F456436

General Info

Members Datasets Scaffolds Average Seq Length
505 221 1010 252

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_504940_c1|nmdc:mga0n895_504940_c1_144_1079
Length 301
Sequence MRPSSPLARRVTAWSGRSRAASFNKSAIIDPQSPITIDNPQSIEDLRHNAQVRRELLIAFVIVSSVSAAADVQFGAQYPRQSELTYDGRFTFVRLRWVSDFGYSRRGFSSAWNHDYPRAEQHLSMILKELTLLDPHTEDSLILTLDDPELFNYPIAFMWEPGFWNLTDREAESFRAYLLKGGFAVFEDFDGVQQWSNFEAQMRRVLPDAKFVKLDNTHRIYDSFFRIKDIDAIVHPMSGIRPRYYGIFEDNDPSKRLMVVANFDNDVPEYWEWSGEGLFPFDASNEAYKLGVNYVIYGLTH

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
153 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
154 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
155 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
156 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
157 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
158 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
161 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
172 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
173 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
174 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
204 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
205 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.18
Nodule 0
Rhizoplane 4.16
Rhizosphere 93.66
Stem 0
Stem Tuber 0
Unclassified 20

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_504940_c1 3300050512 Bacteria 1218
2 Ga0065704_10229153 3300005289 Bacteria 1049
3 Ga0065712_10001042 3300005290 Bacteria 7741
4 Ga0065712_10002470 3300005290 Bacteria 8324
5 Ga0065715_10092197 3300005293 Bacteria 5262
6 Ga0065715_10114244 3300005293 Bacteria 2458
7 Ga0065715_10249250 3300005293 Bacteria 1173
8 Ga0065707_10089350 3300005295 Bacteria 4394
9 Ga0065707_10181475 3300005295 Bacteria 1416
10 Ga0070683_100013736 3300005329 Bacteria 7070
11 Ga0070690_100348033 3300005330 Bacteria 1075
12 Ga0070670_100001347 3300005331 Bacteria 19652
13 Ga0070670_100001816 3300005331 Bacteria 17386
14 Ga0070670_100340558 3300005331 Bacteria 1316
15 Ga0070670_100396068 3300005331 Unclassified 1218
16 Ga0070677_10042123 3300005333 Bacteria 1806
17 Ga0070677_10102142 3300005333 Unclassified 1266
18 Ga0068869_100380431 3300005334 Bacteria 1157
19 Ga0070666_10045102 3300005335 Bacteria 2955
20 Ga0070666_10052767 3300005335 Bacteria 2741
21 Ga0070680_100097566 3300005336 Bacteria 2437
22 Ga0070680_100100258 3300005336 Bacteria 2403
23 Ga0070680_100141015 3300005336 Bacteria 2021
24 Ga0070680_100300973 3300005336 Bacteria 1360
25 Ga0068868_100044387 3300005338 Bacteria 3476
26 Ga0070689_100106797 3300005340 Bacteria 2222
27 Ga0070687_100097790 3300005343 Bacteria 1637
28 Ga0070661_100012492 3300005344 Bacteria 5940
29 Ga0070668_100229443 3300005347 Unclassified 1534
30 Ga0070669_100017576 3300005353 Bacteria 5100
31 Ga0070669_100369692 3300005353 Unclassified 1168
32 Ga0070675_100000160 3300005354 Bacteria 41010
33 Ga0070675_100023007 3300005354 Bacteria 4979
34 Ga0070675_100035874 3300005354 Bacteria 4032
35 Ga0070675_100113116 3300005354 Bacteria 2298
36 Ga0070675_100187742 3300005354 Bacteria 1790
37 Ga0070671_100016984 3300005355 Bacteria 5885
38 Ga0070674_100293396 3300005356 Bacteria 1294
39 Ga0070674_100645806 3300005356 Unclassified 899
40 Ga0070673_100021741 3300005364 Bacteria 4659
41 Ga0070673_100169480 3300005364 Bacteria 1863
42 Ga0070673_100514624 3300005364 Bacteria 1084
43 Ga0070688_100046578 3300005365 Unclassified 2686
44 Ga0070688_100274933 3300005365 Unclassified 1208
45 Ga0070659_100112952 3300005366 Unclassified 2194
46 Ga0070667_100007809 3300005367 Bacteria 8871
47 Ga0070667_100244178 3300005367 Unclassified 1604
48 Ga0070705_100316961 3300005440 Bacteria 1124
49 Ga0070700_100019179 3300005441 Bacteria 3944
50 Ga0070700_100022454 3300005441 Bacteria 3679
51 Ga0070694_100111179 3300005444 Unclassified 1952
52 Ga0070694_100242222 3300005444 Unclassified 1361
53 Ga0070663_100037947 3300005455 Bacteria 3357
54 Ga0070678_100007393 3300005456 Bacteria 6512
55 Ga0070678_100036143 3300005456 Bacteria 3455
56 Ga0070662_100350238 3300005457 Bacteria 1210
57 Ga0068867_100102722 3300005459 Bacteria 2185
58 Ga0068867_100264495 3300005459 Unclassified 1403
59 Ga0070685_10458889 3300005466 Unclassified 894
60 Ga0070707_100084604 3300005468 Bacteria 3065
61 Ga0070707_100194645 3300005468 Bacteria 1977
62 Ga0070698_100033204 3300005471 Bacteria 5345
63 Ga0070698_100150865 3300005471 Bacteria 2272
64 Ga0070698_100418124 3300005471 Bacteria 1275
65 Ga0070699_100001797 3300005518 Bacteria 19519
66 Ga0070699_100130434 3300005518 Bacteria 2216
67 Ga0070679_100423686 3300005530 Unclassified 1276
68 Ga0070684_100002478 3300005535 Bacteria 13598
69 Ga0070697_100203452 3300005536 Bacteria 1683
70 Ga0070672_100006710 3300005543 Bacteria 7760
71 Ga0070672_100118288 3300005543 Bacteria 2167
72 Ga0070686_100000142 3300005544 Bacteria 49233
73 Ga0070686_100073869 3300005544 Bacteria 2240
74 Ga0070695_100120844 3300005545 Unclassified 1792
75 Ga0070695_100138677 3300005545 Bacteria 1684
76 Ga0070695_100343103 3300005545 Bacteria 1117
77 Ga0070696_100017328 3300005546 Bacteria 4863
78 Ga0070696_100484930 3300005546 Bacteria 981
79 Ga0070696_100532390 3300005546 Unclassified 939
80 Ga0070693_100031914 3300005547 Unclassified 2892
81 Ga0070665_100010635 3300005548 Bacteria 9313
82 Ga0070665_100025534 3300005548 Bacteria 5951
83 Ga0070665_100531395 3300005548 Bacteria 1188
84 Ga0070704_100133930 3300005549 Unclassified 1925
85 Ga0070704_100214384 3300005549 Bacteria 1562
86 Ga0070704_100223824 3300005549 Bacteria 1531
87 Ga0068855_100219973 3300005563 Bacteria 2130
88 Ga0070664_100000363 3300005564 Bacteria 33478
89 Ga0070664_100236443 3300005564 Unclassified 1639
90 Ga0068857_100009388 3300005577 Bacteria 8490
91 Ga0068857_100078404 3300005577 Bacteria 2949
92 Ga0068854_100028265 3300005578 Unclassified 3873
93 Ga0068854_100039689 3300005578 Unclassified 3317
94 Ga0070702_100417097 3300005615 Unclassified 965
95 Ga0068852_100957507 3300005616 Bacteria 874
96 Ga0068859_100127526 3300005617 Bacteria 2614
97 Ga0068859_101054545 3300005617 Unclassified 893
98 Ga0068864_100013610 3300005618 Bacteria 6744
99 Ga0068864_100046147 3300005618 Unclassified 3738
100 Ga0068866_10010769 3300005718 Bacteria 3931
101 Ga0068866_10044423 3300005718 Bacteria 2223
102 Ga0068861_100026299 3300005719 Bacteria 4229
103 Ga0068861_100056107 3300005719 Bacteria 3006
104 Ga0068870_10053276 3300005840 Bacteria 2148
105 Ga0068870_10149809 3300005840 Bacteria 1373
106 Ga0068863_100000704 3300005841 Bacteria 33679
107 Ga0068863_100075431 3300005841 Bacteria 3191
108 Ga0068863_100143284 3300005841 Unclassified 2285
109 Ga0068863_100435655 3300005841 Bacteria 1285
110 Ga0068858_100019828 3300005842 Bacteria 6287
111 Ga0068858_100077931 3300005842 Bacteria 3079
112 Ga0068858_100217942 3300005842 Unclassified 1807
113 Ga0068858_100269230 3300005842 Unclassified 1621
114 Ga0068860_100011626 3300005843 Bacteria 8681
115 Ga0068860_100241908 3300005843 Bacteria 1756
116 Ga0068862_100032117 3300005844 Bacteria 4435
117 Ga0081455_10057216 3300005937 Bacteria 3305
118 Ga0075365_10011503 3300006038 Bacteria 5205
119 Ga0075368_10039373 3300006042 Bacteria 1853
120 Ga0075368_10141420 3300006042 Unclassified 1003
121 Ga0075364_10003789 3300006051 Bacteria 8649
122 Ga0075367_10191896 3300006178 Bacteria 1275
123 Ga0075366_10013893 3300006195 Bacteria 4589
124 Ga0075366_10014212 3300006195 Unclassified 4545
125 Ga0097621_100019222 3300006237 Bacteria 5240
126 Ga0097621_100050537 3300006237 Bacteria 3381
127 Ga0068871_100014256 3300006358 Bacteria 5919
128 Ga0068871_100030481 3300006358 Bacteria 4247
129 Ga0068871_100218407 3300006358 Bacteria 1651
130 Ga0068871_100421210 3300006358 Bacteria 1192
131 Ga0068871_100615230 3300006358 Unclassified 989
132 Ga0075428_100005108 3300006844 Bacteria 14588
133 Ga0075428_100005585 3300006844 Bacteria 13969
134 Ga0075428_100024844 3300006844 Bacteria 6628
135 Ga0075428_100040597 3300006844 Bacteria 5118
136 Ga0075428_100203378 3300006844 Bacteria 2140
137 Ga0075431_100016958 3300006847 Bacteria 7396
138 Ga0075431_100018556 3300006847 Bacteria 7086
139 Ga0075431_100033017 3300006847 Bacteria 5334
140 Ga0075431_100044925 3300006847 Bacteria 4555
141 Ga0075433_10010464 3300006852 Bacteria 7447
142 Ga0075433_10172293 3300006852 Bacteria 1926
143 Ga0075434_100032540 3300006871 Bacteria 5142
144 Ga0075434_100075764 3300006871 Unclassified 3358
145 Ga0075434_100128723 3300006871 Bacteria 2549
146 Ga0075434_100130870 3300006871 Bacteria 2528
147 Ga0075429_100012996 3300006880 Bacteria 7223
148 Ga0075429_100013023 3300006880 Bacteria 7216
149 Ga0075429_100116732 3300006880 Unclassified 2333
150 Ga0068865_100029805 3300006881 Bacteria 3624
151 Ga0068865_100100299 3300006881 Bacteria 2118
152 Ga0068865_100503739 3300006881 Unclassified 1010
153 Ga0075436_100000760 3300006914 Bacteria 21322
154 Ga0075436_100052147 3300006914 Bacteria 2823
155 Ga0097620_100127526 3300006931 Bacteria 2614
156 Ga0097620_100258881 3300006931 Bacteria 1831
157 Ga0097620_101054573 3300006931 Unclassified 893
158 Ga0075435_100000006 3300007076 Bacteria 119843
159 Ga0075435_100000212 3300007076 Bacteria 35550
160 Ga0075435_100000332 3300007076 Bacteria 29094
161 Ga0075435_100021421 3300007076 Bacteria 4972
162 Ga0075435_100151721 3300007076 Bacteria 1948
163 Ga0075435_100460120 3300007076 Bacteria 1097
164 Ga0105240_10091445 3300009093 Bacteria 3717
165 Ga0111539_10001097 3300009094 Bacteria 35758
166 Ga0111539_10003624 3300009094 Bacteria 20343
167 Ga0111539_10007362 3300009094 Bacteria 14101
168 Ga0111539_10021564 3300009094 Bacteria 7926
169 Ga0111539_10036004 3300009094 Bacteria 5989
170 Ga0111539_10041195 3300009094 Bacteria 5554
171 Ga0111539_10103486 3300009094 Bacteria 3341
172 Ga0111539_10209111 3300009094 Bacteria 2274
173 Ga0111539_10442705 3300009094 Bacteria 1513
174 Ga0111539_10742874 3300009094 Unclassified 1142
175 Ga0105245_10010830 3300009098 Bacteria 7934
176 Ga0105245_10083614 3300009098 Bacteria 2922
177 Ga0105245_10129268 3300009098 Unclassified 2368
178 Ga0105245_10261928 3300009098 Unclassified 1683
179 Ga0105245_10817056 3300009098 Bacteria 971
180 Ga0105247_10001965 3300009101 Bacteria 14280
181 Ga0105247_10183294 3300009101 Bacteria 1398
182 Ga0105247_10355015 3300009101 Bacteria 1032
183 Ga0114129_10001514 3300009147 Bacteria 31437
184 Ga0114129_10005538 3300009147 Bacteria 17860
185 Ga0114129_10009404 3300009147 Bacteria 13931
186 Ga0114129_10011198 3300009147 Bacteria 12785
187 Ga0114129_10012483 3300009147 Bacteria 12096
188 Ga0114129_10033886 3300009147 Bacteria 7213
189 Ga0114129_10062167 3300009147 Bacteria 5217
190 Ga0114129_10229328 3300009147 Bacteria 2502
191 Ga0114129_10231112 3300009147 Bacteria 2491
192 Ga0114129_10259041 3300009147 Bacteria 2332
193 Ga0114129_10345636 3300009147 Bacteria 1972
194 Ga0114129_10540499 3300009147 Bacteria 1517
195 Ga0114129_10693157 3300009147 Bacteria 1310
196 Ga0114129_11465237 3300009147 Unclassified 840
197 Ga0105243_10101637 3300009148 Bacteria 2387
198 Ga0105243_10677047 3300009148 Unclassified 1003
199 Ga0105243_11027893 3300009148 Bacteria 828
200 Ga0105243_11074649 3300009148 Bacteria 811
201 Ga0105241_10455340 3300009174 Bacteria 1133
202 Ga0105242_10027616 3300009176 Bacteria 4509
203 Ga0105242_10038969 3300009176 Bacteria 3824
204 Ga0105242_10040563 3300009176 Bacteria 3751
205 Ga0105242_10062114 3300009176 Bacteria 3074
206 Ga0105242_10213171 3300009176 Bacteria 1722
207 Ga0105248_10005035 3300009177 Bacteria 14596
208 Ga0105248_10023742 3300009177 Bacteria 6814
209 Ga0105248_10028744 3300009177 Bacteria 6196
210 Ga0105248_10036705 3300009177 Bacteria 5481
211 Ga0105248_10055938 3300009177 Bacteria 4426
212 Ga0105238_10428603 3300009551 Bacteria 1318
213 Ga0105249_10015380 3300009553 Bacteria 6771
214 Ga0105249_10036742 3300009553 Bacteria 4444
215 Ga0105249_10258087 3300009553 Bacteria 1731
216 Ga0105249_10511251 3300009553 Unclassified 1247
217 Ga0105249_10534763 3300009553 Bacteria 1221
218 Ga0105249_10576991 3300009553 Bacteria 1177
219 Ga0105249_10690114 3300009553 Bacteria 1080
220 Ga0157378_10233500 3300013297 Unclassified 1754
221 Ga0157378_10418881 3300013297 Bacteria 1323
222 Ga0157378_10776571 3300013297 Unclassified 982
223 Ga0163162_10039363 3300013306 Bacteria 4724
224 Ga0157375_10127750 3300013308 Unclassified 2659
225 Ga0163163_10006232 3300014325 Bacteria 10405
226 Ga0163163_10007410 3300014325 Bacteria 9688
227 Ga0163163_10151297 3300014325 Unclassified 2364
228 Ga0157380_10003599 3300014326 Bacteria 10655
229 Ga0157380_10107368 3300014326 Bacteria 2338
230 Ga0157380_10198712 3300014326 Bacteria 1777
231 Ga0157380_10375560 3300014326 Bacteria 1340
232 Ga0157380_11200872 3300014326 Bacteria 802
233 Ga0157379_10061376 3300014968 Bacteria 3361
234 Ga0157379_10178800 3300014968 Unclassified 1917
235 Ga0157379_10473761 3300014968 Unclassified 1158
236 Ga0157376_10013566 3300014969 Bacteria 6086
237 Ga0157376_10341633 3300014969 Bacteria 1430
238 Ga0157376_10390198 3300014969 Unclassified 1343
239 Ga0157376_10727361 3300014969 Unclassified 1000
240 Ga0207697_10071819 3300025315 Bacteria 1451
241 Ga0207682_10019796 3300025893 Bacteria 2637
242 Ga0207642_10005401 3300025899 Bacteria 4169
243 Ga0207710_10056112 3300025900 Bacteria 1777
244 Ga0207710_10139655 3300025900 Unclassified 1169
245 Ga0207680_10115736 3300025903 Bacteria 1746
246 Ga0207643_10062515 3300025908 Bacteria 2128
247 Ga0207643_10257359 3300025908 Bacteria 1077
248 Ga0207654_10023678 3300025911 Bacteria 3292
249 Ga0207707_10141513 3300025912 Unclassified 2103
250 Ga0207660_10117609 3300025917 Bacteria 2009
251 Ga0207660_10324472 3300025917 Bacteria 1230
252 Ga0207662_10086381 3300025918 Bacteria 1922
253 Ga0207657_10032065 3300025919 Bacteria 4751
254 Ga0207652_10299656 3300025921 Unclassified 1451
255 Ga0207646_10260600 3300025922 Unclassified 1567
256 Ga0207681_10108481 3300025923 Bacteria 2015
257 Ga0207681_10467939 3300025923 Unclassified 1028
258 Ga0207681_10563297 3300025923 Bacteria 939
259 Ga0207650_10003316 3300025925 Bacteria 11086
260 Ga0207650_10150313 3300025925 Bacteria 1837
261 Ga0207650_10203718 3300025925 Bacteria 1586
262 Ga0207659_10000275 3300025926 Bacteria 31310
263 Ga0207659_10119942 3300025926 Bacteria 2014
264 Ga0207659_10288654 3300025926 Bacteria 1343
265 Ga0207644_10028418 3300025931 Bacteria 3871
266 Ga0207644_10623154 3300025931 Unclassified 897
267 Ga0207690_10126242 3300025932 Unclassified 1866
268 Ga0207706_10263173 3300025933 Bacteria 1505
269 Ga0207706_10762184 3300025933 Unclassified 824
270 Ga0207686_10047035 3300025934 Bacteria 2665
271 Ga0207686_10054599 3300025934 Bacteria 2503
272 Ga0207686_10137349 3300025934 Bacteria 1685
273 Ga0207686_10297063 3300025934 Unclassified 1198
274 Ga0207686_10302886 3300025934 Unclassified 1188
275 Ga0207709_10012070 3300025935 Bacteria 4764
276 Ga0207709_10017969 3300025935 Bacteria 3955
277 Ga0207669_10213706 3300025937 Unclassified 1410
278 Ga0207669_10439185 3300025937 Bacteria 1031
279 Ga0207669_10472848 3300025937 Bacteria 997
280 Ga0207669_10539456 3300025937 Bacteria 939
281 Ga0207704_10033326 3300025938 Bacteria 2927
282 Ga0207704_10274844 3300025938 Bacteria 1277
283 Ga0207691_10001772 3300025940 Bacteria 21258
284 Ga0207711_10061637 3300025941 Bacteria 3234
285 Ga0207711_10149087 3300025941 Bacteria 2110
286 Ga0207711_10162690 3300025941 Unclassified 2021
287 Ga0207711_10170029 3300025941 Unclassified 1977
288 Ga0207711_10243391 3300025941 Unclassified 1650
289 Ga0207711_10582203 3300025941 Bacteria 1044
290 Ga0207689_10152078 3300025942 Unclassified 1908
291 Ga0207689_10169175 3300025942 Unclassified 1801
292 Ga0207661_10029978 3300025944 Bacteria 4184
293 Ga0207679_10019675 3300025945 Bacteria 4541
294 Ga0207679_10173427 3300025945 Unclassified 1778
295 Ga0207679_10278878 3300025945 Bacteria 1432
296 Ga0207679_10344301 3300025945 Unclassified 1297
297 Ga0207679_10627104 3300025945 Unclassified 971
298 Ga0207667_10190667 3300025949 Bacteria 2103
299 Ga0207651_10032374 3300025960 Bacteria 3358
300 Ga0207651_10217152 3300025960 Bacteria 1543
301 Ga0207651_10234022 3300025960 Unclassified 1493
302 Ga0207651_10263610 3300025960 Bacteria 1416
303 Ga0207712_10033413 3300025961 Bacteria 3478
304 Ga0207712_10057246 3300025961 Bacteria 2750
305 Ga0207712_10084596 3300025961 Bacteria 2318
306 Ga0207668_10009682 3300025972 Bacteria 5787
307 Ga0207640_10023950 3300025981 Unclassified 3676
308 Ga0207658_10071157 3300025986 Bacteria 2633
309 Ga0207658_10376210 3300025986 Bacteria 1243
310 Ga0207677_10013217 3300026023 Bacteria 4776
311 Ga0207677_10276639 3300026023 Bacteria 1376
312 Ga0207677_10685111 3300026023 Bacteria 908
313 Ga0207703_10042606 3300026035 Bacteria 3641
314 Ga0207703_10092294 3300026035 Unclassified 2548
315 Ga0207703_10096290 3300026035 Bacteria 2498
316 Ga0207703_10241951 3300026035 Unclassified 1623
317 Ga0207703_10518270 3300026035 Bacteria 1121
318 Ga0207708_10003677 3300026075 Bacteria 11327
319 Ga0207708_10029803 3300026075 Bacteria 4137
320 Ga0207708_10105165 3300026075 Unclassified 2188
321 Ga0207708_10145753 3300026075 Bacteria 1861
322 Ga0207708_10374122 3300026075 Bacteria 1173
323 Ga0207641_10002163 3300026088 Bacteria 18509
324 Ga0207641_10100278 3300026088 Unclassified 2550
325 Ga0207641_10131981 3300026088 Bacteria 2244
326 Ga0207641_10288705 3300026088 Bacteria 1546
327 Ga0207641_10376389 3300026088 Bacteria 1359
328 Ga0207648_10158226 3300026089 Bacteria 2000
329 Ga0207648_10382497 3300026089 Bacteria 1273
330 Ga0207648_10564222 3300026089 Bacteria 1047
331 Ga0207676_10011296 3300026095 Bacteria 6382
332 Ga0207676_10027391 3300026095 Bacteria 4244
333 Ga0207676_10040620 3300026095 Bacteria 3566
334 Ga0207674_10064422 3300026116 Bacteria 3697
335 Ga0207674_10091456 3300026116 Bacteria 3032
336 Ga0207675_100002942 3300026118 Bacteria 16751
337 Ga0207675_100019231 3300026118 Bacteria 6373
338 Ga0207675_100047053 3300026118 Bacteria 4029
339 Ga0207675_100051394 3300026118 Bacteria 3845
340 Ga0207675_100179135 3300026118 Unclassified 2029
341 Ga0207683_10016708 3300026121 Bacteria 6245
342 Ga0207683_10388015 3300026121 Bacteria 1284
343 Ga0207698_10105105 3300026142 Bacteria 2352
344 Ga0207428_10080312 3300027907 Bacteria 2548
345 Ga0207428_10084904 3300027907 Bacteria 2466
346 Ga0207428_10105728 3300027907 Bacteria 2170
347 Ga0207428_10134836 3300027907 Bacteria 1888
348 Ga0207428_10143387 3300027907 Bacteria 1822
349 Ga0207428_10235614 3300027907 Bacteria 1369
350 Ga0268266_10044946 3300028379 Bacteria 3776
351 Ga0268265_10080702 3300028380 Bacteria 2566
352 Ga0268264_10008590 3300028381 Bacteria 8486
353 Ga0268264_10124424 3300028381 Unclassified 2277
354 Ga0268264_10682979 3300028381 Bacteria 1018
355 Ga0307408_100013563 3300031548 Bacteria 5410
356 Ga0307408_100397581 3300031548 Bacteria 1182
357 Ga0307407_10518776 3300031903 Unclassified 876
358 Ga0307412_10105860 3300031911 Bacteria 1999
359 Ga0307416_100007379 3300032002 Bacteria 6985
360 Ga0307416_100019071 3300032002 Bacteria 4853
361 Ga0307414_10739611 3300032004 Bacteria 893
362 Ga0307411_10205721 3300032005 Bacteria 1515
363 Ga0307411_10652393 3300032005 Bacteria 911
364 Ga0307415_100146327 3300032126 Bacteria 1812
365 Ga0307415_100230221 3300032126 Bacteria 1492
366 Ga0373948_0008729 3300034817 Bacteria 1733
367 Ga0373950_0007340 3300034818 Bacteria 1708
368 Ga0373958_0000858 3300034819 Bacteria 3908
369 Ga0373959_0003152 3300034820 Bacteria 2626
370 Ga0373928_0006653 3300035084 Bacteria 2223
371 Ga0373929_0000166 3300035085 Bacteria 11576
372 Ga0373929_0001785 3300035085 Bacteria 4038
373 Ga0373940_0013588 3300035088 Bacteria 1973
374 Ga0373949_0002785 3300035090 Bacteria 4358
375 Ga0373951_0000216 3300035091 Bacteria 20354
376 Ga0373951_0001616 3300035091 Bacteria 5918
377 Ga0373952_0000430 3300035092 Bacteria 7266
378 Ga0373952_0001761 3300035092 Bacteria 3937
379 Ga0373932_0000788 3300035112 Bacteria 9373
380 Ga0373939_0000154 3300035114 Bacteria 19358
381 Ga0373939_0000656 3300035114 Bacteria 8597
382 Ga0373941_0003269 3300035115 Bacteria 3657
383 Ga0373960_0000396 3300035121 Bacteria 8515
384 Ga0373960_0002201 3300035121 Bacteria 4383
385 Ga0373942_0001548 3300035207 Bacteria 5893
386 Ga0373942_0015332 3300035207 Bacteria 1866
387 Ga0373961_0000589 3300035241 Bacteria 13562
388 Ga0373961_0003704 3300035241 Bacteria 3740
389 Ga0373962_0003238 3300035242 Bacteria 3913
390 Ga0373931_0003180 3300035691 Bacteria 7326
391 Ga0373931_0035545 3300035691 Bacteria 2591
392 Ga0373931_0120343 3300035691 Unclassified 1500
393 Ga0373935_0111817 3300035692 Unclassified 1814
394 Ga0439433_0031110 3300041999 Unclassified 1221
395 Ga0439435_0002480 3300042436 Bacteria 3677
396 Ga0439464_0067563 3300042439 Unclassified 1054
397 Ga0439464_0103134 3300042439 Bacteria 868
398 Ga0439460_0019391 3300042461 Bacteria 1842
399 Ga0451577_0004431 3300042876 Bacteria 14821
400 Ga0453684_0091657 3300044712 Bacteria 3751
401 Ga0451576_0004049 3300045051 Bacteria 19434
402 Ga0451576_0134015 3300045051 Bacteria 2583
403 Ga0495603_0261501 3300046455 Unclassified 996
404 Ga0495635_0340577 3300046663 Bacteria 1001
405 Ga0496102_0278766 3300048905 Bacteria 1576
406 Ga0496104_0014049 3300048907 Bacteria 7228
407 Ga0496104_0091416 3300048907 Unclassified 2909
408 Ga0496105_0043739 3300048908 Unclassified 3694
409 Ga0496106_0598586 3300048909 Unclassified 883
410 Ga0496107_0207664 3300048910 Bacteria 1456
411 Ga0496108_0005317 3300048911 Bacteria 10398
412 Ga0496108_0014200 3300048911 Bacteria 6498
413 Ga0496109_0006976 3300048912 Bacteria 9535
414 Ga0496109_0059124 3300048912 Unclassified 3502
415 Ga0496110_0001996 3300048913 Bacteria 15180
416 Ga0496110_0171073 3300048913 Unclassified 1971
417 Ga0496111_0190395 3300048914 Unclassified 1525
418 Ga0496112_0000819 3300048915 Bacteria 22032
419 Ga0496112_0007127 3300048915 Bacteria 9892
420 Ga0496112_0017919 3300048915 Bacteria 6663
421 Ga0496113_0038924 3300048916 Unclassified 3498
422 Ga0496113_0564481 3300048916 Bacteria 912
423 Ga0496114_0058392 3300048917 Bacteria 3222
424 Ga0496114_0274521 3300048917 Bacteria 1486
425 Ga0496114_0453861 3300048917 Bacteria 1135
426 Ga0501295_031804 3300049518 Bacteria 1045
427 Ga0501036_0207123 3300049572 Bacteria 1649
428 Ga0501036_0295041 3300049572 Bacteria 1356
429 Ga0501036_0437230 3300049572 Bacteria 1090
430 Ga0501039_0209734 3300049575 Bacteria 1532
431 Ga0501039_0217907 3300049575 Unclassified 1501
432 Ga0501040_0104319 3300049576 Bacteria 1980
433 Ga0501040_0338098 3300049576 Unclassified 1078
434 Ga0501042_0475018 3300049578 Unclassified 907
435 Ga0501043_0305743 3300049579 Bacteria 1214
436 Ga0501048_0083129 3300049582 Bacteria 2258
437 Ga0501072_0089148 3300049588 Unclassified 2448
438 Ga0501072_0228116 3300049588 Unclassified 1484
439 Ga0501072_0605168 3300049588 Bacteria 864
440 Ga0501072_0703609 3300049588 Unclassified 794
441 Ga0501074_0256824 3300049590 Bacteria 1243
442 Ga0501074_0370519 3300049590 Unclassified 1016
443 Ga0501075_0088114 3300049591 Bacteria 2353
444 Ga0501076_0046206 3300049592 Bacteria 3440
445 Ga0501198_019109 3300049649 Bacteria 1077
446 Ga0501206_009203 3300049653 Bacteria 1311
447 Ga0501216_017081 3300049660 Bacteria 1238
448 Ga0501079_0202576 3300049741 Unclassified 1550
449 Ga0501035_0287676 3300049822 Bacteria 1388
450 Ga0501045_0046543 3300049824 Bacteria 3159
451 Ga0501045_0090656 3300049824 Bacteria 2259
452 nmdc:mga00v17_11458_c1 3300050491 Bacteria 4873
453 nmdc:mga0k408_13344_c1 3300050493 Bacteria 4504
454 nmdc:mga0k408_18177_c1 3300050493 Bacteria 3922
455 nmdc:mga06z11_87764_c1 3300050494 Bacteria 1683
456 nmdc:mga05p37_12839_c1 3300050507 Bacteria 10016
457 nmdc:mga05p37_13711_c1 3300050507 Bacteria 9714
458 nmdc:mga05p37_172841_c1 3300050507 Bacteria 2634
459 nmdc:mga05p37_180016_c1 3300050507 Bacteria 2572
460 nmdc:mga05p37_18974_c1 3300050507 Bacteria 8316
461 nmdc:mga05p37_262552_c1 3300050507 Bacteria 2066
462 nmdc:mga05p37_26576_c1 3300050507 Bacteria 7038
463 nmdc:mga05p37_31313_c1 3300050507 Bacteria 6497
464 nmdc:mga05p37_327456_c1 3300050507 Bacteria 1811
465 nmdc:mga05p37_332125_c1 3300050507 Bacteria 1795
466 nmdc:mga05p37_34874_c1 3300050507 Bacteria 6165
467 nmdc:mga05p37_419601_c1 3300050507 Bacteria 1557
468 nmdc:mga05p37_62765_c1 3300050507 Bacteria 4573
469 nmdc:mga05p37_63109_c1 3300050507 Bacteria 4559
470 nmdc:mga05p37_97982_c1 3300050507 Unclassified 3612
471 nmdc:mga09592_18962_c1 3300050508 Bacteria 5645
472 nmdc:mga09592_33385_c1 3300050508 Bacteria 4295
473 nmdc:mga09592_463307_c1 3300050508 Bacteria 1093
474 nmdc:mga09592_82800_c1 3300050508 Unclassified 2734
475 nmdc:mga0qj67_168417_c1 3300050509 Bacteria 1779
476 nmdc:mga0qj67_219920_c1 3300050509 Bacteria 1542
477 nmdc:mga0qj67_405342_c1 3300050509 Unclassified 1100
478 nmdc:mga0qj67_69975_c1 3300050509 Bacteria 2799
479 nmdc:mga06r32_13030_c1 3300050510 Bacteria 7523
480 nmdc:mga06r32_1978_c1 3300050510 Bacteria 18299
481 nmdc:mga08y16_10534_c1 3300050511 Bacteria 9704
482 nmdc:mga08y16_11907_c1 3300050511 Bacteria 9136
483 nmdc:mga08y16_160161_c1 3300050511 Unclassified 2338
484 nmdc:mga08y16_177652_c1 3300050511 Bacteria 2211
485 nmdc:mga08y16_200921_c1 3300050511 Bacteria 2066
486 nmdc:mga08y16_3320_c1 3300050511 Bacteria 16654
487 nmdc:mga08y16_45443_c1 3300050511 Bacteria 4602
488 nmdc:mga08y16_476_c1 3300050511 Bacteria 37001
489 nmdc:mga08y16_71089_c1 3300050511 Bacteria 3627
490 nmdc:mga0n895_120045_c1 3300050512 Bacteria 2650
491 nmdc:mga0n895_14941_c1 3300050512 Bacteria 7073
492 nmdc:mga0n895_35188_c1 3300050512 Unclassified 4826
493 nmdc:mga0n895_383001_c1 3300050512 Bacteria 1423
494 nmdc:mga0rr50_15_c1 3300050513 Bacteria 189079
495 nmdc:mga0rr50_169186_c1 3300050513 Bacteria 1779
496 nmdc:mga0rr50_19201_c1 3300050513 Bacteria 4607
497 nmdc:mga0rr50_2076_c1 3300050513 Bacteria 11185
498 nmdc:mga0rr50_228_c1 3300050513 Bacteria 30390
499 nmdc:mga0rr50_442733_c1 3300050513 Bacteria 1101
500 nmdc:mga08x19_65231_c1 3300050514 Bacteria 2364
501 nmdc:mga08x19_699_c1 3300050514 Bacteria 21454
502 nmdc:mga0a205_27435_c1 3300050515 Bacteria 3896
503 nmdc:mga0a205_8357_c1 3300050515 Bacteria 9415
504 Ga0501084_0084515 3300054114 Bacteria 2664
505 Ga0590071_006149 3300059421 Bacteria 2864
506 nmdc:mga0n895_504940_c1
507 Ga0065704_10229153
508 Ga0065712_10001042
509 Ga0065712_10002470
510 Ga0065715_10092197
511 Ga0065715_10114244
512 Ga0065715_10249250
513 Ga0065707_10089350
514 Ga0065707_10181475
515 Ga0070683_100013736
516 Ga0070690_100348033
517 Ga0070670_100001347
518 Ga0070670_100001816
519 Ga0070670_100340558
520 Ga0070670_100396068
521 Ga0070677_10042123
522 Ga0070677_10102142
523 Ga0068869_100380431
524 Ga0070666_10045102
525 Ga0070666_10052767
526 Ga0070680_100097566
527 Ga0070680_100100258
528 Ga0070680_100141015
529 Ga0070680_100300973
530 Ga0068868_100044387
531 Ga0070689_100106797
532 Ga0070687_100097790
533 Ga0070661_100012492
534 Ga0070668_100229443
535 Ga0070669_100017576
536 Ga0070669_100369692
537 Ga0070675_100000160
538 Ga0070675_100023007
539 Ga0070675_100035874
540 Ga0070675_100113116
541 Ga0070675_100187742
542 Ga0070671_100016984
543 Ga0070674_100293396
544 Ga0070674_100645806
545 Ga0070673_100021741
546 Ga0070673_100169480
547 Ga0070673_100514624
548 Ga0070688_100046578
549 Ga0070688_100274933
550 Ga0070659_100112952
551 Ga0070667_100007809
552 Ga0070667_100244178
553 Ga0070705_100316961
554 Ga0070700_100019179
555 Ga0070700_100022454
556 Ga0070694_100111179
557 Ga0070694_100242222
558 Ga0070663_100037947
559 Ga0070678_100007393
560 Ga0070678_100036143
561 Ga0070662_100350238
562 Ga0068867_100102722
563 Ga0068867_100264495
564 Ga0070685_10458889
565 Ga0070707_100084604
566 Ga0070707_100194645
567 Ga0070698_100033204
568 Ga0070698_100150865
569 Ga0070698_100418124
570 Ga0070699_100001797
571 Ga0070699_100130434
572 Ga0070679_100423686
573 Ga0070684_100002478
574 Ga0070697_100203452
575 Ga0070672_100006710
576 Ga0070672_100118288
577 Ga0070686_100000142
578 Ga0070686_100073869
579 Ga0070695_100120844
580 Ga0070695_100138677
581 Ga0070695_100343103
582 Ga0070696_100017328
583 Ga0070696_100484930
584 Ga0070696_100532390
585 Ga0070693_100031914
586 Ga0070665_100010635
587 Ga0070665_100025534
588 Ga0070665_100531395
589 Ga0070704_100133930
590 Ga0070704_100214384
591 Ga0070704_100223824
592 Ga0068855_100219973
593 Ga0070664_100000363
594 Ga0070664_100236443
595 Ga0068857_100009388
596 Ga0068857_100078404
597 Ga0068854_100028265
598 Ga0068854_100039689
599 Ga0070702_100417097
600 Ga0068852_100957507
601 Ga0068859_100127526
602 Ga0068859_101054545
603 Ga0068864_100013610
604 Ga0068864_100046147
605 Ga0068866_10010769
606 Ga0068866_10044423
607 Ga0068861_100026299
608 Ga0068861_100056107
609 Ga0068870_10053276
610 Ga0068870_10149809
611 Ga0068863_100000704
612 Ga0068863_100075431
613 Ga0068863_100143284
614 Ga0068863_100435655
615 Ga0068858_100019828
616 Ga0068858_100077931
617 Ga0068858_100217942
618 Ga0068858_100269230
619 Ga0068860_100011626
620 Ga0068860_100241908
621 Ga0068862_100032117
622 Ga0081455_10057216
623 Ga0075365_10011503
624 Ga0075368_10039373
625 Ga0075368_10141420
626 Ga0075364_10003789
627 Ga0075367_10191896
628 Ga0075366_10013893
629 Ga0075366_10014212
630 Ga0097621_100019222
631 Ga0097621_100050537
632 Ga0068871_100014256
633 Ga0068871_100030481
634 Ga0068871_100218407
635 Ga0068871_100421210
636 Ga0068871_100615230
637 Ga0075428_100005108
638 Ga0075428_100005585
639 Ga0075428_100024844
640 Ga0075428_100040597
641 Ga0075428_100203378
642 Ga0075431_100016958
643 Ga0075431_100018556
644 Ga0075431_100033017
645 Ga0075431_100044925
646 Ga0075433_10010464
647 Ga0075433_10172293
648 Ga0075434_100032540
649 Ga0075434_100075764
650 Ga0075434_100128723
651 Ga0075434_100130870
652 Ga0075429_100012996
653 Ga0075429_100013023
654 Ga0075429_100116732
655 Ga0068865_100029805
656 Ga0068865_100100299
657 Ga0068865_100503739
658 Ga0075436_100000760
659 Ga0075436_100052147
660 Ga0097620_100127526
661 Ga0097620_100258881
662 Ga0097620_101054573
663 Ga0075435_100000006
664 Ga0075435_100000212
665 Ga0075435_100000332
666 Ga0075435_100021421
667 Ga0075435_100151721
668 Ga0075435_100460120
669 Ga0105240_10091445
670 Ga0111539_10001097
671 Ga0111539_10003624
672 Ga0111539_10007362
673 Ga0111539_10021564
674 Ga0111539_10036004
675 Ga0111539_10041195
676 Ga0111539_10103486
677 Ga0111539_10209111
678 Ga0111539_10442705
679 Ga0111539_10742874
680 Ga0105245_10010830
681 Ga0105245_10083614
682 Ga0105245_10129268
683 Ga0105245_10261928
684 Ga0105245_10817056
685 Ga0105247_10001965
686 Ga0105247_10183294
687 Ga0105247_10355015
688 Ga0114129_10001514
689 Ga0114129_10005538
690 Ga0114129_10009404
691 Ga0114129_10011198
692 Ga0114129_10012483
693 Ga0114129_10033886
694 Ga0114129_10062167
695 Ga0114129_10229328
696 Ga0114129_10231112
697 Ga0114129_10259041
698 Ga0114129_10345636
699 Ga0114129_10540499
700 Ga0114129_10693157
701 Ga0114129_11465237
702 Ga0105243_10101637
703 Ga0105243_10677047
704 Ga0105243_11027893
705 Ga0105243_11074649
706 Ga0105241_10455340
707 Ga0105242_10027616
708 Ga0105242_10038969
709 Ga0105242_10040563
710 Ga0105242_10062114
711 Ga0105242_10213171
712 Ga0105248_10005035
713 Ga0105248_10023742
714 Ga0105248_10028744
715 Ga0105248_10036705
716 Ga0105248_10055938
717 Ga0105238_10428603
718 Ga0105249_10015380
719 Ga0105249_10036742
720 Ga0105249_10258087
721 Ga0105249_10511251
722 Ga0105249_10534763
723 Ga0105249_10576991
724 Ga0105249_10690114
725 Ga0157378_10233500
726 Ga0157378_10418881
727 Ga0157378_10776571
728 Ga0163162_10039363
729 Ga0157375_10127750
730 Ga0163163_10006232
731 Ga0163163_10007410
732 Ga0163163_10151297
733 Ga0157380_10003599
734 Ga0157380_10107368
735 Ga0157380_10198712
736 Ga0157380_10375560
737 Ga0157380_11200872
738 Ga0157379_10061376
739 Ga0157379_10178800
740 Ga0157379_10473761
741 Ga0157376_10013566
742 Ga0157376_10341633
743 Ga0157376_10390198
744 Ga0157376_10727361
745 Ga0207697_10071819
746 Ga0207682_10019796
747 Ga0207642_10005401
748 Ga0207710_10056112
749 Ga0207710_10139655
750 Ga0207680_10115736
751 Ga0207643_10062515
752 Ga0207643_10257359
753 Ga0207654_10023678
754 Ga0207707_10141513
755 Ga0207660_10117609
756 Ga0207660_10324472
757 Ga0207662_10086381
758 Ga0207657_10032065
759 Ga0207652_10299656
760 Ga0207646_10260600
761 Ga0207681_10108481
762 Ga0207681_10467939
763 Ga0207681_10563297
764 Ga0207650_10003316
765 Ga0207650_10150313
766 Ga0207650_10203718
767 Ga0207659_10000275
768 Ga0207659_10119942
769 Ga0207659_10288654
770 Ga0207644_10028418
771 Ga0207644_10623154
772 Ga0207690_10126242
773 Ga0207706_10263173
774 Ga0207706_10762184
775 Ga0207686_10047035
776 Ga0207686_10054599
777 Ga0207686_10137349
778 Ga0207686_10297063
779 Ga0207686_10302886
780 Ga0207709_10012070
781 Ga0207709_10017969
782 Ga0207669_10213706
783 Ga0207669_10439185
784 Ga0207669_10472848
785 Ga0207669_10539456
786 Ga0207704_10033326
787 Ga0207704_10274844
788 Ga0207691_10001772
789 Ga0207711_10061637
790 Ga0207711_10149087
791 Ga0207711_10162690
792 Ga0207711_10170029
793 Ga0207711_10243391
794 Ga0207711_10582203
795 Ga0207689_10152078
796 Ga0207689_10169175
797 Ga0207661_10029978
798 Ga0207679_10019675
799 Ga0207679_10173427
800 Ga0207679_10278878
801 Ga0207679_10344301
802 Ga0207679_10627104
803 Ga0207667_10190667
804 Ga0207651_10032374
805 Ga0207651_10217152
806 Ga0207651_10234022
807 Ga0207651_10263610
808 Ga0207712_10033413
809 Ga0207712_10057246
810 Ga0207712_10084596
811 Ga0207668_10009682
812 Ga0207640_10023950
813 Ga0207658_10071157
814 Ga0207658_10376210
815 Ga0207677_10013217
816 Ga0207677_10276639
817 Ga0207677_10685111
818 Ga0207703_10042606
819 Ga0207703_10092294
820 Ga0207703_10096290
821 Ga0207703_10241951
822 Ga0207703_10518270
823 Ga0207708_10003677
824 Ga0207708_10029803
825 Ga0207708_10105165
826 Ga0207708_10145753
827 Ga0207708_10374122
828 Ga0207641_10002163
829 Ga0207641_10100278
830 Ga0207641_10131981
831 Ga0207641_10288705
832 Ga0207641_10376389
833 Ga0207648_10158226
834 Ga0207648_10382497
835 Ga0207648_10564222
836 Ga0207676_10011296
837 Ga0207676_10027391
838 Ga0207676_10040620
839 Ga0207674_10064422
840 Ga0207674_10091456
841 Ga0207675_100002942
842 Ga0207675_100019231
843 Ga0207675_100047053
844 Ga0207675_100051394
845 Ga0207675_100179135
846 Ga0207683_10016708
847 Ga0207683_10388015
848 Ga0207698_10105105
849 Ga0207428_10080312
850 Ga0207428_10084904
851 Ga0207428_10105728
852 Ga0207428_10134836
853 Ga0207428_10143387
854 Ga0207428_10235614
855 Ga0268266_10044946
856 Ga0268265_10080702
857 Ga0268264_10008590
858 Ga0268264_10124424
859 Ga0268264_10682979
860 Ga0307408_100013563
861 Ga0307408_100397581
862 Ga0307407_10518776
863 Ga0307412_10105860
864 Ga0307416_100007379
865 Ga0307416_100019071
866 Ga0307414_10739611
867 Ga0307411_10205721
868 Ga0307411_10652393
869 Ga0307415_100146327
870 Ga0307415_100230221
871 Ga0373948_0008729
872 Ga0373950_0007340
873 Ga0373958_0000858
874 Ga0373959_0003152
875 Ga0373928_0006653
876 Ga0373929_0000166
877 Ga0373929_0001785
878 Ga0373940_0013588
879 Ga0373949_0002785
880 Ga0373951_0000216
881 Ga0373951_0001616
882 Ga0373952_0000430
883 Ga0373952_0001761
884 Ga0373932_0000788
885 Ga0373939_0000154
886 Ga0373939_0000656
887 Ga0373941_0003269
888 Ga0373960_0000396
889 Ga0373960_0002201
890 Ga0373942_0001548
891 Ga0373942_0015332
892 Ga0373961_0000589
893 Ga0373961_0003704
894 Ga0373962_0003238
895 Ga0373931_0003180
896 Ga0373931_0035545
897 Ga0373931_0120343
898 Ga0373935_0111817
899 Ga0439433_0031110
900 Ga0439435_0002480
901 Ga0439464_0067563
902 Ga0439464_0103134
903 Ga0439460_0019391
904 Ga0451577_0004431
905 Ga0453684_0091657
906 Ga0451576_0004049
907 Ga0451576_0134015
908 Ga0495603_0261501
909 Ga0495635_0340577
910 Ga0496102_0278766
911 Ga0496104_0014049
912 Ga0496104_0091416
913 Ga0496105_0043739
914 Ga0496106_0598586
915 Ga0496107_0207664
916 Ga0496108_0005317
917 Ga0496108_0014200
918 Ga0496109_0006976
919 Ga0496109_0059124
920 Ga0496110_0001996
921 Ga0496110_0171073
922 Ga0496111_0190395
923 Ga0496112_0000819
924 Ga0496112_0007127
925 Ga0496112_0017919
926 Ga0496113_0038924
927 Ga0496113_0564481
928 Ga0496114_0058392
929 Ga0496114_0274521
930 Ga0496114_0453861
931 Ga0501295_031804
932 Ga0501036_0207123
933 Ga0501036_0295041
934 Ga0501036_0437230
935 Ga0501039_0209734
936 Ga0501039_0217907
937 Ga0501040_0104319
938 Ga0501040_0338098
939 Ga0501042_0475018
940 Ga0501043_0305743
941 Ga0501048_0083129
942 Ga0501072_0089148
943 Ga0501072_0228116
944 Ga0501072_0605168
945 Ga0501072_0703609
946 Ga0501074_0256824
947 Ga0501074_0370519
948 Ga0501075_0088114
949 Ga0501076_0046206
950 Ga0501198_019109
951 Ga0501206_009203
952 Ga0501216_017081
953 Ga0501079_0202576
954 Ga0501035_0287676
955 Ga0501045_0046543
956 Ga0501045_0090656
957 nmdc:mga00v17_11458_c1
958 nmdc:mga0k408_13344_c1
959 nmdc:mga0k408_18177_c1
960 nmdc:mga06z11_87764_c1
961 nmdc:mga05p37_12839_c1
962 nmdc:mga05p37_13711_c1
963 nmdc:mga05p37_172841_c1
964 nmdc:mga05p37_180016_c1
965 nmdc:mga05p37_18974_c1
966 nmdc:mga05p37_262552_c1
967 nmdc:mga05p37_26576_c1
968 nmdc:mga05p37_31313_c1
969 nmdc:mga05p37_327456_c1
970 nmdc:mga05p37_332125_c1
971 nmdc:mga05p37_34874_c1
972 nmdc:mga05p37_419601_c1
973 nmdc:mga05p37_62765_c1
974 nmdc:mga05p37_63109_c1
975 nmdc:mga05p37_97982_c1
976 nmdc:mga09592_18962_c1
977 nmdc:mga09592_33385_c1
978 nmdc:mga09592_463307_c1
979 nmdc:mga09592_82800_c1
980 nmdc:mga0qj67_168417_c1
981 nmdc:mga0qj67_219920_c1
982 nmdc:mga0qj67_405342_c1
983 nmdc:mga0qj67_69975_c1
984 nmdc:mga06r32_13030_c1
985 nmdc:mga06r32_1978_c1
986 nmdc:mga08y16_10534_c1
987 nmdc:mga08y16_11907_c1
988 nmdc:mga08y16_160161_c1
989 nmdc:mga08y16_177652_c1
990 nmdc:mga08y16_200921_c1
991 nmdc:mga08y16_3320_c1
992 nmdc:mga08y16_45443_c1
993 nmdc:mga08y16_476_c1
994 nmdc:mga08y16_71089_c1
995 nmdc:mga0n895_120045_c1
996 nmdc:mga0n895_14941_c1
997 nmdc:mga0n895_35188_c1
998 nmdc:mga0n895_383001_c1
999 nmdc:mga0rr50_15_c1
1000 nmdc:mga0rr50_169186_c1
1001 nmdc:mga0rr50_19201_c1
1002 nmdc:mga0rr50_2076_c1
1003 nmdc:mga0rr50_228_c1
1004 nmdc:mga0rr50_442733_c1
1005 nmdc:mga08x19_65231_c1
1006 nmdc:mga08x19_699_c1
1007 nmdc:mga0a205_27435_c1
1008 nmdc:mga0a205_8357_c1
1009 Ga0501084_0084515
1010 Ga0590071_006149

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13709

DUF4159

Domain of unknown function (DUF4159)

94

299

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.7748 44 252
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.7642 44 252
3ir7-assembly1.cif.gz_A crystal structure of narghi mutant narg-r94s 0.639 102 149
3ir6-assembly1.cif.gz_A crystal structure of narghi mutant narg-h49s 0.6353 102 149
1f0i-assembly1.cif.gz_A the first crystal structure of a phospholipase d 0.596 119 161
ID Description Score Start End Superfamily
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7354 44 252 3.40.50.12140
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7253 44 252 3.40.50.12140
1y5nA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6391 102 149 3.40.50.12440
af_Q2FVM1_41_1229_3.40.50.12440 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.635 102 149 3.40.50.12440
af_Q2FUS0_84_189_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6289 194 216 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A257VSL0-F1-model_v4 DUF4159 domain-containing protein 0.9675 98 171
AF-A0A1F2U8P8-F1-model_v4 DUF4159 domain-containing protein 0.9354 64 254
AF-A0A6L8HP09-F1-model_v4 DUF4159 domain-containing protein 0.9262 64 254
AF-A0A7V8WDT2-F1-model_v4 DUF4159 domain-containing protein 0.9246 64 254
AF-A0A6M4IU80-F1-model_v4 DUF4159 domain-containing protein 0.918 37 254

Map