068855_100030860
531 Ga0068855_100044269
532 Ga0068855_100133397
533 Ga0068857_100007471
534 Ga0068857_100069700
535 Ga0068857_100150995
536 Ga0068857_100185979
537 Ga0068857_100335563
538 Ga0068854_100008434
539 Ga0068854_100010772
540 Ga0068854_100110891
541 Ga0068856_100066640
542 Ga0068856_100179897
543 Ga0068859_100044153
544 Ga0068866_10017272
545 Ga0068851_10005436
546 Ga0068851_10033696
547 Ga0068863_100068779
548 Ga0068858_100226771
549 Ga0068860_100000313
550 Ga0068860_100441557
551 Ga0068862_100124635
552 Ga0081540_1006515
553 Ga0081540_1006744
554 Ga0081539_10002599
555 Ga0070717_10001116
556 Ga0070716_100100367
557 Ga0070712_100096947
558 Ga0097621_100076542
559 Ga0097621_100077144
560 Ga0068865_100050981
561 Ga0097620_100044153
562 Ga0099795_10044290
563 Ga0105240_10001631
564 Ga0105240_10002788
565 Ga0105240_10107815
566 Ga0105240_10199056
567 Ga0105247_10161649
568 Ga0105243_10024514
569 Ga0105241_10101538
570 Ga0105242_10169226
571 Ga0105248_10028323
572 Ga0105237_10032859
573 Ga0105237_10136876
574 Ga0105237_10180362
575 Ga0105237_10413730
576 Ga0105238_10002394
577 Ga0105238_10006268
578 Ga0105238_10032718
579 Ga0105238_10119602
580 Ga0105239_10030726
581 Ga0105239_10070257
582 Ga0105239_10100495
583 Ga0105239_10395640
584 Ga0105246_10183919
585 Ga0157370_10013445
586 Ga0157369_10012181
587 Ga0157369_10037850
588 Ga0157369_10096088
589 Ga0157369_10153540
590 Ga0157378_10397856
591 Ga0163162_10056562
592 Ga0157375_10069684
593 Ga0157375_10078596
594 Ga0182008_10117250
595 Ga0163161_10080895
596 Ga0213875_10071605
597 Ga0209677_100685
598 Ga0209758_1004632
599 Ga0207656_10010552
600 Ga0207710_10007195
601 Ga0207688_10031733
602 Ga0207647_10000121
603 Ga0207645_10089315
604 Ga0207654_10000156
605 Ga0207707_10000143
606 Ga0207707_10206234
607 Ga0207707_10243997
608 Ga0207695_10001028
609 Ga0207695_10050546
610 Ga0207671_10051219
611 Ga0207660_10019489
612 Ga0207660_10044638
613 Ga0207660_10046251
614 Ga0207657_10005482
615 Ga0207657_10176087
616 Ga0207652_10026083
617 Ga0207646_10130984
618 Ga0207694_10000186
619 Ga0207694_10105140
620 Ga0207694_10178905
621 Ga0207687_10077201
622 Ga0207700_10012640
623 Ga0207700_10044587
624 Ga0207700_10395679
625 Ga0207664_10067186
626 Ga0207664_10075870
627 Ga0207706_10050702
628 Ga0207686_10038443
629 Ga0207665_10003561
630 Ga0207665_10052598
631 Ga0207665_10076173
632 Ga0207691_10127450
633 Ga0207711_10026666
634 Ga0207661_10014079
635 Ga0207661_10030099
636 Ga0207667_10068072
637 Ga0207667_10144689
638 Ga0207712_10085801
639 Ga0207668_10356471
640 Ga0207640_10056845
641 Ga0207703_10128553
642 Ga0207703_10246142
643 Ga0207639_10074678
644 Ga0207639_10096174
645 Ga0207639_10298989
646 Ga0207702_10000064
647 Ga0207702_10158103
648 Ga0207648_10097788
649 Ga0207674_10000946
650 Ga0207674_10001023
651 Ga0207674_10036150
652 Ga0207675_100018882
653 Ga0207683_10011518
654 Ga0207683_10020781
655 Ga0207698_10100177
656 Ga0207698_10152802
657 Ga0207698_10270859
658 Ga0209588_1005975
659 Ga0268264_10000356
660 Ga0268264_10487772
661 Ga0265334_10021711
662 Ga0307517_10000476
663 Ga0265330_10005365
664 Ga0265330_10016894
665 Ga0265328_10049147
666 Ga0265325_10024352
667 Ga0265339_10003456
668 Ga0265339_10050855
669 Ga0307509_10124109
670 Ga0307509_10238991
671 Ga0307508_10000715
672 Ga0307508_10034232
673 Ga0307508_10104560
674 Ga0265314_10012600
675 Ga0265342_10044703
676 Ga0307516_10034739
677 Ga0307510_10010517
678 Ga0316215_1000633
679 Ga0373938_0010796
680 Ga0373923_0026435
681 Ga0373936_0003405
682 Ga0373954_0037213
683 Ga0373954_0088945
684 Ga0373946_0001260
685 Ga0373924_0101931
686 Ga0373931_0044615
687 Ga0373935_0074295
688 Ga0373927_0000137
689 Ga0373927_0002991
690 Ga0373927_0003570
691 Ga0373927_0010284
692 Ga0373927_0025020
693 Ga0373927_0035530
694 Ga0373933_0034074
695 Ga0373933_0109881
696 Ga0373947_0000957
697 Ga0373947_0004448
698 Ga0373947_0021423
699 Ga0373937_0106258
700 Ga0372808_004016
701 Ga0373925_0006059
702 Ga0373925_0008802
703 Ga0373925_0042009
704 Ga0373925_0113909
705 Ga0395900_0127874
706 Ga0395898_0041792
707 Ga0395905_0038797
708 Ga0395905_0061369
709 Ga0436364_0694029
710 Ga0436364_0718815
711 Ga0436365_0485329
712 Ga0436365_1256973
713 Ga0436365_1520750
714 Ga0436363_0837537
715 Ga0466966_0001463
716 Ga0466961_0000601
717 Ga0466963_0023536
718 Ga0466968_0003565
719 Ga0495627_031115
720 Ga0495592_0070939
721 Ga0495603_0000029
722 Ga0495603_0006255
723 Ga0495629_0000029
724 Ga0495641_0002830
725 Ga0495651_0036737
726 Ga0495580_0000321
727 Ga0495580_0005864
728 Ga0495580_0193558
729 Ga0495582_0000024
730 Ga0495582_0018696
731 Ga0495639_0000006
732 Ga0495639_0027591
733 Ga0495662_0000068
734 Ga0495664_0047704
735 Ga0495594_0000170
736 Ga0495608_0137009
737 Ga0495618_0009287
738 Ga0495628_0001554
739 Ga0495628_0123317
740 Ga0495630_0000497
741 Ga0495630_0002513
742 Ga0495648_0003177
743 Ga0495652_0017109
744 Ga0495652_0042286
745 Ga0495665_0000158
746 Ga0495665_0037942
747 Ga0495640_0003686
748 Ga0495640_0014772
749 Ga0495640_0017074
750 Ga0495622_0002476
751 Ga0495667_0011949
752 Ga0495667_0033770
753 Ga0495634_0000354
754 Ga0495635_0000179
755 Ga0495635_0039370
756 Ga0495635_0128925
757 Ga0495588_0001137
758 Ga0495599_0051434
759 Ga0495646_0017593
760 Ga0495646_0019078
761 Ga0495647_0000068
762 Ga0495647_0024081
763 Ga0495658_0000428
764 Ga0495613_0001281
765 Ga0495613_0071952
766 Ga0495624_0000698
767 Ga0495600_0099019
768 Ga0495581_0000004
769 Ga0495581_0019684
770 Ga0495636_0037699
771 Ga0495674_0000415
772 Ga0495674_0018209
773 Ga0495672_0059232
774 Ga0495676_0005774
775 Ga0495680_0001065
776 Ga0495673_0026606
777 Ga0495684_0000721
778 Ga0495684_0014576
779 Ga0495593_0012010
780 Ga0495593_0057208
781 Ga0495602_0131270
782 Ga0496100_0074161
783 Ga0496100_0125959
784 Ga0496101_0155934
785 Ga0496103_0043437
786 Ga0496104_0044240
787 Ga0496104_0072526
788 Ga0496105_0097185
789 Ga0496105_0304596
790 Ga0496106_0001358
791 Ga0496106_0003717
792 Ga0496107_0009967
793 Ga0496108_0007465
794 Ga0496109_0000609
795 Ga0496110_0008924
796 Ga0496111_0015711
797 Ga0496112_0000035
798 Ga0496112_0002437
799 Ga0496112_0074510
800 Ga0496112_0129602
801 Ga0496113_0036807
802 Ga0496114_0097840
803 Ga0496114_0314518
804 Ga0496115_0124499
805 Ga0496115_0140567
806 Ga0496117_0005995
807 Ga0496118_0003027
808 Ga0496118_0047554
809 Ga0496119_0058770
810 Ga0496121_0001622
811 Ga0496121_0002689
812 Ga0496121_0094342
813 Ga0496121_0174410
814 Ga0496124_0002957
815 Ga0496126_0003803
816 Ga0496126_0158265
817 Ga0501047_0009870
818 Ga0501070_0058842
819 Ga0501080_0011624
820 nmdc:mga0n895_109284_c1
821 Ga0495601_0021499
822 Ga0495601_0182184
823 Ga0495612_0014144
824 Ga0500635_0016229
825 Ga0500635_0041013
826 Ga0495619_0007421
827 Ga0495619_0041451
828 Ga0500647_0042147
829 Ga0500566_0000126
830 Ga0500566_0062280
831 Ga0500640_001063
832 Ga0500554_000425
833 Ga0500572_000152
834 Ga0500572_002016
835 Ga0500595_000497
836 Ga0500595_009686
837 Ga0500595_012643
838 Ga0500614_003977
839 Ga0500655_020617
840 Ga0500559_0000230
841 Ga0500559_0003160
842 Ga0500568_0059759
843 Ga0500573_0004388
844 Ga0500590_073346
845 Ga0500603_001822
846 Ga0500630_000113
847 Ga0500639_000039
848 Ga0500639_019582
849 Ga0500637_0000131
850 Ga0500637_0008745
851 Ga0500596_001316
852 Ga0500596_003162
853 Ga0500596_005445
854 Ga0466962_0032010
855 2507505881
856 2508540072
857 2508696142
858 2511396634
859 2513638795
860 2513649855
861 2513715429
862 2513877283
863 2513891661
864 2514011230
865 2515631713
866 2517105706
867 2524435450
868 2528851318
869 2617347765
870 2728753865
871 2745081386
872 2793061579
873 2805916117
874 2818240855
875 2824663756
876 2824676124
877 2824680238
878 2824692477
879 2824699899
880 2824706081
881 2824760286
882 2824771525
883 2824775755
884 2838125128
885 2841945867
886 2841956807
887 2841965291
888 2841973323
889 2841979514
890 2841989362
891 2842044353
892 2842051658
893 2844321499
894 2847939484
895 2847941232
896 2849082223
897 2874620205
898 2874622428
899 2874633353
900 2874650369
901 2876761706
902 2879091074
903 2879106639
904 2879128214
905 2879143543
906 2881670166
907 2885367708
908 2885418247
909 2888387754
910 2888389972
911 2903727922
912 2904671565
913 2904718108
914 2906602594
915 2906631921
916 2906648650
917 2922366762
918 2922377458
919 2922389332
920 2922393366
921 2929622251
922 2929630102
923 2932787965
924 2932799501
925 2932805193
926 2932813340
927 2932820037
928 2932832899
929 2933584135
930 2935614305
931 2935620384
932 2935640708
933 2935649333
934 2935657895
935 2935668900
936 2935681375
937 2935687208
938 2935696820
939 2935709088
940 2935716896
941 2935722979
942 2935734536
943 2935744673
944 2935753174
945 2935767579
946 2935770172
947 2935777798
948 2935786774
949 2935794828
950 2935804818
951 2935815967
952 2935826523
953 2935832215
954 2935840955
955 2935851183
956 2935859270
957 2935864454
958 2935875194
959 2935887717
960 2935913232
961 2935922654
962 2935930843
963 2935939823
964 2935946772
965 2935956027
966 2935963895
967 2935972820
968 2935978263
969 2935985609
970 2935995831
971 2936005742
972 2936012114
973 2936020805
974 2936029407
975 2936041870
976 2936048269
977 2936056620
978 2940559087
979 2941532079
980 2941541783
981 3005485829
982 3005588818
983 3005601865
984 3005717604
985 3005724653
986 8006931603
987 8016517304
988 8016545221
989 8016565217
990 8016570301
991 8016582849
992 8016585458
993 8016602861
994 8016617638
995 8016623932
996 8016634936
997 8017059293
998 8019531829
999 8019539699
1000 8019550950
1001 8019576338
1002 8019607354
1003 8019611163
1004 8019622008
1005 8019631314
1006 8019639309
1007 8019651727
1008 8019677583
1009 8019687365
1010 8019693341
1011 8055743500
1012 8056975375

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

340

422

0.91

PF00520

Ion_trans

Ion transport protein

98

309

0.83

PF07885

Ion_trans_2

Ion channel

220

302

0.83

Map