F456424
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 505 | 402 | 1010 | 416 |
Family's Representative Sequence
| Representative Sequence | 3300048912|Ga0496109_0051399|Ga0496109_0051399_1267_2583 |
| Length | 438 |
| Sequence | VRGAARLLTPRGRAAMSVDVITFGCRLNTYESEVIRRQARAADLPETVVFNTCAVTAEAVRQSRQAIRRLKRERPAARIVVTGCAAQTEPGRFADMPEVALVLGNEEKLSAQAWRAHRDVLARASFGIAAEEKVAVNDIMTVTQTATHLIDGVEGHARAFVQVQNGCDHRCTFCIIPYGRGNSRSVPMGEVVAQVRTLCARGYREVVLTGVDLTSYGANLPGAPKLGTLVKQILKHVPELERLRLSSIDSVEADPALLDAFASDERLMPHLHLSLQSGDDLILKRMKRRHLRADAIAFCRQVRRLRPDVVFGGDIIAGFPTETEDMFARSLDLVEECGLTHLHVFPFSPRPGTPAARMPQLPSDIVKDRARRLRARGEAALRRHLDAQVGATRKVLTEFNAIGHTEHFTPVRLDASIKPGVILDLTFAGHNGRQLLAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 31 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 37 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 38 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 41 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 42 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 47 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 62 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 63 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 64 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 65 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 66 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 101 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 102 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 103 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 104 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 109 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 110 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 111 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 112 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 113 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 114 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 115 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 116 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 117 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 118 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 119 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 120 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 121 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 122 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 123 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 124 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 125 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 159 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 160 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 161 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 162 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 163 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 165 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 166 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 167 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 168 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 169 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 170 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 171 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 172 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 173 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 174 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 175 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 176 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 196 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 197 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 198 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 202 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 206 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 207 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 208 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 209 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 210 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 211 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 212 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 213 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 214 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 215 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 216 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 217 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 218 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 219 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 220 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 221 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 222 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 223 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 224 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 226 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 227 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 228 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 229 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 230 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 231 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 232 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 233 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 234 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 235 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 236 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 237 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 238 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 239 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 240 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 241 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 242 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 243 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 244 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 245 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 246 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 247 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 248 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 249 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 250 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 251 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 252 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 253 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 254 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 255 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 256 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 257 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 258 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 259 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 260 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 261 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 262 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 263 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 264 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 265 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 266 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 267 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 268 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 269 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 270 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 271 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 272 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 273 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 274 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 275 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 276 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 277 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 278 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 279 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 280 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 281 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 282 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 283 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 284 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 285 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 286 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 287 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 288 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 289 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 290 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 291 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 292 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 293 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 294 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 295 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 296 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 297 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 298 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 299 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 300 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 301 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 302 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 303 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 304 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 305 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 306 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 307 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 308 | 2922368715 | |||
| 309 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 310 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 311 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 312 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 313 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 314 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 315 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 316 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 317 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 318 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 319 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 320 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 321 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 322 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 323 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 324 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 325 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 326 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 327 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 328 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 329 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 330 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 331 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 332 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 333 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 334 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 335 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 336 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 337 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 338 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 339 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 340 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 341 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 342 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 343 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 344 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 345 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 346 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 347 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 348 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 349 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 350 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 351 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 352 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 353 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 354 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 355 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 356 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 357 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 358 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 359 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 360 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 361 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 362 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 363 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 364 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 365 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 366 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 367 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 368 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 369 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 370 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 371 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 372 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 373 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 374 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 375 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 376 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 377 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 378 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 379 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 380 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 381 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 382 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 383 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 384 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 385 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 386 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 387 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 388 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 389 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 390 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 391 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 392 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 393 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 394 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 395 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 396 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 397 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 398 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 399 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 400 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 401 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 402 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 64.88 |
| Metatranscriptomes | 0 |
| Isolates | 35.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.69 |
| Nodule | 28.12 |
| Rhizoplane | 6.14 |
| Rhizosphere | 42.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496109_0051399 | 3300048912 | Bacteria | 3753 |
| 2 | JGI25406J46586_10021240 | 3300003203 | Bacteria | 2609 |
| 3 | JGI25153J46596_10011827 | 3300003215 | Bacteria | 3827 |
| 4 | JGI25153J46596_10018415 | 3300003215 | Bacteria | 2714 |
| 5 | JGI25160J50197_1007581 | 3300003354 | Bacteria | 4232 |
| 6 | JGI25404J52841_10001804 | 3300003659 | Bacteria | 3886 |
| 7 | JGI25404J52841_10005251 | 3300003659 | Bacteria | 2671 |
| 8 | JGI25404J52841_10014858 | 3300003659 | Bacteria | 1690 |
| 9 | Ga0055531_10012260 | 3300003794 | Bacteria | 4049 |
| 10 | Ga0055543_1002633 | 3300004625 | Bacteria | 5784 |
| 11 | Ga0065165_1005401 | 3300005262 | Bacteria | 7210 |
| 12 | Ga0070676_10117321 | 3300005328 | Bacteria | 1666 |
| 13 | Ga0070690_100044177 | 3300005330 | Bacteria | 2827 |
| 14 | Ga0068869_100044714 | 3300005334 | Bacteria | 3185 |
| 15 | Ga0068869_100266724 | 3300005334 | Bacteria | 1372 |
| 16 | Ga0070680_100046810 | 3300005336 | Bacteria | 3519 |
| 17 | Ga0068868_100045931 | 3300005338 | Bacteria | 3418 |
| 18 | Ga0070692_10068000 | 3300005345 | Bacteria | 1892 |
| 19 | Ga0070674_100080398 | 3300005356 | Bacteria | 2327 |
| 20 | Ga0070673_100016429 | 3300005364 | Bacteria | 5234 |
| 21 | Ga0070709_10007668 | 3300005434 | Bacteria | 5921 |
| 22 | Ga0070701_10004923 | 3300005438 | Bacteria | 5467 |
| 23 | Ga0070711_100199567 | 3300005439 | Bacteria | 1543 |
| 24 | Ga0070663_100065946 | 3300005455 | Bacteria | 2622 |
| 25 | Ga0070663_100070111 | 3300005455 | Bacteria | 2548 |
| 26 | Ga0070678_100142336 | 3300005456 | Bacteria | 1921 |
| 27 | Ga0070679_100002400 | 3300005530 | Bacteria | 16984 |
| 28 | Ga0070684_100074915 | 3300005535 | Bacteria | 2984 |
| 29 | Ga0068853_100181751 | 3300005539 | Bacteria | 1907 |
| 30 | Ga0070665_100300337 | 3300005548 | Bacteria | 1608 |
| 31 | Ga0070704_100064395 | 3300005549 | Bacteria | 2635 |
| 32 | Ga0070664_100076487 | 3300005564 | Bacteria | 2876 |
| 33 | Ga0068852_100019262 | 3300005616 | Bacteria | 5396 |
| 34 | Ga0068859_100037949 | 3300005617 | Bacteria | 4834 |
| 35 | Ga0068861_100126326 | 3300005719 | Bacteria | 2069 |
| 36 | Ga0068870_10020575 | 3300005840 | Bacteria | 3215 |
| 37 | Ga0068863_100042974 | 3300005841 | Bacteria | 4292 |
| 38 | Ga0068860_100000477 | 3300005843 | Bacteria | 49839 |
| 39 | Ga0068862_100102424 | 3300005844 | Bacteria | 2506 |
| 40 | Ga0081455_10007370 | 3300005937 | Bacteria | 11598 |
| 41 | Ga0081455_10007381 | 3300005937 | Bacteria | 11587 |
| 42 | Ga0081455_10010669 | 3300005937 | Bacteria | 9294 |
| 43 | Ga0081455_10033179 | 3300005937 | Bacteria | 4643 |
| 44 | Ga0081455_10132976 | 3300005937 | Bacteria | 1942 |
| 45 | Ga0081540_1000315 | 3300005983 | Bacteria | 50137 |
| 46 | Ga0081540_1003488 | 3300005983 | Bacteria | 12411 |
| 47 | Ga0081540_1008854 | 3300005983 | Bacteria | 6988 |
| 48 | Ga0081540_1009415 | 3300005983 | Bacteria | 6731 |
| 49 | Ga0081540_1012184 | 3300005983 | Bacteria | 5686 |
| 50 | Ga0081539_10000371 | 3300005985 | Bacteria | 98455 |
| 51 | Ga0081539_10041044 | 3300005985 | Bacteria | 2709 |
| 52 | Ga0075363_100004174 | 3300006048 | Bacteria | 6275 |
| 53 | Ga0070712_100034544 | 3300006175 | Bacteria | 3427 |
| 54 | Ga0070712_100100996 | 3300006175 | Bacteria | 2133 |
| 55 | Ga0075369_10033954 | 3300006186 | Bacteria | 2163 |
| 56 | Ga0075366_10082954 | 3300006195 | Bacteria | 1915 |
| 57 | Ga0075370_10009901 | 3300006353 | Bacteria | 4967 |
| 58 | Ga0075370_10124559 | 3300006353 | Bacteria | 1502 |
| 59 | Ga0068871_100054091 | 3300006358 | Bacteria | 3255 |
| 60 | Ga0075434_100028319 | 3300006871 | Bacteria | 5503 |
| 61 | Ga0075434_100056552 | 3300006871 | Bacteria | 3898 |
| 62 | Ga0075434_100207232 | 3300006871 | Bacteria | 1981 |
| 63 | Ga0097620_100037951 | 3300006931 | Bacteria | 4834 |
| 64 | Ga0099824_1016105 | 3300006942 | Bacteria | 6871 |
| 65 | Ga0099794_10001485 | 3300007265 | Bacteria | 8212 |
| 66 | Ga0105240_10098846 | 3300009093 | Bacteria | 3553 |
| 67 | Ga0105240_10414714 | 3300009093 | Bacteria | 1514 |
| 68 | Ga0111539_10091971 | 3300009094 | Bacteria | 3564 |
| 69 | Ga0105243_10064195 | 3300009148 | Bacteria | 2945 |
| 70 | Ga0105241_10045141 | 3300009174 | Bacteria | 3342 |
| 71 | Ga0105237_10067599 | 3300009545 | Bacteria | 3567 |
| 72 | Ga0105239_10023403 | 3300010375 | Bacteria | 6803 |
| 73 | Ga0157370_10015855 | 3300013104 | Bacteria | 7646 |
| 74 | Ga0157369_10232445 | 3300013105 | Bacteria | 1927 |
| 75 | Ga0157369_10259153 | 3300013105 | Bacteria | 1814 |
| 76 | Ga0157374_10290330 | 3300013296 | Bacteria | 1616 |
| 77 | Ga0157375_10139921 | 3300013308 | Bacteria | 2547 |
| 78 | Ga0157375_10307266 | 3300013308 | Bacteria | 1750 |
| 79 | Ga0163163_10064343 | 3300014325 | Bacteria | 3639 |
| 80 | Ga0163163_10327679 | 3300014325 | Bacteria | 1585 |
| 81 | Ga0157376_10101853 | 3300014969 | Bacteria | 2510 |
| 82 | Ga0163161_10045035 | 3300017792 | Bacteria | 3180 |
| 83 | Ga0163161_10070039 | 3300017792 | Bacteria | 2565 |
| 84 | Ga0214544_1000056 | 3300021320 | Bacteria | 132760 |
| 85 | Ga0214542_1008787 | 3300021321 | Bacteria | 16304 |
| 86 | Ga0214545_1008514 | 3300021324 | Bacteria | 16304 |
| 87 | Ga0214543_1008757 | 3300021327 | Bacteria | 16304 |
| 88 | Ga0213874_10002095 | 3300021377 | Bacteria | 4228 |
| 89 | Ga0209563_103396 | 3300025230 | Bacteria | 3301 |
| 90 | Ga0209148_1000295 | 3300025254 | Bacteria | 73660 |
| 91 | Ga0209455_1008560 | 3300025272 | Bacteria | 2770 |
| 92 | Ga0209455_1009243 | 3300025272 | Bacteria | 2603 |
| 93 | Ga0209758_1000069 | 3300025297 | Bacteria | 286161 |
| 94 | Ga0209758_1001918 | 3300025297 | Bacteria | 22622 |
| 95 | Ga0209758_1002874 | 3300025297 | Bacteria | 16683 |
| 96 | Ga0209758_1004293 | 3300025297 | Bacteria | 12018 |
| 97 | Ga0209256_1003351 | 3300025299 | Bacteria | 11357 |
| 98 | Ga0207426_1001156 | 3300025302 | Bacteria | 23697 |
| 99 | Ga0207426_1002173 | 3300025302 | Bacteria | 13275 |
| 100 | Ga0207426_1009484 | 3300025302 | Bacteria | 3849 |
| 101 | Ga0209257_1004231 | 3300025304 | Bacteria | 11347 |
| 102 | Ga0207653_10026991 | 3300025885 | Bacteria | 1842 |
| 103 | Ga0207688_10019674 | 3300025901 | Bacteria | 3680 |
| 104 | Ga0207688_10140003 | 3300025901 | Bacteria | 1424 |
| 105 | Ga0207647_10017832 | 3300025904 | Bacteria | 4817 |
| 106 | Ga0207643_10039093 | 3300025908 | Bacteria | 2669 |
| 107 | Ga0207705_10057530 | 3300025909 | Bacteria | 2804 |
| 108 | Ga0207684_10002963 | 3300025910 | Bacteria | 16822 |
| 109 | Ga0207654_10032163 | 3300025911 | Bacteria | 2896 |
| 110 | Ga0207654_10066481 | 3300025911 | Bacteria | 2126 |
| 111 | Ga0207707_10049575 | 3300025912 | Bacteria | 3658 |
| 112 | Ga0207695_10000148 | 3300025913 | Bacteria | 208344 |
| 113 | Ga0207695_10301863 | 3300025913 | Bacteria | 1492 |
| 114 | Ga0207671_10003051 | 3300025914 | Bacteria | 17147 |
| 115 | Ga0207671_10034623 | 3300025914 | Bacteria | 3752 |
| 116 | Ga0207693_10042386 | 3300025915 | Bacteria | 3583 |
| 117 | Ga0207693_10208860 | 3300025915 | Bacteria | 1535 |
| 118 | Ga0207662_10001498 | 3300025918 | Bacteria | 11346 |
| 119 | Ga0207657_10009668 | 3300025919 | Bacteria | 9676 |
| 120 | Ga0207652_10254390 | 3300025921 | Bacteria | 1584 |
| 121 | Ga0207681_10157303 | 3300025923 | Bacteria | 1709 |
| 122 | Ga0207687_10020164 | 3300025927 | Bacteria | 4421 |
| 123 | Ga0207700_10177259 | 3300025928 | Bacteria | 1782 |
| 124 | Ga0207706_10046199 | 3300025933 | Bacteria | 3855 |
| 125 | Ga0207691_10210121 | 3300025940 | Bacteria | 1691 |
| 126 | Ga0207711_10102758 | 3300025941 | Bacteria | 2530 |
| 127 | Ga0207689_10109515 | 3300025942 | Bacteria | 2270 |
| 128 | Ga0207668_10060578 | 3300025972 | Bacteria | 2657 |
| 129 | Ga0207668_10198841 | 3300025972 | Bacteria | 1594 |
| 130 | Ga0207639_10260111 | 3300026041 | Bacteria | 1517 |
| 131 | Ga0207678_10019439 | 3300026067 | Bacteria | 5967 |
| 132 | Ga0207678_10041095 | 3300026067 | Bacteria | 4009 |
| 133 | Ga0207678_10044257 | 3300026067 | Bacteria | 3851 |
| 134 | Ga0207678_10142722 | 3300026067 | Bacteria | 2044 |
| 135 | Ga0207708_10005274 | 3300026075 | Bacteria | 9518 |
| 136 | Ga0207702_10262432 | 3300026078 | Bacteria | 1627 |
| 137 | Ga0207683_10003631 | 3300026121 | Bacteria | 13427 |
| 138 | Ga0209389_1000157 | 3300027296 | Bacteria | 56696 |
| 139 | Ga0209389_1000349 | 3300027296 | Bacteria | 27996 |
| 140 | Ga0209589_1003843 | 3300027357 | Bacteria | 26144 |
| 141 | Ga0209489_101111 | 3300027361 | Bacteria | 54702 |
| 142 | Ga0209489_103974 | 3300027361 | Bacteria | 27996 |
| 143 | Ga0209700_100011 | 3300027363 | Bacteria | 362159 |
| 144 | Ga0209588_1010749 | 3300027671 | Bacteria | 2757 |
| 145 | Ga0207428_10046668 | 3300027907 | Bacteria | 3483 |
| 146 | Ga0268266_10001906 | 3300028379 | Bacteria | 23472 |
| 147 | Ga0268266_10012729 | 3300028379 | Bacteria | 7270 |
| 148 | Ga0268264_10000062 | 3300028381 | Bacteria | 302110 |
| 149 | Ga0268264_10042144 | 3300028381 | Bacteria | 3778 |
| 150 | Ga0268264_10060938 | 3300028381 | Bacteria | 3164 |
| 151 | Ga0268264_10129272 | 3300028381 | Bacteria | 2237 |
| 152 | Ga0307511_10054505 | 3300030521 | Bacteria | 3151 |
| 153 | Ga0265325_10037182 | 3300031241 | Bacteria | 2574 |
| 154 | Ga0307509_10006160 | 3300031507 | Bacteria | 16260 |
| 155 | Ga0307508_10000045 | 3300031616 | Bacteria | 142824 |
| 156 | Ga0307516_10098273 | 3300031730 | Bacteria | 2746 |
| 157 | Ga0307516_10102757 | 3300031730 | Bacteria | 2672 |
| 158 | Ga0307510_10005941 | 3300033180 | Bacteria | 14568 |
| 159 | Ga0373926_0014155 | 3300035083 | Bacteria | 2709 |
| 160 | Ga0373941_0017370 | 3300035115 | Bacteria | 1970 |
| 161 | Ga0395900_0161552 | 3300037418 | Bacteria | 2285 |
| 162 | Ga0395905_0001948 | 3300037471 | Bacteria | 23653 |
| 163 | Ga0395905_0184358 | 3300037471 | Bacteria | 1959 |
| 164 | Ga0436360_1001815 | 3300039438 | Bacteria | 1463 |
| 165 | Ga0436363_0576644 | 3300039450 | Bacteria | 6088 |
| 166 | Ga0466969_0046141 | 3300044656 | Bacteria | 2161 |
| 167 | Ga0466972_0000299 | 3300044658 | Bacteria | 30012 |
| 168 | Ga0466972_0009358 | 3300044658 | Bacteria | 4926 |
| 169 | Ga0466963_0028548 | 3300044694 | Bacteria | 3583 |
| 170 | Ga0466963_0043770 | 3300044694 | Bacteria | 2946 |
| 171 | Ga0466964_0090035 | 3300044706 | Bacteria | 1334 |
| 172 | Ga0466960_0015037 | 3300044901 | Bacteria | 3329 |
| 173 | Ga0495617_012208 | 3300046452 | Bacteria | 2926 |
| 174 | Ga0495592_0017976 | 3300046454 | Bacteria | 5371 |
| 175 | Ga0495603_0003728 | 3300046455 | Bacteria | 9063 |
| 176 | Ga0495629_0002800 | 3300046459 | Bacteria | 13295 |
| 177 | Ga0495638_0003712 | 3300046460 | Bacteria | 11885 |
| 178 | Ga0495651_0003711 | 3300046462 | Bacteria | 11696 |
| 179 | Ga0495605_0054070 | 3300046474 | Bacteria | 1946 |
| 180 | Ga0495664_0006292 | 3300046477 | Bacteria | 6555 |
| 181 | Ga0495606_0102378 | 3300046507 | Bacteria | 1741 |
| 182 | Ga0495608_0035508 | 3300046511 | Bacteria | 3362 |
| 183 | Ga0495628_0010065 | 3300046516 | Bacteria | 8047 |
| 184 | Ga0495630_0162403 | 3300046517 | Bacteria | 1701 |
| 185 | Ga0495648_0087765 | 3300046524 | Bacteria | 1750 |
| 186 | Ga0495652_0029791 | 3300046529 | Bacteria | 4791 |
| 187 | Ga0495652_0064757 | 3300046529 | Bacteria | 3073 |
| 188 | Ga0495640_0025238 | 3300046533 | Bacteria | 4314 |
| 189 | Ga0495587_0007773 | 3300046536 | Bacteria | 6928 |
| 190 | Ga0495597_0021201 | 3300046542 | Bacteria | 3022 |
| 191 | Ga0495645_0010485 | 3300046543 | Bacteria | 6499 |
| 192 | Ga0495622_0036397 | 3300046557 | Bacteria | 2295 |
| 193 | Ga0495622_0041899 | 3300046557 | Bacteria | 2129 |
| 194 | Ga0495667_0005488 | 3300046559 | Bacteria | 8568 |
| 195 | Ga0495667_0061433 | 3300046559 | Bacteria | 2463 |
| 196 | Ga0495668_0063674 | 3300046616 | Bacteria | 2031 |
| 197 | Ga0495635_0024401 | 3300046663 | Bacteria | 4214 |
| 198 | Ga0495657_0011486 | 3300046675 | Bacteria | 6619 |
| 199 | Ga0495599_0125623 | 3300046678 | Bacteria | 1594 |
| 200 | Ga0495623_0002368 | 3300046679 | Bacteria | 12532 |
| 201 | Ga0495646_0016460 | 3300046680 | Bacteria | 4694 |
| 202 | Ga0495646_0033708 | 3300046680 | Bacteria | 3183 |
| 203 | Ga0495649_0120602 | 3300046694 | Bacteria | 1387 |
| 204 | Ga0495604_0001746 | 3300047317 | Bacteria | 17757 |
| 205 | Ga0495604_0115401 | 3300047317 | Bacteria | 1951 |
| 206 | Ga0495680_0000836 | 3300047322 | Bacteria | 34084 |
| 207 | Ga0495683_0018622 | 3300047323 | Bacteria | 3587 |
| 208 | Ga0495675_0007267 | 3300047444 | Bacteria | 6824 |
| 209 | Ga0495684_0006597 | 3300047471 | Bacteria | 9001 |
| 210 | Ga0495684_0060653 | 3300047471 | Bacteria | 2879 |
| 211 | Ga0495602_0013506 | 3300048088 | Bacteria | 8344 |
| 212 | Ga0496103_0009968 | 3300048906 | Bacteria | 5618 |
| 213 | Ga0496104_0000431 | 3300048907 | Bacteria | 36365 |
| 214 | Ga0496104_0005504 | 3300048907 | Bacteria | 11092 |
| 215 | Ga0496104_0032629 | 3300048907 | Bacteria | 4847 |
| 216 | Ga0496104_0100734 | 3300048907 | Bacteria | 2765 |
| 217 | Ga0496104_0187614 | 3300048907 | Bacteria | 1978 |
| 218 | Ga0496105_0076146 | 3300048908 | Bacteria | 2770 |
| 219 | Ga0496106_0001644 | 3300048909 | Bacteria | 16771 |
| 220 | Ga0496106_0190745 | 3300048909 | Bacteria | 1629 |
| 221 | Ga0496107_0110108 | 3300048910 | Bacteria | 2023 |
| 222 | Ga0496108_0038530 | 3300048911 | Bacteria | 3982 |
| 223 | Ga0496108_0059276 | 3300048911 | Bacteria | 3218 |
| 224 | Ga0496108_0104573 | 3300048911 | Bacteria | 2416 |
| 225 | Ga0496108_0163483 | 3300048911 | Bacteria | 1924 |
| 226 | Ga0496109_0000404 | 3300048912 | Bacteria | 38842 |
| 227 | Ga0496109_0215437 | 3300048912 | Bacteria | 1806 |
| 228 | Ga0496110_0004921 | 3300048913 | Bacteria | 10430 |
| 229 | Ga0496110_0024049 | 3300048913 | Bacteria | 5191 |
| 230 | Ga0496110_0344167 | 3300048913 | Bacteria | 1358 |
| 231 | Ga0496111_0030535 | 3300048914 | Bacteria | 3833 |
| 232 | Ga0496112_0001354 | 3300048915 | Bacteria | 18644 |
| 233 | Ga0496112_0148240 | 3300048915 | Bacteria | 2314 |
| 234 | Ga0496113_0001624 | 3300048916 | Bacteria | 12662 |
| 235 | Ga0496113_0009496 | 3300048916 | Bacteria | 6379 |
| 236 | Ga0496113_0058133 | 3300048916 | Bacteria | 2909 |
| 237 | Ga0496113_0073952 | 3300048916 | Bacteria | 2597 |
| 238 | Ga0496114_0070158 | 3300048917 | Bacteria | 2943 |
| 239 | Ga0496114_0212372 | 3300048917 | Bacteria | 1697 |
| 240 | Ga0496114_0263917 | 3300048917 | Bacteria | 1517 |
| 241 | Ga0496115_0020680 | 3300048918 | Bacteria | 5077 |
| 242 | Ga0496117_0046301 | 3300048920 | Bacteria | 3130 |
| 243 | Ga0496118_0023464 | 3300048921 | Bacteria | 5357 |
| 244 | Ga0496118_0135291 | 3300048921 | Bacteria | 1574 |
| 245 | Ga0496119_0030236 | 3300048922 | Bacteria | 3656 |
| 246 | Ga0496121_0000654 | 3300048924 | Bacteria | 64945 |
| 247 | Ga0496121_0019391 | 3300048924 | Bacteria | 6801 |
| 248 | Ga0496121_0054271 | 3300048924 | Bacteria | 3350 |
| 249 | Ga0496125_0055518 | 3300048928 | Bacteria | 3226 |
| 250 | Ga0496126_0114164 | 3300048929 | Bacteria | 2350 |
| 251 | Ga0501032_0018276 | 3300049569 | Bacteria | 4913 |
| 252 | Ga0501033_0042439 | 3300049570 | Bacteria | 3391 |
| 253 | Ga0501033_0081539 | 3300049570 | Bacteria | 2372 |
| 254 | Ga0501034_0047608 | 3300049571 | Bacteria | 4329 |
| 255 | Ga0501034_0057543 | 3300049571 | Bacteria | 3908 |
| 256 | Ga0501034_0242705 | 3300049571 | Bacteria | 1747 |
| 257 | Ga0501036_0061136 | 3300049572 | Bacteria | 3191 |
| 258 | Ga0501037_0006762 | 3300049573 | Bacteria | 8386 |
| 259 | Ga0501037_0011748 | 3300049573 | Bacteria | 6447 |
| 260 | Ga0501037_0055834 | 3300049573 | Bacteria | 2886 |
| 261 | Ga0501038_0022622 | 3300049574 | Bacteria | 5629 |
| 262 | Ga0501038_0029585 | 3300049574 | Bacteria | 4851 |
| 263 | Ga0501038_0112876 | 3300049574 | Bacteria | 2249 |
| 264 | Ga0501038_0129001 | 3300049574 | Bacteria | 2078 |
| 265 | Ga0501039_0019466 | 3300049575 | Bacteria | 5204 |
| 266 | Ga0501039_0055331 | 3300049575 | Bacteria | 3072 |
| 267 | Ga0501043_0029469 | 3300049579 | Bacteria | 4312 |
| 268 | Ga0501043_0030336 | 3300049579 | Bacteria | 4249 |
| 269 | Ga0501046_0006647 | 3300049580 | Bacteria | 10216 |
| 270 | Ga0501046_0023536 | 3300049580 | Bacteria | 5065 |
| 271 | Ga0501047_0027786 | 3300049581 | Bacteria | 5451 |
| 272 | Ga0501047_0101585 | 3300049581 | Bacteria | 2755 |
| 273 | Ga0501048_0094283 | 3300049582 | Bacteria | 2111 |
| 274 | Ga0501069_0026587 | 3300049585 | Bacteria | 3169 |
| 275 | Ga0501070_0103505 | 3300049586 | Bacteria | 2354 |
| 276 | Ga0501070_0189983 | 3300049586 | Bacteria | 1688 |
| 277 | Ga0501071_0022461 | 3300049587 | Bacteria | 4397 |
| 278 | Ga0501071_0067878 | 3300049587 | Bacteria | 2594 |
| 279 | Ga0501072_0023228 | 3300049588 | Bacteria | 4816 |
| 280 | Ga0501073_0031245 | 3300049589 | Bacteria | 3799 |
| 281 | Ga0501073_0078944 | 3300049589 | Bacteria | 2290 |
| 282 | Ga0501080_0020427 | 3300049742 | Bacteria | 6129 |
| 283 | Ga0501080_0031459 | 3300049742 | Bacteria | 4944 |
| 284 | Ga0501080_0073718 | 3300049742 | Bacteria | 3175 |
| 285 | Ga0501035_0043306 | 3300049822 | Bacteria | 4057 |
| 286 | Ga0501035_0130879 | 3300049822 | Bacteria | 2187 |
| 287 | Ga0501044_0071002 | 3300049823 | Bacteria | 3541 |
| 288 | Ga0501044_0127545 | 3300049823 | Bacteria | 2540 |
| 289 | nmdc:mga03n38_788_c1 | 3300050490 | Bacteria | 8412 |
| 290 | nmdc:mga06z11_6741_c1 | 3300050494 | Bacteria | 4692 |
| 291 | nmdc:mga07m45_3103_c1 | 3300050496 | Bacteria | 7739 |
| 292 | nmdc:mga07m45_74977_c1 | 3300050496 | Bacteria | 1927 |
| 293 | nmdc:mga05p37_191184_c1 | 3300050507 | Bacteria | 2485 |
| 294 | nmdc:mga08y16_337547_c1 | 3300050511 | Bacteria | 1549 |
| 295 | nmdc:mga0n895_30842_c1 | 3300050512 | Bacteria | 5128 |
| 296 | nmdc:mga0sz30_19967_c1 | 3300050516 | Bacteria | 2699 |
| 297 | Ga0495601_0006579 | 3300053077 | Bacteria | 6798 |
| 298 | Ga0495655_0010864 | 3300053083 | Bacteria | 1811 |
| 299 | Ga0495619_0020301 | 3300053085 | Bacteria | 4230 |
| 300 | Ga0495619_0116346 | 3300053085 | Bacteria | 1830 |
| 301 | Ga0495619_0194939 | 3300053085 | Bacteria | 1402 |
| 302 | Ga0500643_000076 | 3300053087 | Bacteria | 106911 |
| 303 | Ga0500566_0000107 | 3300053094 | Bacteria | 42130 |
| 304 | Ga0500566_0002998 | 3300053094 | Bacteria | 10082 |
| 305 | Ga0500557_000021 | 3300053105 | Bacteria | 89662 |
| 306 | Ga0500572_002265 | 3300053111 | Bacteria | 4684 |
| 307 | Ga0500572_015068 | 3300053111 | Bacteria | 1943 |
| 308 | Ga0500595_039094 | 3300053119 | Bacteria | 1537 |
| 309 | Ga0500608_047467 | 3300053122 | Bacteria | 2063 |
| 310 | Ga0500614_006565 | 3300053123 | Bacteria | 2445 |
| 311 | Ga0500642_0000225 | 3300053130 | Bacteria | 22158 |
| 312 | Ga0500559_0001471 | 3300053136 | Bacteria | 13308 |
| 313 | Ga0500559_0055039 | 3300053136 | Bacteria | 1763 |
| 314 | Ga0500568_0016005 | 3300053139 | Bacteria | 3342 |
| 315 | Ga0500577_0017947 | 3300053142 | Bacteria | 2265 |
| 316 | Ga0500616_0013699 | 3300053153 | Bacteria | 4693 |
| 317 | Ga0500627_0075722 | 3300053158 | Bacteria | 1496 |
| 318 | Ga0500636_0001726 | 3300053177 | Bacteria | 11964 |
| 319 | Ga0500636_0019278 | 3300053177 | Bacteria | 4037 |
| 320 | Ga0500625_001964 | 3300053729 | Bacteria | 7441 |
| 321 | Ga0500596_002404 | 3300053735 | Bacteria | 3691 |
| 322 | Ga0500596_003276 | 3300053735 | Bacteria | 3104 |
| 323 | Ga0500596_010501 | 3300053735 | Bacteria | 1429 |
| 324 | Ga0500599_006139 | 3300053736 | Bacteria | 1527 |
| 325 | Ga0500601_001452 | 3300053737 | Bacteria | 2603 |
| 326 | Ga0500661_014696 | 3300055283 | Bacteria | 1408 |
| 327 | Ga0501082_0025665 | 3300060353 | Bacteria | 5077 |
| 328 | 2507505427 | 2507262055 | Bacteria | 8048963 |
| 329 | 2508539313 | 2508501009 | Bacteria | 7784016 |
| 330 | 2508695640 | 2508501042 | Bacteria | 8719808 |
| 331 | 2511399102 | 2511231028 | Bacteria | 8046582 |
| 332 | 2513623948 | 2513237092 | Bacteria | 8341956 |
| 333 | 2513642166 | 2513237094 | Bacteria | 8789602 |
| 334 | 2513651357 | 2513237095 | Bacteria | 8976980 |
| 335 | 2513695265 | 2513237101 | Bacteria | 7952346 |
| 336 | 2513700741 | 2513237102 | Bacteria | 7703324 |
| 337 | 2513718218 | 2513237104 | Bacteria | 10034502 |
| 338 | 2513873372 | 2513237139 | Bacteria | 8737671 |
| 339 | 2514014702 | 2513237161 | Bacteria | 8871253 |
| 340 | 2515627623 | 2515154112 | Bacteria | 8294334 |
| 341 | 2517106302 | 2517093001 | Bacteria | 9002274 |
| 342 | 2524441419 | 2524023205 | Bacteria | 8918781 |
| 343 | 2528853341 | 2528768022 | Bacteria | 10457665 |
| 344 | 2617352083 | 2617270735 | Bacteria | 9163226 |
| 345 | 2617373552 | 2617270741 | Bacteria | 8201522 |
| 346 | 2723841794 | 2721755755 | Bacteria | 8322773 |
| 347 | 2745077553 | 2744054633 | Bacteria | 8678936 |
| 348 | 2793062212 | 2791355196 | Bacteria | 7323613 |
| 349 | 2805920720 | 2802429603 | Bacteria | 8777136 |
| 350 | 2818237832 | 2816332527 | Bacteria | 8933356 |
| 351 | 2824609014 | 2824600985 | Bacteria | 8488197 |
| 352 | 2824617720 | 2824609381 | Bacteria | 8672835 |
| 353 | 2824624805 | 2824617872 | Bacteria | 8814715 |
| 354 | 2824633729 | 2824626560 | Bacteria | 8813858 |
| 355 | 2824643265 | 2824635225 | Bacteria | 8785348 |
| 356 | 2824652827 | 2824644064 | Bacteria | 8743947 |
| 357 | 2824661009 | 2824653114 | Bacteria | 8493680 |
| 358 | 2824670012 | 2824661429 | Bacteria | 9877870 |
| 359 | 2824676598 | 2824671348 | Bacteria | 8369588 |
| 360 | 2824696017 | 2824687955 | Bacteria | 8360029 |
| 361 | 2824702629 | 2824696289 | Bacteria | 8335049 |
| 362 | 2824711056 | 2824704595 | Bacteria | 9667483 |
| 363 | 2824723451 | 2824714736 | Bacteria | 8717648 |
| 364 | 2824731806 | 2824723954 | Bacteria | 8758240 |
| 365 | 2824740604 | 2824732956 | Bacteria | 7810675 |
| 366 | 2824752118 | 2824746037 | Bacteria | 7911610 |
| 367 | 2824761778 | 2824753945 | Bacteria | 9787441 |
| 368 | 2824772277 | 2824763712 | Bacteria | 9792355 |
| 369 | 2824780867 | 2824773399 | Bacteria | 8360218 |
| 370 | 2838124673 | 2838122688 | Bacteria | 8803140 |
| 371 | 2841945365 | 2841941048 | Bacteria | 8688029 |
| 372 | 2841952150 | 2841949485 | Bacteria | 8680857 |
| 373 | 2841965369 | 2841957949 | Bacteria | 8652217 |
| 374 | 2841970462 | 2841966195 | Bacteria | 8673214 |
| 375 | 2841981710 | 2841974524 | Bacteria | 8931498 |
| 376 | 2841984991 | 2841983080 | Bacteria | 8395090 |
| 377 | 2842043345 | 2842038055 | Bacteria | 8002051 |
| 378 | 2842052665 | 2842045827 | Bacteria | 8006841 |
| 379 | 2844315520 | 2844315083 | Bacteria | 8138177 |
| 380 | 2847931225 | 2847930680 | Bacteria | 9342022 |
| 381 | 2847942316 | 2847939898 | Bacteria | 8606328 |
| 382 | 2849083188 | 2849076700 | Bacteria | 7039503 |
| 383 | 2874592572 | 2874590934 | Bacteria | 8299676 |
| 384 | 2874607909 | 2874604998 | Bacteria | 7834745 |
| 385 | 2874618003 | 2874612657 | Bacteria | 8252029 |
| 386 | 2874621227 | 2874620515 | Bacteria | 8290088 |
| 387 | 2874628625 | 2874628541 | Bacteria | 8630250 |
| 388 | 2874646140 | 2874645413 | Bacteria | 8214782 |
| 389 | 2876769617 | 2876761206 | Bacteria | 10111113 |
| 390 | 2876771184 | 2876771140 | Bacteria | 8287509 |
| 391 | 2876814211 | 2876808645 | Bacteria | 8824342 |
| 392 | 2876818496 | 2876818435 | Bacteria | 8274608 |
| 393 | 2879074913 | 2879074833 | Bacteria | 8279565 |
| 394 | 2879083153 | 2879083081 | Bacteria | 8587928 |
| 395 | 2879105862 | 2879099564 | Bacteria | 10442239 |
| 396 | 2879113336 | 2879110137 | Bacteria | 8907982 |
| 397 | 2879128462 | 2879127579 | Bacteria | 8294491 |
| 398 | 2879150859 | 2879142872 | Bacteria | 8267021 |
| 399 | 2881368903 | 2881364244 | Bacteria | 7710352 |
| 400 | 2881669970 | 2881665667 | Bacteria | 8175609 |
| 401 | 2885369358 | 2885366525 | Bacteria | 8326213 |
| 402 | 2885418592 | 2885409591 | Bacteria | 9235467 |
| 403 | 2888379426 | 2888378607 | Bacteria | 9652610 |
| 404 | 2888390524 | 2888388044 | Bacteria | 7304136 |
| 405 | 2888420147 | 2888419890 | Bacteria | 7857137 |
| 406 | 2903733712 | 2903727486 | Bacteria | 8281579 |
| 407 | 2904667772 | 2904666416 | Bacteria | 8226587 |
| 408 | 2904716353 | 2904711408 | Bacteria | 9771557 |
| 409 | 2906609484 | 2906602504 | Bacteria | 8295279 |
| 410 | 2906652366 | 2906643746 | Bacteria | 8722424 |
| 411 | 2922369412 | |||
| 412 | 2922400050 | 2922393267 | Bacteria | 8285685 |
| 413 | 2929618760 | 2929615660 | Bacteria | 9193770 |
| 414 | 2929628555 | 2929624759 | Bacteria | 9339455 |
| 415 | 2932790942 | 2932784394 | Bacteria | 9704911 |
| 416 | 2932794167 | 2932794094 | Bacteria | 7915132 |
| 417 | 2932809243 | 2932801729 | Bacteria | 7987968 |
| 418 | 2932812007 | 2932809354 | Bacteria | 9135765 |
| 419 | 2932825542 | 2932818245 | Bacteria | 9955613 |
| 420 | 2932833658 | 2932828146 | Bacteria | 9745859 |
| 421 | 2933580530 | 2933577622 | Bacteria | 9116884 |
| 422 | 2935615544 | 2935608549 | Bacteria | 8203142 |
| 423 | 2935623184 | 2935616580 | Bacteria | 9032984 |
| 424 | 2935644259 | 2935638405 | Bacteria | 10015038 |
| 425 | 2935654474 | 2935648319 | Bacteria | 8801166 |
| 426 | 2935663354 | 2935656913 | Bacteria | 8965014 |
| 427 | 2935672159 | 2935665750 | Bacteria | 9571747 |
| 428 | 2935679318 | 2935675223 | Bacteria | 9928132 |
| 429 | 2935686561 | 2935684952 | Bacteria | 9590419 |
| 430 | 2935700344 | 2935694250 | Bacteria | 9291695 |
| 431 | 2935710292 | 2935703347 | Bacteria | 10242284 |
| 432 | 2935716249 | 2935713505 | Bacteria | 9608509 |
| 433 | 2935723627 | 2935722832 | Bacteria | 9608746 |
| 434 | 2935735182 | 2935732158 | Bacteria | 9706831 |
| 435 | 2935744027 | 2935741537 | Bacteria | 9707219 |
| 436 | 2935752527 | 2935750917 | Bacteria | 9590372 |
| 437 | 2935763341 | 2935760218 | Bacteria | 9817913 |
| 438 | 2935772888 | 2935769743 | Bacteria | 7878163 |
| 439 | 2935783322 | 2935777560 | Bacteria | 8077691 |
| 440 | 2935788124 | 2935785616 | Bacteria | 7962367 |
| 441 | 2935796300 | 2935793552 | Bacteria | 8012592 |
| 442 | 2935808283 | 2935801545 | Bacteria | 9301974 |
| 443 | 2935816106 | 2935810662 | Bacteria | 9401221 |
| 444 | 2935825655 | 2935819856 | Bacteria | 8261050 |
| 445 | 2935833497 | 2935827899 | Bacteria | 10038562 |
| 446 | 2935844450 | 2935837841 | Bacteria | 9454360 |
| 447 | 2935853419 | 2935847175 | Bacteria | 8228321 |
| 448 | 2935861432 | 2935855204 | Bacteria | 9035059 |
| 449 | 2935869551 | 2935864058 | Bacteria | 9784707 |
| 450 | 2935879880 | 2935873716 | Bacteria | 9632195 |
| 451 | 2935889194 | 2935883170 | Bacteria | 7964738 |
| 452 | 2935915021 | 2935908558 | Bacteria | 8568796 |
| 453 | 2935918869 | 2935916978 | Bacteria | 9113783 |
| 454 | 2935931414 | 2935926038 | Bacteria | 8601059 |
| 455 | 2935940011 | 2935934488 | Bacteria | 8602579 |
| 456 | 2935947642 | 2935942939 | Bacteria | 8599779 |
| 457 | 2935956413 | 2935951376 | Bacteria | 8602333 |
| 458 | 2935973207 | 2935967501 | Bacteria | 8603075 |
| 459 | 2935980549 | 2935975950 | Bacteria | 8347125 |
| 460 | 2935990099 | 2935984226 | Bacteria | 8302647 |
| 461 | 2935997897 | 2935992306 | Bacteria | 9802711 |
| 462 | 2936008838 | 2936002035 | Bacteria | 9362176 |
| 463 | 2936017487 | 2936011229 | Bacteria | 8801034 |
| 464 | 2936026012 | 2936019824 | Bacteria | 8804134 |
| 465 | 2936034854 | 2936028420 | Bacteria | 8965941 |
| 466 | 2936041111 | 2936037263 | Bacteria | 9446081 |
| 467 | 2936052888 | 2936046547 | Bacteria | 8903709 |
| 468 | 2936060253 | 2936055302 | Bacteria | 8785755 |
| 469 | 2940558440 | 2940556831 | Bacteria | 9590747 |
| 470 | 2941543377 | 2941538514 | Bacteria | 9402094 |
| 471 | 3005486699 | 3005483717 | Bacteria | 7877331 |
| 472 | 3005509004 | 3005506211 | Bacteria | 6943378 |
| 473 | 3005594113 | 3005587118 | Bacteria | 7794411 |
| 474 | 3005595210 | 3005594810 | Bacteria | 8716512 |
| 475 | 3005711153 | 3005710791 | Bacteria | 7622528 |
| 476 | 3005718450 | 3005718088 | Bacteria | 8283608 |
| 477 | 8006931945 | 8006926726 | Bacteria | 6749210 |
| 478 | 8006991083 | 8006984368 | Bacteria | 9651211 |
| 479 | 8016518017 | 8016511872 | Bacteria | 9921665 |
| 480 | 8016526302 | 8016522445 | Bacteria | 8156687 |
| 481 | 8016557497 | 8016548790 | Bacteria | 8155074 |
| 482 | 8016565853 | 8016557553 | Bacteria | 8154380 |
| 483 | 8016569631 | 8016566248 | Bacteria | 8158151 |
| 484 | 8016582240 | 8016575299 | Bacteria | 8154085 |
| 485 | 8016586269 | 8016583857 | Bacteria | 10421953 |
| 486 | 8016603452 | 8016595262 | Bacteria | 8149947 |
| 487 | 8016606392 | 8016603502 | Bacteria | 8731218 |
| 488 | 8016618298 | 8016613128 | Bacteria | 8794220 |
| 489 | 8016622946 | 8016622563 | Bacteria | 7999408 |
| 490 | 8016635450 | 8016630954 | Bacteria | 9217207 |
| 491 | 8017058626 | 8017057580 | Bacteria | 10023680 |
| 492 | 8019540355 | 8019538911 | Bacteria | 7872763 |
| 493 | 8019549950 | 8019547302 | Bacteria | 7996444 |
| 494 | 8019595100 | 8019586578 | Bacteria | 10212056 |
| 495 | 8019611871 | 8019608314 | Bacteria | 10042931 |
| 496 | 8019623140 | 8019619141 | Bacteria | 9218857 |
| 497 | 8019629960 | 8019629233 | Bacteria | 8687553 |
| 498 | 8019640647 | 8019638758 | Bacteria | 9062356 |
| 499 | 8019652306 | 8019648815 | Bacteria | 10014479 |
| 500 | 8019666800 | 8019659431 | Bacteria | 8577854 |
| 501 | 8019676558 | 8019668869 | Bacteria | 8791617 |
| 502 | 8019679432 | 8019678201 | Bacteria | 8863603 |
| 503 | 8019696073 | 8019687851 | Bacteria | 8712826 |
| 504 | 8055742609 | 8055742211 | Bacteria | 9226248 |
| 505 | 8056971467 | 8056967851 | Bacteria | 9038162 |
| 506 | Ga0496109_0051399 | |||
| 507 | JGI25406J46586_10021240 | |||
| 508 | JGI25153J46596_10011827 | |||
| 509 | JGI25153J46596_10018415 | |||
| 510 | JGI25160J50197_1007581 | |||
| 511 | JGI25404J52841_10001804 | |||
| 512 | JGI25404J52841_10005251 | |||
| 513 | JGI25404J52841_10014858 | |||
| 514 | Ga0055531_10012260 | |||
| 515 | Ga0055543_1002633 | |||
| 516 | Ga0065165_1005401 | |||
| 517 | Ga0070676_10117321 | |||
| 518 | Ga0070690_100044177 | |||
| 519 | Ga0068869_100044714 | |||
| 520 | Ga0068869_100266724 | |||
| 521 | Ga0070680_100046810 | |||
| 522 | Ga0068868_100045931 | |||
| 523 | Ga0070692_10068000 | |||
| 524 | Ga0070674_100080398 | |||
| 525 | Ga0070673_100016429 | |||
| 526 | Ga0070709_10007668 | |||
| 527 | Ga0070701_10004923 | |||
| 528 | Ga0070711_100199567 | |||
| 529 | Ga0070663_100065946 | |||
| 530 | Ga0070663_100070111 | |||
| 531 | Ga0070678_100142336 | |||
| 532 | Ga0070679_100002400 | |||
| 533 | Ga0070684_100074915 | |||
| 534 | Ga0068853_100181751 | |||
| 535 | Ga0070665_100300337 | |||
| 536 | Ga0070704_100064395 | |||
| 537 | Ga0070664_100076487 | |||
| 538 | Ga0068852_100019262 | |||
| 539 | Ga0068859_100037949 | |||
| 540 | Ga0068861_100126326 | |||
| 541 | Ga0068870_10020575 | |||
| 542 | Ga0068863_100042974 | |||
| 543 | Ga0068860_100000477 | |||
| 544 | Ga0068862_100102424 | |||
| 545 | Ga0081455_10007370 | |||
| 546 | Ga0081455_10007381 | |||
| 547 | Ga0081455_10010669 | |||
| 548 | Ga0081455_10033179 | |||
| 549 | Ga0081455_10132976 | |||
| 550 | Ga0081540_1000315 | |||
| 551 | Ga0081540_1003488 | |||
| 552 | Ga0081540_1008854 | |||
| 553 | Ga0081540_1009415 | |||
| 554 | Ga0081540_1012184 | |||
| 555 | Ga0081539_10000371 | |||
| 556 | Ga0081539_10041044 | |||
| 557 | Ga0075363_100004174 | |||
| 558 | Ga0070712_100034544 | |||
| 559 | Ga0070712_100100996 | |||
| 560 | Ga0075369_10033954 | |||
| 561 | Ga0075366_10082954 | |||
| 562 | Ga0075370_10009901 | |||
| 563 | Ga0075370_10124559 | |||
| 564 | Ga0068871_100054091 | |||
| 565 | Ga0075434_100028319 | |||
| 566 | Ga0075434_100056552 | |||
| 567 | Ga0075434_100207232 | |||
| 568 | Ga0097620_100037951 | |||
| 569 | Ga0099824_1016105 | |||
| 570 | Ga0099794_10001485 | |||
| 571 | Ga0105240_10098846 | |||
| 572 | Ga0105240_10414714 | |||
| 573 | Ga0111539_10091971 | |||
| 574 | Ga0105243_10064195 | |||
| 575 | Ga0105241_10045141 | |||
| 576 | Ga0105237_10067599 | |||
| 577 | Ga0105239_10023403 | |||
| 578 | Ga0157370_10015855 | |||
| 579 | Ga0157369_10232445 | |||
| 580 | Ga0157369_10259153 | |||
| 581 | Ga0157374_10290330 | |||
| 582 | Ga0157375_10139921 | |||
| 583 | Ga0157375_10307266 | |||
| 584 | Ga0163163_10064343 | |||
| 585 | Ga0163163_10327679 | |||
| 586 | Ga0157376_10101853 | |||
| 587 | Ga0163161_10045035 | |||
| 588 | Ga0163161_10070039 | |||
| 589 | Ga0214544_1000056 | |||
| 590 | Ga0214542_1008787 | |||
| 591 | Ga0214545_1008514 | |||
| 592 | Ga0214543_1008757 | |||
| 593 | Ga0213874_10002095 | |||
| 594 | Ga0209563_103396 | |||
| 595 | Ga0209148_1000295 | |||
| 596 | Ga0209455_1008560 | |||
| 597 | Ga0209455_1009243 | |||
| 598 | Ga0209758_1000069 | |||
| 599 | Ga0209758_1001918 | |||
| 600 | Ga0209758_1002874 | |||
| 601 | Ga0209758_1004293 | |||
| 602 | Ga0209256_1003351 | |||
| 603 | Ga0207426_1001156 | |||
| 604 | Ga0207426_1002173 | |||
| 605 | Ga0207426_1009484 | |||
| 606 | Ga0209257_1004231 | |||
| 607 | Ga0207653_10026991 | |||
| 608 | Ga0207688_10019674 | |||
| 609 | Ga0207688_10140003 | |||
| 610 | Ga0207647_10017832 | |||
| 611 | Ga0207643_10039093 | |||
| 612 | Ga0207705_10057530 | |||
| 613 | Ga0207684_10002963 | |||
| 614 | Ga0207654_10032163 | |||
| 615 | Ga0207654_10066481 | |||
| 616 | Ga0207707_10049575 | |||
| 617 | Ga0207695_10000148 | |||
| 618 | Ga0207695_10301863 | |||
| 619 | Ga0207671_10003051 | |||
| 620 | Ga0207671_10034623 | |||
| 621 | Ga0207693_10042386 | |||
| 622 | Ga0207693_10208860 | |||
| 623 | Ga0207662_10001498 | |||
| 624 | Ga0207657_10009668 | |||
| 625 | Ga0207652_10254390 | |||
| 626 | Ga0207681_10157303 | |||
| 627 | Ga0207687_10020164 | |||
| 628 | Ga0207700_10177259 | |||
| 629 | Ga0207706_10046199 | |||
| 630 | Ga0207691_10210121 | |||
| 631 | Ga0207711_10102758 | |||
| 632 | Ga0207689_10109515 | |||
| 633 | Ga0207668_10060578 | |||
| 634 | Ga0207668_10198841 | |||
| 635 | Ga0207639_10260111 | |||
| 636 | Ga0207678_10019439 | |||
| 637 | Ga0207678_10041095 | |||
| 638 | Ga0207678_10044257 | |||
| 639 | Ga0207678_10142722 | |||
| 640 | Ga0207708_10005274 | |||
| 641 | Ga0207702_10262432 | |||
| 642 | Ga0207683_10003631 | |||
| 643 | Ga0209389_1000157 | |||
| 644 | Ga0209389_1000349 | |||
| 645 | Ga0209589_1003843 | |||
| 646 | Ga0209489_101111 | |||
| 647 | Ga0209489_103974 | |||
| 648 | Ga0209700_100011 | |||
| 649 | Ga0209588_1010749 | |||
| 650 | Ga0207428_10046668 | |||
| 651 | Ga0268266_10001906 | |||
| 652 | Ga0268266_10012729 | |||
| 653 | Ga0268264_10000062 | |||
| 654 | Ga0268264_10042144 | |||
| 655 | Ga0268264_10060938 | |||
| 656 | Ga0268264_10129272 | |||
| 657 | Ga0307511_10054505 | |||
| 658 | Ga0265325_10037182 | |||
| 659 | Ga0307509_10006160 | |||
| 660 | Ga0307508_10000045 | |||
| 661 | Ga0307516_10098273 | |||
| 662 | Ga0307516_10102757 | |||
| 663 | Ga0307510_10005941 | |||
| 664 | Ga0373926_0014155 | |||
| 665 | Ga0373941_0017370 | |||
| 666 | Ga0395900_0161552 | |||
| 667 | Ga0395905_0001948 | |||
| 668 | Ga0395905_0184358 | |||
| 669 | Ga0436360_1001815 | |||
| 670 | Ga0436363_0576644 | |||
| 671 | Ga0466969_0046141 | |||
| 672 | Ga0466972_0000299 | |||
| 673 | Ga0466972_0009358 | |||
| 674 | Ga0466963_0028548 | |||
| 675 | Ga0466963_0043770 | |||
| 676 | Ga0466964_0090035 | |||
| 677 | Ga0466960_0015037 | |||
| 678 | Ga0495617_012208 | |||
| 679 | Ga0495592_0017976 | |||
| 680 | Ga0495603_0003728 | |||
| 681 | Ga0495629_0002800 | |||
| 682 | Ga0495638_0003712 | |||
| 683 | Ga0495651_0003711 | |||
| 684 | Ga0495605_0054070 | |||
| 685 | Ga0495664_0006292 | |||
| 686 | Ga0495606_0102378 | |||
| 687 | Ga0495608_0035508 | |||
| 688 | Ga0495628_0010065 | |||
| 689 | Ga0495630_0162403 | |||
| 690 | Ga0495648_0087765 | |||
| 691 | Ga0495652_0029791 | |||
| 692 | Ga0495652_0064757 | |||
| 693 | Ga0495640_0025238 | |||
| 694 | Ga0495587_0007773 | |||
| 695 | Ga0495597_0021201 | |||
| 696 | Ga0495645_0010485 | |||
| 697 | Ga0495622_0036397 | |||
| 698 | Ga0495622_0041899 | |||
| 699 | Ga0495667_0005488 | |||
| 700 | Ga0495667_0061433 | |||
| 701 | Ga0495668_0063674 | |||
| 702 | Ga0495635_0024401 | |||
| 703 | Ga0495657_0011486 | |||
| 704 | Ga0495599_0125623 | |||
| 705 | Ga0495623_0002368 | |||
| 706 | Ga0495646_0016460 | |||
| 707 | Ga0495646_0033708 | |||
| 708 | Ga0495649_0120602 | |||
| 709 | Ga0495604_0001746 | |||
| 710 | Ga0495604_0115401 | |||
| 711 | Ga0495680_0000836 | |||
| 712 | Ga0495683_0018622 | |||
| 713 | Ga0495675_0007267 | |||
| 714 | Ga0495684_0006597 | |||
| 715 | Ga0495684_0060653 | |||
| 716 | Ga0495602_0013506 | |||
| 717 | Ga0496103_0009968 | |||
| 718 | Ga0496104_0000431 | |||
| 719 | Ga0496104_0005504 | |||
| 720 | Ga0496104_0032629 | |||
| 721 | Ga0496104_0100734 | |||
| 722 | Ga0496104_0187614 | |||
| 723 | Ga0496105_0076146 | |||
| 724 | Ga0496106_0001644 | |||
| 725 | Ga0496106_0190745 | |||
| 726 | Ga0496107_0110108 | |||
| 727 | Ga0496108_0038530 | |||
| 728 | Ga0496108_0059276 | |||
| 729 | Ga0496108_0104573 | |||
| 730 | Ga0496108_0163483 | |||
| 731 | Ga0496109_0000404 | |||
| 732 | Ga0496109_0215437 | |||
| 733 | Ga0496110_0004921 | |||
| 734 | Ga0496110_0024049 | |||
| 735 | Ga0496110_0344167 | |||
| 736 | Ga0496111_0030535 | |||
| 737 | Ga0496112_0001354 | |||
| 738 | Ga0496112_0148240 | |||
| 739 | Ga0496113_0001624 | |||
| 740 | Ga0496113_0009496 | |||
| 741 | Ga0496113_0058133 | |||
| 742 | Ga0496113_0073952 | |||
| 743 | Ga0496114_0070158 | |||
| 744 | Ga0496114_0212372 | |||
| 745 | Ga0496114_0263917 | |||
| 746 | Ga0496115_0020680 | |||
| 747 | Ga0496117_0046301 | |||
| 748 | Ga0496118_0023464 | |||
| 749 | Ga0496118_0135291 | |||
| 750 | Ga0496119_0030236 | |||
| 751 | Ga0496121_0000654 | |||
| 752 | Ga0496121_0019391 | |||
| 753 | Ga0496121_0054271 | |||
| 754 | Ga0496125_0055518 | |||
| 755 | Ga0496126_0114164 | |||
| 756 | Ga0501032_0018276 | |||
| 757 | Ga0501033_0042439 | |||
| 758 | Ga0501033_0081539 | |||
| 759 | Ga0501034_0047608 | |||
| 760 | Ga0501034_0057543 | |||
| 761 | Ga0501034_0242705 | |||
| 762 | Ga0501036_0061136 | |||
| 763 | Ga0501037_0006762 | |||
| 764 | Ga0501037_0011748 | |||
| 765 | Ga0501037_0055834 | |||
| 766 | Ga0501038_0022622 | |||
| 767 | Ga0501038_0029585 | |||
| 768 | Ga0501038_0112876 | |||
| 769 | Ga0501038_0129001 | |||
| 770 | Ga0501039_0019466 | |||
| 771 | Ga0501039_0055331 | |||
| 772 | Ga0501043_0029469 | |||
| 773 | Ga0501043_0030336 | |||
| 774 | Ga0501046_0006647 | |||
| 775 | Ga0501046_0023536 | |||
| 776 | Ga0501047_0027786 | |||
| 777 | Ga0501047_0101585 | |||
| 778 | Ga0501048_0094283 | |||
| 779 | Ga0501069_0026587 | |||
| 780 | Ga0501070_0103505 | |||
| 781 | Ga0501070_0189983 | |||
| 782 | Ga0501071_0022461 | |||
| 783 | Ga0501071_0067878 | |||
| 784 | Ga0501072_0023228 | |||
| 785 | Ga0501073_0031245 | |||
| 786 | Ga0501073_0078944 | |||
| 787 | Ga0501080_0020427 | |||
| 788 | Ga0501080_0031459 | |||
| 789 | Ga0501080_0073718 | |||
| 790 | Ga0501035_0043306 | |||
| 791 | Ga0501035_0130879 | |||
| 792 | Ga0501044_0071002 | |||
| 793 | Ga0501044_0127545 | |||
| 794 | nmdc:mga03n38_788_c1 | |||
| 795 | nmdc:mga06z11_6741_c1 | |||
| 796 | nmdc:mga07m45_3103_c1 | |||
| 797 | nmdc:mga07m45_74977_c1 | |||
| 798 | nmdc:mga05p37_191184_c1 | |||
| 799 | nmdc:mga08y16_337547_c1 | |||
| 800 | nmdc:mga0n895_30842_c1 | |||
| 801 | nmdc:mga0sz30_19967_c1 | |||
| 802 | Ga0495601_0006579 | |||
| 803 | Ga0495655_0010864 | |||
| 804 | Ga0495619_0020301 | |||
| 805 | Ga0495619_0116346 | |||
| 806 | Ga0495619_0194939 | |||
| 807 | Ga0500643_000076 | |||
| 808 | Ga0500566_0000107 | |||
| 809 | Ga0500566_0002998 | |||
| 810 | Ga0500557_000021 | |||
| 811 | Ga0500572_002265 | |||
| 812 | Ga0500572_015068 | |||
| 813 | Ga0500595_039094 | |||
| 814 | Ga0500608_047467 | |||
| 815 | Ga0500614_006565 | |||
| 816 | Ga0500642_0000225 | |||
| 817 | Ga0500559_0001471 | |||
| 818 | Ga0500559_0055039 | |||
| 819 | Ga0500568_0016005 | |||
| 820 | Ga0500577_0017947 | |||
| 821 | Ga0500616_0013699 | |||
| 822 | Ga0500627_0075722 | |||
| 823 | Ga0500636_0001726 | |||
| 824 | Ga0500636_0019278 | |||
| 825 | Ga0500625_001964 | |||
| 826 | Ga0500596_002404 | |||
| 827 | Ga0500596_003276 | |||
| 828 | Ga0500596_010501 | |||
| 829 | Ga0500599_006139 | |||
| 830 | Ga0500601_001452 | |||
| 831 | Ga0500661_014696 | |||
| 832 | Ga0501082_0025665 | |||
| 833 | 2507505427 | |||
| 834 | 2508539313 | |||
| 835 | 2508695640 | |||
| 836 | 2511399102 | |||
| 837 | 2513623948 | |||
| 838 | 2513642166 | |||
| 839 | 2513651357 | |||
| 840 | 2513695265 | |||
| 841 | 2513700741 | |||
| 842 | 2513718218 | |||
| 843 | 2513873372 | |||
| 844 | 2514014702 | |||
| 845 | 2515627623 | |||
| 846 | 2517106302 | |||
| 847 | 2524441419 | |||
| 848 | 2528853341 | |||
| 849 | 2617352083 | |||
| 850 | 2617373552 | |||
| 851 | 2723841794 | |||
| 852 | 2745077553 | |||
| 853 | 2793062212 | |||
| 854 | 2805920720 | |||
| 855 | 2818237832 | |||
| 856 | 2824609014 | |||
| 857 | 2824617720 | |||
| 858 | 2824624805 | |||
| 859 | 2824633729 | |||
| 860 | 2824643265 | |||
| 861 | 2824652827 | |||
| 862 | 2824661009 | |||
| 863 | 2824670012 | |||
| 864 | 2824676598 | |||
| 865 | 2824696017 | |||
| 866 | 2824702629 | |||
| 867 | 2824711056 | |||
| 868 | 2824723451 | |||
| 869 | 2824731806 | |||
| 870 | 2824740604 | |||
| 871 | 2824752118 | |||
| 872 | 2824761778 | |||
| 873 | 2824772277 | |||
| 874 | 2824780867 | |||
| 875 | 2838124673 | |||
| 876 | 2841945365 | |||
| 877 | 2841952150 | |||
| 878 | 2841965369 | |||
| 879 | 2841970462 | |||
| 880 | 2841981710 | |||
| 881 | 2841984991 | |||
| 882 | 2842043345 | |||
| 883 | 2842052665 | |||
| 884 | 2844315520 | |||
| 885 | 2847931225 | |||
| 886 | 2847942316 | |||
| 887 | 2849083188 | |||
| 888 | 2874592572 | |||
| 889 | 2874607909 | |||
| 890 | 2874618003 | |||
| 891 | 2874621227 | |||
| 892 | 2874628625 | |||
| 893 | 2874646140 | |||
| 894 | 2876769617 | |||
| 895 | 2876771184 | |||
| 896 | 2876814211 | |||
| 897 | 2876818496 | |||
| 898 | 2879074913 | |||
| 899 | 2879083153 | |||
| 900 | 2879105862 | |||
| 901 | 2879113336 | |||
| 902 | 2879128462 | |||
| 903 | 2879150859 | |||
| 904 | 2881368903 | |||
| 905 | 2881669970 | |||
| 906 | 2885369358 | |||
| 907 | 2885418592 | |||
| 908 | 2888379426 | |||
| 909 | 2888390524 | |||
| 910 | 2888420147 | |||
| 911 | 2903733712 | |||
| 912 | 2904667772 | |||
| 913 | 2904716353 | |||
| 914 | 2906609484 | |||
| 915 | 2906652366 | |||
| 916 | 2922369412 | |||
| 917 | 2922400050 | |||
| 918 | 2929618760 | |||
| 919 | 2929628555 | |||
| 920 | 2932790942 | |||
| 921 | 2932794167 | |||
| 922 | 2932809243 | |||
| 923 | 2932812007 | |||
| 924 | 2932825542 | |||
| 925 | 2932833658 | |||
| 926 | 2933580530 | |||
| 927 | 2935615544 | |||
| 928 | 2935623184 | |||
| 929 | 2935644259 | |||
| 930 | 2935654474 | |||
| 931 | 2935663354 | |||
| 932 | 2935672159 | |||
| 933 | 2935679318 | |||
| 934 | 2935686561 | |||
| 935 | 2935700344 | |||
| 936 | 2935710292 | |||
| 937 | 2935716249 | |||
| 938 | 2935723627 | |||
| 939 | 2935735182 | |||
| 940 | 2935744027 | |||
| 941 | 2935752527 | |||
| 942 | 2935763341 | |||
| 943 | 2935772888 | |||
| 944 | 2935783322 | |||
| 945 | 2935788124 | |||
| 946 | 2935796300 | |||
| 947 | 2935808283 | |||
| 948 | 2935816106 | |||
| 949 | 2935825655 | |||
| 950 | 2935833497 | |||
| 951 | 2935844450 | |||
| 952 | 2935853419 | |||
| 953 | 2935861432 | |||
| 954 | 2935869551 | |||
| 955 | 2935879880 | |||
| 956 | 2935889194 | |||
| 957 | 2935915021 | |||
| 958 | 2935918869 | |||
| 959 | 2935931414 | |||
| 960 | 2935940011 | |||
| 961 | 2935947642 | |||
| 962 | 2935956413 | |||
| 963 | 2935973207 | |||
| 964 | 2935980549 | |||
| 965 | 2935990099 | |||
| 966 | 2935997897 | |||
| 967 | 2936008838 | |||
| 968 | 2936017487 | |||
| 969 | 2936026012 | |||
| 970 | 2936034854 | |||
| 971 | 2936041111 | |||
| 972 | 2936052888 | |||
| 973 | 2936060253 | |||
| 974 | 2940558440 | |||
| 975 | 2941543377 | |||
| 976 | 3005486699 | |||
| 977 | 3005509004 | |||
| 978 | 3005594113 | |||
| 979 | 3005595210 | |||
| 980 | 3005711153 | |||
| 981 | 3005718450 | |||
| 982 | 8006931945 | |||
| 983 | 8006991083 | |||
| 984 | 8016518017 | |||
| 985 | 8016526302 | |||
| 986 | 8016557497 | |||
| 987 | 8016565853 | |||
| 988 | 8016569631 | |||
| 989 | 8016582240 | |||
| 990 | 8016586269 | |||
| 991 | 8016603452 | |||
| 992 | 8016606392 | |||
| 993 | 8016618298 | |||
| 994 | 8016622946 | |||
| 995 | 8016635450 | |||
| 996 | 8017058626 | |||
| 997 | 8019540355 | |||
| 998 | 8019549950 | |||
| 999 | 8019595100 | |||
| 1000 | 8019611871 | |||
| 1001 | 8019623140 | |||
| 1002 | 8019629960 | |||
| 1003 | 8019640647 | |||
| 1004 | 8019652306 | |||
| 1005 | 8019666800 | |||
| 1006 | 8019676558 | |||
| 1007 | 8019679432 | |||
| 1008 | 8019696073 | |||
| 1009 | 8055742609 | |||
| 1010 | 8056971467 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7mjx-assembly1.cif.gz_A | miab in the complex with 5'-deoxyadenosine, methionine and rna | 0.8647 | 2 | 417 |
| 7mjx-assembly1.cif.gz_A | miab in the complex with 5'-deoxyadenosine, methionine and rna | 0.8589 | 2 | 417 |
| 7mjz-assembly1.cif.gz_A | the structure of miab with pentasulfide bridge | 0.8348 | 2 | 417 |
| 7mjz-assembly1.cif.gz_A | the structure of miab with pentasulfide bridge | 0.8292 | 2 | 417 |
| 4jc0-assembly2.cif.gz_B | crystal structure of thermotoga maritima holo rimo in complex with pentasulfide, northeast structural genomics consortium target vr77 | 0.8274 | 4 | 417 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXZ6_140_373_3.80.30.20 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain | 0.9197 | 139 | 369 | 3.80.30.20 |
| af_Q2FXZ6_140_373_3.80.30.20 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain | 0.901 | 139 | 369 | 3.80.30.20 |
| af_Q96SZ6_246_518_3.80.30.20 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain | 0.8933 | 139 | 371 | 3.80.30.20 |
| af_Q2FZ02_212_444_3.80.30.20 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain | 0.886 | 140 | 369 | 3.80.30.20 |
| af_P9WK05_198_439_3.80.30.20 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain | 0.878 | 140 | 371 | 3.80.30.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A401TUT9-F1-model_v4 | MTTase N-terminal domain-containing protein | 0.9889 | 1 | 86 |
GO:0035598
GO:0046872 GO:0051539 |
| AF-A0A401TUT9-F1-model_v4 | MTTase N-terminal domain-containing protein | 0.9776 | 1 | 86 |
GO:0035598
GO:0046872 GO:0051539 |
| AF-A0A2W4SJA4-F1-model_v4 | tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB | 0.9501 | 1 | 101 |
GO:0035598
GO:0046872 GO:0051539 |
| AF-A0A4P7F2E4-F1-model_v4 | tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB | 0.9414 | 2 | 417 |
GO:0035598
GO:0046872 GO:0051539 |
| AF-A0A7C2QNT2-F1-model_v4 | tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB | 0.9399 | 2 | 417 |
GO:0035598
GO:0046872 GO:0051539 |