F456424

General Info

Members Datasets Scaffolds Average Seq Length
505 402 1010 416

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0051399|Ga0496109_0051399_1267_2583
Length 438
Sequence VRGAARLLTPRGRAAMSVDVITFGCRLNTYESEVIRRQARAADLPETVVFNTCAVTAEAVRQSRQAIRRLKRERPAARIVVTGCAAQTEPGRFADMPEVALVLGNEEKLSAQAWRAHRDVLARASFGIAAEEKVAVNDIMTVTQTATHLIDGVEGHARAFVQVQNGCDHRCTFCIIPYGRGNSRSVPMGEVVAQVRTLCARGYREVVLTGVDLTSYGANLPGAPKLGTLVKQILKHVPELERLRLSSIDSVEADPALLDAFASDERLMPHLHLSLQSGDDLILKRMKRRHLRADAIAFCRQVRRLRPDVVFGGDIIAGFPTETEDMFARSLDLVEECGLTHLHVFPFSPRPGTPAARMPQLPSDIVKDRARRLRARGEAALRRHLDAQVGATRKVLTEFNAIGHTEHFTPVRLDASIKPGVILDLTFAGHNGRQLLAA

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
62 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
63 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
64 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
101 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
102 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
103 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
104 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
115 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
172 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
206 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
207 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
208 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
209 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
210 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
211 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
212 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
213 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
214 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
215 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
218 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
219 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
220 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
221 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
222 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
223 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
226 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
227 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
228 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
229 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
230 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
231 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
232 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
233 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
234 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
235 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
236 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
237 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
238 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
239 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
240 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
241 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
242 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
243 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
244 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
245 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
246 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
247 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
248 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
249 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
250 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
251 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
252 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
253 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
254 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
255 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
256 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
257 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
258 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
259 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
260 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
261 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
262 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
263 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
264 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
265 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
266 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
267 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
268 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
269 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
270 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
271 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
272 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
273 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
274 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
275 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
276 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
277 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
278 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
279 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
280 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
281 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
282 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
283 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
284 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
285 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
286 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
287 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
288 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
289 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
290 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
291 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
292 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
293 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
294 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
295 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
296 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
297 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
298 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
299 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
300 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
301 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
302 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
303 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
304 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
305 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
306 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
307 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
308 2922368715
309 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
310 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
311 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
312 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
313 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
314 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
315 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
316 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
317 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
318 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
319 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
320 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
321 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
322 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
323 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
324 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
325 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
326 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
327 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
328 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
329 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
330 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
331 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
332 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
333 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
334 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
335 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
336 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
337 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
338 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
339 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
340 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
341 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
342 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
343 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
344 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
345 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
346 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
347 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
348 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
349 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
350 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
351 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
352 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
353 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
354 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
355 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
356 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
357 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
358 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
359 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
360 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
361 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
362 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
363 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
364 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
365 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
366 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
367 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
368 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
369 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
370 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
371 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
372 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
373 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
374 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
375 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
376 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
377 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
378 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
379 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
380 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
381 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
382 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
383 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
384 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
385 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
386 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
387 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
388 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
389 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
390 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
391 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
392 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
393 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
394 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
395 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
396 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
397 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
398 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
399 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
400 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
401 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
402 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 64.88
Metatranscriptomes 0
Isolates 35.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.69
Nodule 28.12
Rhizoplane 6.14
Rhizosphere 42.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0051399 3300048912 Bacteria 3753
2 JGI25406J46586_10021240 3300003203 Bacteria 2609
3 JGI25153J46596_10011827 3300003215 Bacteria 3827
4 JGI25153J46596_10018415 3300003215 Bacteria 2714
5 JGI25160J50197_1007581 3300003354 Bacteria 4232
6 JGI25404J52841_10001804 3300003659 Bacteria 3886
7 JGI25404J52841_10005251 3300003659 Bacteria 2671
8 JGI25404J52841_10014858 3300003659 Bacteria 1690
9 Ga0055531_10012260 3300003794 Bacteria 4049
10 Ga0055543_1002633 3300004625 Bacteria 5784
11 Ga0065165_1005401 3300005262 Bacteria 7210
12 Ga0070676_10117321 3300005328 Bacteria 1666
13 Ga0070690_100044177 3300005330 Bacteria 2827
14 Ga0068869_100044714 3300005334 Bacteria 3185
15 Ga0068869_100266724 3300005334 Bacteria 1372
16 Ga0070680_100046810 3300005336 Bacteria 3519
17 Ga0068868_100045931 3300005338 Bacteria 3418
18 Ga0070692_10068000 3300005345 Bacteria 1892
19 Ga0070674_100080398 3300005356 Bacteria 2327
20 Ga0070673_100016429 3300005364 Bacteria 5234
21 Ga0070709_10007668 3300005434 Bacteria 5921
22 Ga0070701_10004923 3300005438 Bacteria 5467
23 Ga0070711_100199567 3300005439 Bacteria 1543
24 Ga0070663_100065946 3300005455 Bacteria 2622
25 Ga0070663_100070111 3300005455 Bacteria 2548
26 Ga0070678_100142336 3300005456 Bacteria 1921
27 Ga0070679_100002400 3300005530 Bacteria 16984
28 Ga0070684_100074915 3300005535 Bacteria 2984
29 Ga0068853_100181751 3300005539 Bacteria 1907
30 Ga0070665_100300337 3300005548 Bacteria 1608
31 Ga0070704_100064395 3300005549 Bacteria 2635
32 Ga0070664_100076487 3300005564 Bacteria 2876
33 Ga0068852_100019262 3300005616 Bacteria 5396
34 Ga0068859_100037949 3300005617 Bacteria 4834
35 Ga0068861_100126326 3300005719 Bacteria 2069
36 Ga0068870_10020575 3300005840 Bacteria 3215
37 Ga0068863_100042974 3300005841 Bacteria 4292
38 Ga0068860_100000477 3300005843 Bacteria 49839
39 Ga0068862_100102424 3300005844 Bacteria 2506
40 Ga0081455_10007370 3300005937 Bacteria 11598
41 Ga0081455_10007381 3300005937 Bacteria 11587
42 Ga0081455_10010669 3300005937 Bacteria 9294
43 Ga0081455_10033179 3300005937 Bacteria 4643
44 Ga0081455_10132976 3300005937 Bacteria 1942
45 Ga0081540_1000315 3300005983 Bacteria 50137
46 Ga0081540_1003488 3300005983 Bacteria 12411
47 Ga0081540_1008854 3300005983 Bacteria 6988
48 Ga0081540_1009415 3300005983 Bacteria 6731
49 Ga0081540_1012184 3300005983 Bacteria 5686
50 Ga0081539_10000371 3300005985 Bacteria 98455
51 Ga0081539_10041044 3300005985 Bacteria 2709
52 Ga0075363_100004174 3300006048 Bacteria 6275
53 Ga0070712_100034544 3300006175 Bacteria 3427
54 Ga0070712_100100996 3300006175 Bacteria 2133
55 Ga0075369_10033954 3300006186 Bacteria 2163
56 Ga0075366_10082954 3300006195 Bacteria 1915
57 Ga0075370_10009901 3300006353 Bacteria 4967
58 Ga0075370_10124559 3300006353 Bacteria 1502
59 Ga0068871_100054091 3300006358 Bacteria 3255
60 Ga0075434_100028319 3300006871 Bacteria 5503
61 Ga0075434_100056552 3300006871 Bacteria 3898
62 Ga0075434_100207232 3300006871 Bacteria 1981
63 Ga0097620_100037951 3300006931 Bacteria 4834
64 Ga0099824_1016105 3300006942 Bacteria 6871
65 Ga0099794_10001485 3300007265 Bacteria 8212
66 Ga0105240_10098846 3300009093 Bacteria 3553
67 Ga0105240_10414714 3300009093 Bacteria 1514
68 Ga0111539_10091971 3300009094 Bacteria 3564
69 Ga0105243_10064195 3300009148 Bacteria 2945
70 Ga0105241_10045141 3300009174 Bacteria 3342
71 Ga0105237_10067599 3300009545 Bacteria 3567
72 Ga0105239_10023403 3300010375 Bacteria 6803
73 Ga0157370_10015855 3300013104 Bacteria 7646
74 Ga0157369_10232445 3300013105 Bacteria 1927
75 Ga0157369_10259153 3300013105 Bacteria 1814
76 Ga0157374_10290330 3300013296 Bacteria 1616
77 Ga0157375_10139921 3300013308 Bacteria 2547
78 Ga0157375_10307266 3300013308 Bacteria 1750
79 Ga0163163_10064343 3300014325 Bacteria 3639
80 Ga0163163_10327679 3300014325 Bacteria 1585
81 Ga0157376_10101853 3300014969 Bacteria 2510
82 Ga0163161_10045035 3300017792 Bacteria 3180
83 Ga0163161_10070039 3300017792 Bacteria 2565
84 Ga0214544_1000056 3300021320 Bacteria 132760
85 Ga0214542_1008787 3300021321 Bacteria 16304
86 Ga0214545_1008514 3300021324 Bacteria 16304
87 Ga0214543_1008757 3300021327 Bacteria 16304
88 Ga0213874_10002095 3300021377 Bacteria 4228
89 Ga0209563_103396 3300025230 Bacteria 3301
90 Ga0209148_1000295 3300025254 Bacteria 73660
91 Ga0209455_1008560 3300025272 Bacteria 2770
92 Ga0209455_1009243 3300025272 Bacteria 2603
93 Ga0209758_1000069 3300025297 Bacteria 286161
94 Ga0209758_1001918 3300025297 Bacteria 22622
95 Ga0209758_1002874 3300025297 Bacteria 16683
96 Ga0209758_1004293 3300025297 Bacteria 12018
97 Ga0209256_1003351 3300025299 Bacteria 11357
98 Ga0207426_1001156 3300025302 Bacteria 23697
99 Ga0207426_1002173 3300025302 Bacteria 13275
100 Ga0207426_1009484 3300025302 Bacteria 3849
101 Ga0209257_1004231 3300025304 Bacteria 11347
102 Ga0207653_10026991 3300025885 Bacteria 1842
103 Ga0207688_10019674 3300025901 Bacteria 3680
104 Ga0207688_10140003 3300025901 Bacteria 1424
105 Ga0207647_10017832 3300025904 Bacteria 4817
106 Ga0207643_10039093 3300025908 Bacteria 2669
107 Ga0207705_10057530 3300025909 Bacteria 2804
108 Ga0207684_10002963 3300025910 Bacteria 16822
109 Ga0207654_10032163 3300025911 Bacteria 2896
110 Ga0207654_10066481 3300025911 Bacteria 2126
111 Ga0207707_10049575 3300025912 Bacteria 3658
112 Ga0207695_10000148 3300025913 Bacteria 208344
113 Ga0207695_10301863 3300025913 Bacteria 1492
114 Ga0207671_10003051 3300025914 Bacteria 17147
115 Ga0207671_10034623 3300025914 Bacteria 3752
116 Ga0207693_10042386 3300025915 Bacteria 3583
117 Ga0207693_10208860 3300025915 Bacteria 1535
118 Ga0207662_10001498 3300025918 Bacteria 11346
119 Ga0207657_10009668 3300025919 Bacteria 9676
120 Ga0207652_10254390 3300025921 Bacteria 1584
121 Ga0207681_10157303 3300025923 Bacteria 1709
122 Ga0207687_10020164 3300025927 Bacteria 4421
123 Ga0207700_10177259 3300025928 Bacteria 1782
124 Ga0207706_10046199 3300025933 Bacteria 3855
125 Ga0207691_10210121 3300025940 Bacteria 1691
126 Ga0207711_10102758 3300025941 Bacteria 2530
127 Ga0207689_10109515 3300025942 Bacteria 2270
128 Ga0207668_10060578 3300025972 Bacteria 2657
129 Ga0207668_10198841 3300025972 Bacteria 1594
130 Ga0207639_10260111 3300026041 Bacteria 1517
131 Ga0207678_10019439 3300026067 Bacteria 5967
132 Ga0207678_10041095 3300026067 Bacteria 4009
133 Ga0207678_10044257 3300026067 Bacteria 3851
134 Ga0207678_10142722 3300026067 Bacteria 2044
135 Ga0207708_10005274 3300026075 Bacteria 9518
136 Ga0207702_10262432 3300026078 Bacteria 1627
137 Ga0207683_10003631 3300026121 Bacteria 13427
138 Ga0209389_1000157 3300027296 Bacteria 56696
139 Ga0209389_1000349 3300027296 Bacteria 27996
140 Ga0209589_1003843 3300027357 Bacteria 26144
141 Ga0209489_101111 3300027361 Bacteria 54702
142 Ga0209489_103974 3300027361 Bacteria 27996
143 Ga0209700_100011 3300027363 Bacteria 362159
144 Ga0209588_1010749 3300027671 Bacteria 2757
145 Ga0207428_10046668 3300027907 Bacteria 3483
146 Ga0268266_10001906 3300028379 Bacteria 23472
147 Ga0268266_10012729 3300028379 Bacteria 7270
148 Ga0268264_10000062 3300028381 Bacteria 302110
149 Ga0268264_10042144 3300028381 Bacteria 3778
150 Ga0268264_10060938 3300028381 Bacteria 3164
151 Ga0268264_10129272 3300028381 Bacteria 2237
152 Ga0307511_10054505 3300030521 Bacteria 3151
153 Ga0265325_10037182 3300031241 Bacteria 2574
154 Ga0307509_10006160 3300031507 Bacteria 16260
155 Ga0307508_10000045 3300031616 Bacteria 142824
156 Ga0307516_10098273 3300031730 Bacteria 2746
157 Ga0307516_10102757 3300031730 Bacteria 2672
158 Ga0307510_10005941 3300033180 Bacteria 14568
159 Ga0373926_0014155 3300035083 Bacteria 2709
160 Ga0373941_0017370 3300035115 Bacteria 1970
161 Ga0395900_0161552 3300037418 Bacteria 2285
162 Ga0395905_0001948 3300037471 Bacteria 23653
163 Ga0395905_0184358 3300037471 Bacteria 1959
164 Ga0436360_1001815 3300039438 Bacteria 1463
165 Ga0436363_0576644 3300039450 Bacteria 6088
166 Ga0466969_0046141 3300044656 Bacteria 2161
167 Ga0466972_0000299 3300044658 Bacteria 30012
168 Ga0466972_0009358 3300044658 Bacteria 4926
169 Ga0466963_0028548 3300044694 Bacteria 3583
170 Ga0466963_0043770 3300044694 Bacteria 2946
171 Ga0466964_0090035 3300044706 Bacteria 1334
172 Ga0466960_0015037 3300044901 Bacteria 3329
173 Ga0495617_012208 3300046452 Bacteria 2926
174 Ga0495592_0017976 3300046454 Bacteria 5371
175 Ga0495603_0003728 3300046455 Bacteria 9063
176 Ga0495629_0002800 3300046459 Bacteria 13295
177 Ga0495638_0003712 3300046460 Bacteria 11885
178 Ga0495651_0003711 3300046462 Bacteria 11696
179 Ga0495605_0054070 3300046474 Bacteria 1946
180 Ga0495664_0006292 3300046477 Bacteria 6555
181 Ga0495606_0102378 3300046507 Bacteria 1741
182 Ga0495608_0035508 3300046511 Bacteria 3362
183 Ga0495628_0010065 3300046516 Bacteria 8047
184 Ga0495630_0162403 3300046517 Bacteria 1701
185 Ga0495648_0087765 3300046524 Bacteria 1750
186 Ga0495652_0029791 3300046529 Bacteria 4791
187 Ga0495652_0064757 3300046529 Bacteria 3073
188 Ga0495640_0025238 3300046533 Bacteria 4314
189 Ga0495587_0007773 3300046536 Bacteria 6928
190 Ga0495597_0021201 3300046542 Bacteria 3022
191 Ga0495645_0010485 3300046543 Bacteria 6499
192 Ga0495622_0036397 3300046557 Bacteria 2295
193 Ga0495622_0041899 3300046557 Bacteria 2129
194 Ga0495667_0005488 3300046559 Bacteria 8568
195 Ga0495667_0061433 3300046559 Bacteria 2463
196 Ga0495668_0063674 3300046616 Bacteria 2031
197 Ga0495635_0024401 3300046663 Bacteria 4214
198 Ga0495657_0011486 3300046675 Bacteria 6619
199 Ga0495599_0125623 3300046678 Bacteria 1594
200 Ga0495623_0002368 3300046679 Bacteria 12532
201 Ga0495646_0016460 3300046680 Bacteria 4694
202 Ga0495646_0033708 3300046680 Bacteria 3183
203 Ga0495649_0120602 3300046694 Bacteria 1387
204 Ga0495604_0001746 3300047317 Bacteria 17757
205 Ga0495604_0115401 3300047317 Bacteria 1951
206 Ga0495680_0000836 3300047322 Bacteria 34084
207 Ga0495683_0018622 3300047323 Bacteria 3587
208 Ga0495675_0007267 3300047444 Bacteria 6824
209 Ga0495684_0006597 3300047471 Bacteria 9001
210 Ga0495684_0060653 3300047471 Bacteria 2879
211 Ga0495602_0013506 3300048088 Bacteria 8344
212 Ga0496103_0009968 3300048906 Bacteria 5618
213 Ga0496104_0000431 3300048907 Bacteria 36365
214 Ga0496104_0005504 3300048907 Bacteria 11092
215 Ga0496104_0032629 3300048907 Bacteria 4847
216 Ga0496104_0100734 3300048907 Bacteria 2765
217 Ga0496104_0187614 3300048907 Bacteria 1978
218 Ga0496105_0076146 3300048908 Bacteria 2770
219 Ga0496106_0001644 3300048909 Bacteria 16771
220 Ga0496106_0190745 3300048909 Bacteria 1629
221 Ga0496107_0110108 3300048910 Bacteria 2023
222 Ga0496108_0038530 3300048911 Bacteria 3982
223 Ga0496108_0059276 3300048911 Bacteria 3218
224 Ga0496108_0104573 3300048911 Bacteria 2416
225 Ga0496108_0163483 3300048911 Bacteria 1924
226 Ga0496109_0000404 3300048912 Bacteria 38842
227 Ga0496109_0215437 3300048912 Bacteria 1806
228 Ga0496110_0004921 3300048913 Bacteria 10430
229 Ga0496110_0024049 3300048913 Bacteria 5191
230 Ga0496110_0344167 3300048913 Bacteria 1358
231 Ga0496111_0030535 3300048914 Bacteria 3833
232 Ga0496112_0001354 3300048915 Bacteria 18644
233 Ga0496112_0148240 3300048915 Bacteria 2314
234 Ga0496113_0001624 3300048916 Bacteria 12662
235 Ga0496113_0009496 3300048916 Bacteria 6379
236 Ga0496113_0058133 3300048916 Bacteria 2909
237 Ga0496113_0073952 3300048916 Bacteria 2597
238 Ga0496114_0070158 3300048917 Bacteria 2943
239 Ga0496114_0212372 3300048917 Bacteria 1697
240 Ga0496114_0263917 3300048917 Bacteria 1517
241 Ga0496115_0020680 3300048918 Bacteria 5077
242 Ga0496117_0046301 3300048920 Bacteria 3130
243 Ga0496118_0023464 3300048921 Bacteria 5357
244 Ga0496118_0135291 3300048921 Bacteria 1574
245 Ga0496119_0030236 3300048922 Bacteria 3656
246 Ga0496121_0000654 3300048924 Bacteria 64945
247 Ga0496121_0019391 3300048924 Bacteria 6801
248 Ga0496121_0054271 3300048924 Bacteria 3350
249 Ga0496125_0055518 3300048928 Bacteria 3226
250 Ga0496126_0114164 3300048929 Bacteria 2350
251 Ga0501032_0018276 3300049569 Bacteria 4913
252 Ga0501033_0042439 3300049570 Bacteria 3391
253 Ga0501033_0081539 3300049570 Bacteria 2372
254 Ga0501034_0047608 3300049571 Bacteria 4329
255 Ga0501034_0057543 3300049571 Bacteria 3908
256 Ga0501034_0242705 3300049571 Bacteria 1747
257 Ga0501036_0061136 3300049572 Bacteria 3191
258 Ga0501037_0006762 3300049573 Bacteria 8386
259 Ga0501037_0011748 3300049573 Bacteria 6447
260 Ga0501037_0055834 3300049573 Bacteria 2886
261 Ga0501038_0022622 3300049574 Bacteria 5629
262 Ga0501038_0029585 3300049574 Bacteria 4851
263 Ga0501038_0112876 3300049574 Bacteria 2249
264 Ga0501038_0129001 3300049574 Bacteria 2078
265 Ga0501039_0019466 3300049575 Bacteria 5204
266 Ga0501039_0055331 3300049575 Bacteria 3072
267 Ga0501043_0029469 3300049579 Bacteria 4312
268 Ga0501043_0030336 3300049579 Bacteria 4249
269 Ga0501046_0006647 3300049580 Bacteria 10216
270 Ga0501046_0023536 3300049580 Bacteria 5065
271 Ga0501047_0027786 3300049581 Bacteria 5451
272 Ga0501047_0101585 3300049581 Bacteria 2755
273 Ga0501048_0094283 3300049582 Bacteria 2111
274 Ga0501069_0026587 3300049585 Bacteria 3169
275 Ga0501070_0103505 3300049586 Bacteria 2354
276 Ga0501070_0189983 3300049586 Bacteria 1688
277 Ga0501071_0022461 3300049587 Bacteria 4397
278 Ga0501071_0067878 3300049587 Bacteria 2594
279 Ga0501072_0023228 3300049588 Bacteria 4816
280 Ga0501073_0031245 3300049589 Bacteria 3799
281 Ga0501073_0078944 3300049589 Bacteria 2290
282 Ga0501080_0020427 3300049742 Bacteria 6129
283 Ga0501080_0031459 3300049742 Bacteria 4944
284 Ga0501080_0073718 3300049742 Bacteria 3175
285 Ga0501035_0043306 3300049822 Bacteria 4057
286 Ga0501035_0130879 3300049822 Bacteria 2187
287 Ga0501044_0071002 3300049823 Bacteria 3541
288 Ga0501044_0127545 3300049823 Bacteria 2540
289 nmdc:mga03n38_788_c1 3300050490 Bacteria 8412
290 nmdc:mga06z11_6741_c1 3300050494 Bacteria 4692
291 nmdc:mga07m45_3103_c1 3300050496 Bacteria 7739
292 nmdc:mga07m45_74977_c1 3300050496 Bacteria 1927
293 nmdc:mga05p37_191184_c1 3300050507 Bacteria 2485
294 nmdc:mga08y16_337547_c1 3300050511 Bacteria 1549
295 nmdc:mga0n895_30842_c1 3300050512 Bacteria 5128
296 nmdc:mga0sz30_19967_c1 3300050516 Bacteria 2699
297 Ga0495601_0006579 3300053077 Bacteria 6798
298 Ga0495655_0010864 3300053083 Bacteria 1811
299 Ga0495619_0020301 3300053085 Bacteria 4230
300 Ga0495619_0116346 3300053085 Bacteria 1830
301 Ga0495619_0194939 3300053085 Bacteria 1402
302 Ga0500643_000076 3300053087 Bacteria 106911
303 Ga0500566_0000107 3300053094 Bacteria 42130
304 Ga0500566_0002998 3300053094 Bacteria 10082
305 Ga0500557_000021 3300053105 Bacteria 89662
306 Ga0500572_002265 3300053111 Bacteria 4684
307 Ga0500572_015068 3300053111 Bacteria 1943
308 Ga0500595_039094 3300053119 Bacteria 1537
309 Ga0500608_047467 3300053122 Bacteria 2063
310 Ga0500614_006565 3300053123 Bacteria 2445
311 Ga0500642_0000225 3300053130 Bacteria 22158
312 Ga0500559_0001471 3300053136 Bacteria 13308
313 Ga0500559_0055039 3300053136 Bacteria 1763
314 Ga0500568_0016005 3300053139 Bacteria 3342
315 Ga0500577_0017947 3300053142 Bacteria 2265
316 Ga0500616_0013699 3300053153 Bacteria 4693
317 Ga0500627_0075722 3300053158 Bacteria 1496
318 Ga0500636_0001726 3300053177 Bacteria 11964
319 Ga0500636_0019278 3300053177 Bacteria 4037
320 Ga0500625_001964 3300053729 Bacteria 7441
321 Ga0500596_002404 3300053735 Bacteria 3691
322 Ga0500596_003276 3300053735 Bacteria 3104
323 Ga0500596_010501 3300053735 Bacteria 1429
324 Ga0500599_006139 3300053736 Bacteria 1527
325 Ga0500601_001452 3300053737 Bacteria 2603
326 Ga0500661_014696 3300055283 Bacteria 1408
327 Ga0501082_0025665 3300060353 Bacteria 5077
328 2507505427 2507262055 Bacteria 8048963
329 2508539313 2508501009 Bacteria 7784016
330 2508695640 2508501042 Bacteria 8719808
331 2511399102 2511231028 Bacteria 8046582
332 2513623948 2513237092 Bacteria 8341956
333 2513642166 2513237094 Bacteria 8789602
334 2513651357 2513237095 Bacteria 8976980
335 2513695265 2513237101 Bacteria 7952346
336 2513700741 2513237102 Bacteria 7703324
337 2513718218 2513237104 Bacteria 10034502
338 2513873372 2513237139 Bacteria 8737671
339 2514014702 2513237161 Bacteria 8871253
340 2515627623 2515154112 Bacteria 8294334
341 2517106302 2517093001 Bacteria 9002274
342 2524441419 2524023205 Bacteria 8918781
343 2528853341 2528768022 Bacteria 10457665
344 2617352083 2617270735 Bacteria 9163226
345 2617373552 2617270741 Bacteria 8201522
346 2723841794 2721755755 Bacteria 8322773
347 2745077553 2744054633 Bacteria 8678936
348 2793062212 2791355196 Bacteria 7323613
349 2805920720 2802429603 Bacteria 8777136
350 2818237832 2816332527 Bacteria 8933356
351 2824609014 2824600985 Bacteria 8488197
352 2824617720 2824609381 Bacteria 8672835
353 2824624805 2824617872 Bacteria 8814715
354 2824633729 2824626560 Bacteria 8813858
355 2824643265 2824635225 Bacteria 8785348
356 2824652827 2824644064 Bacteria 8743947
357 2824661009 2824653114 Bacteria 8493680
358 2824670012 2824661429 Bacteria 9877870
359 2824676598 2824671348 Bacteria 8369588
360 2824696017 2824687955 Bacteria 8360029
361 2824702629 2824696289 Bacteria 8335049
362 2824711056 2824704595 Bacteria 9667483
363 2824723451 2824714736 Bacteria 8717648
364 2824731806 2824723954 Bacteria 8758240
365 2824740604 2824732956 Bacteria 7810675
366 2824752118 2824746037 Bacteria 7911610
367 2824761778 2824753945 Bacteria 9787441
368 2824772277 2824763712 Bacteria 9792355
369 2824780867 2824773399 Bacteria 8360218
370 2838124673 2838122688 Bacteria 8803140
371 2841945365 2841941048 Bacteria 8688029
372 2841952150 2841949485 Bacteria 8680857
373 2841965369 2841957949 Bacteria 8652217
374 2841970462 2841966195 Bacteria 8673214
375 2841981710 2841974524 Bacteria 8931498
376 2841984991 2841983080 Bacteria 8395090
377 2842043345 2842038055 Bacteria 8002051
378 2842052665 2842045827 Bacteria 8006841
379 2844315520 2844315083 Bacteria 8138177
380 2847931225 2847930680 Bacteria 9342022
381 2847942316 2847939898 Bacteria 8606328
382 2849083188 2849076700 Bacteria 7039503
383 2874592572 2874590934 Bacteria 8299676
384 2874607909 2874604998 Bacteria 7834745
385 2874618003 2874612657 Bacteria 8252029
386 2874621227 2874620515 Bacteria 8290088
387 2874628625 2874628541 Bacteria 8630250
388 2874646140 2874645413 Bacteria 8214782
389 2876769617 2876761206 Bacteria 10111113
390 2876771184 2876771140 Bacteria 8287509
391 2876814211 2876808645 Bacteria 8824342
392 2876818496 2876818435 Bacteria 8274608
393 2879074913 2879074833 Bacteria 8279565
394 2879083153 2879083081 Bacteria 8587928
395 2879105862 2879099564 Bacteria 10442239
396 2879113336 2879110137 Bacteria 8907982
397 2879128462 2879127579 Bacteria 8294491
398 2879150859 2879142872 Bacteria 8267021
399 2881368903 2881364244 Bacteria 7710352
400 2881669970 2881665667 Bacteria 8175609
401 2885369358 2885366525 Bacteria 8326213
402 2885418592 2885409591 Bacteria 9235467
403 2888379426 2888378607 Bacteria 9652610
404 2888390524 2888388044 Bacteria 7304136
405 2888420147 2888419890 Bacteria 7857137
406 2903733712 2903727486 Bacteria 8281579
407 2904667772 2904666416 Bacteria 8226587
408 2904716353 2904711408 Bacteria 9771557
409 2906609484 2906602504 Bacteria 8295279
410 2906652366 2906643746 Bacteria 8722424
411 2922369412
412 2922400050 2922393267 Bacteria 8285685
413 2929618760 2929615660 Bacteria 9193770
414 2929628555 2929624759 Bacteria 9339455
415 2932790942 2932784394 Bacteria 9704911
416 2932794167 2932794094 Bacteria 7915132
417 2932809243 2932801729 Bacteria 7987968
418 2932812007 2932809354 Bacteria 9135765
419 2932825542 2932818245 Bacteria 9955613
420 2932833658 2932828146 Bacteria 9745859
421 2933580530 2933577622 Bacteria 9116884
422 2935615544 2935608549 Bacteria 8203142
423 2935623184 2935616580 Bacteria 9032984
424 2935644259 2935638405 Bacteria 10015038
425 2935654474 2935648319 Bacteria 8801166
426 2935663354 2935656913 Bacteria 8965014
427 2935672159 2935665750 Bacteria 9571747
428 2935679318 2935675223 Bacteria 9928132
429 2935686561 2935684952 Bacteria 9590419
430 2935700344 2935694250 Bacteria 9291695
431 2935710292 2935703347 Bacteria 10242284
432 2935716249 2935713505 Bacteria 9608509
433 2935723627 2935722832 Bacteria 9608746
434 2935735182 2935732158 Bacteria 9706831
435 2935744027 2935741537 Bacteria 9707219
436 2935752527 2935750917 Bacteria 9590372
437 2935763341 2935760218 Bacteria 9817913
438 2935772888 2935769743 Bacteria 7878163
439 2935783322 2935777560 Bacteria 8077691
440 2935788124 2935785616 Bacteria 7962367
441 2935796300 2935793552 Bacteria 8012592
442 2935808283 2935801545 Bacteria 9301974
443 2935816106 2935810662 Bacteria 9401221
444 2935825655 2935819856 Bacteria 8261050
445 2935833497 2935827899 Bacteria 10038562
446 2935844450 2935837841 Bacteria 9454360
447 2935853419 2935847175 Bacteria 8228321
448 2935861432 2935855204 Bacteria 9035059
449 2935869551 2935864058 Bacteria 9784707
450 2935879880 2935873716 Bacteria 9632195
451 2935889194 2935883170 Bacteria 7964738
452 2935915021 2935908558 Bacteria 8568796
453 2935918869 2935916978 Bacteria 9113783
454 2935931414 2935926038 Bacteria 8601059
455 2935940011 2935934488 Bacteria 8602579
456 2935947642 2935942939 Bacteria 8599779
457 2935956413 2935951376 Bacteria 8602333
458 2935973207 2935967501 Bacteria 8603075
459 2935980549 2935975950 Bacteria 8347125
460 2935990099 2935984226 Bacteria 8302647
461 2935997897 2935992306 Bacteria 9802711
462 2936008838 2936002035 Bacteria 9362176
463 2936017487 2936011229 Bacteria 8801034
464 2936026012 2936019824 Bacteria 8804134
465 2936034854 2936028420 Bacteria 8965941
466 2936041111 2936037263 Bacteria 9446081
467 2936052888 2936046547 Bacteria 8903709
468 2936060253 2936055302 Bacteria 8785755
469 2940558440 2940556831 Bacteria 9590747
470 2941543377 2941538514 Bacteria 9402094
471 3005486699 3005483717 Bacteria 7877331
472 3005509004 3005506211 Bacteria 6943378
473 3005594113 3005587118 Bacteria 7794411
474 3005595210 3005594810 Bacteria 8716512
475 3005711153 3005710791 Bacteria 7622528
476 3005718450 3005718088 Bacteria 8283608
477 8006931945 8006926726 Bacteria 6749210
478 8006991083 8006984368 Bacteria 9651211
479 8016518017 8016511872 Bacteria 9921665
480 8016526302 8016522445 Bacteria 8156687
481 8016557497 8016548790 Bacteria 8155074
482 8016565853 8016557553 Bacteria 8154380
483 8016569631 8016566248 Bacteria 8158151
484 8016582240 8016575299 Bacteria 8154085
485 8016586269 8016583857 Bacteria 10421953
486 8016603452 8016595262 Bacteria 8149947
487 8016606392 8016603502 Bacteria 8731218
488 8016618298 8016613128 Bacteria 8794220
489 8016622946 8016622563 Bacteria 7999408
490 8016635450 8016630954 Bacteria 9217207
491 8017058626 8017057580 Bacteria 10023680
492 8019540355 8019538911 Bacteria 7872763
493 8019549950 8019547302 Bacteria 7996444
494 8019595100 8019586578 Bacteria 10212056
495 8019611871 8019608314 Bacteria 10042931
496 8019623140 8019619141 Bacteria 9218857
497 8019629960 8019629233 Bacteria 8687553
498 8019640647 8019638758 Bacteria 9062356
499 8019652306 8019648815 Bacteria 10014479
500 8019666800 8019659431 Bacteria 8577854
501 8019676558 8019668869 Bacteria 8791617
502 8019679432 8019678201 Bacteria 8863603
503 8019696073 8019687851 Bacteria 8712826
504 8055742609 8055742211 Bacteria 9226248
505 8056971467 8056967851 Bacteria 9038162
506 Ga0496109_0051399
507 JGI25406J46586_10021240
508 JGI25153J46596_10011827
509 JGI25153J46596_10018415
510 JGI25160J50197_1007581
511 JGI25404J52841_10001804
512 JGI25404J52841_10005251
513 JGI25404J52841_10014858
514 Ga0055531_10012260
515 Ga0055543_1002633
516 Ga0065165_1005401
517 Ga0070676_10117321
518 Ga0070690_100044177
519 Ga0068869_100044714
520 Ga0068869_100266724
521 Ga0070680_100046810
522 Ga0068868_100045931
523 Ga0070692_10068000
524 Ga0070674_100080398
525 Ga0070673_100016429
526 Ga0070709_10007668
527 Ga0070701_10004923
528 Ga0070711_100199567
529 Ga0070663_100065946
530 Ga0070663_100070111
531 Ga0070678_100142336
532 Ga0070679_100002400
533 Ga0070684_100074915
534 Ga0068853_100181751
535 Ga0070665_100300337
536 Ga0070704_100064395
537 Ga0070664_100076487
538 Ga0068852_100019262
539 Ga0068859_100037949
540 Ga0068861_100126326
541 Ga0068870_10020575
542 Ga0068863_100042974
543 Ga0068860_100000477
544 Ga0068862_100102424
545 Ga0081455_10007370
546 Ga0081455_10007381
547 Ga0081455_10010669
548 Ga0081455_10033179
549 Ga0081455_10132976
550 Ga0081540_1000315
551 Ga0081540_1003488
552 Ga0081540_1008854
553 Ga0081540_1009415
554 Ga0081540_1012184
555 Ga0081539_10000371
556 Ga0081539_10041044
557 Ga0075363_100004174
558 Ga0070712_100034544
559 Ga0070712_100100996
560 Ga0075369_10033954
561 Ga0075366_10082954
562 Ga0075370_10009901
563 Ga0075370_10124559
564 Ga0068871_100054091
565 Ga0075434_100028319
566 Ga0075434_100056552
567 Ga0075434_100207232
568 Ga0097620_100037951
569 Ga0099824_1016105
570 Ga0099794_10001485
571 Ga0105240_10098846
572 Ga0105240_10414714
573 Ga0111539_10091971
574 Ga0105243_10064195
575 Ga0105241_10045141
576 Ga0105237_10067599
577 Ga0105239_10023403
578 Ga0157370_10015855
579 Ga0157369_10232445
580 Ga0157369_10259153
581 Ga0157374_10290330
582 Ga0157375_10139921
583 Ga0157375_10307266
584 Ga0163163_10064343
585 Ga0163163_10327679
586 Ga0157376_10101853
587 Ga0163161_10045035
588 Ga0163161_10070039
589 Ga0214544_1000056
590 Ga0214542_1008787
591 Ga0214545_1008514
592 Ga0214543_1008757
593 Ga0213874_10002095
594 Ga0209563_103396
595 Ga0209148_1000295
596 Ga0209455_1008560
597 Ga0209455_1009243
598 Ga0209758_1000069
599 Ga0209758_1001918
600 Ga0209758_1002874
601 Ga0209758_1004293
602 Ga0209256_1003351
603 Ga0207426_1001156
604 Ga0207426_1002173
605 Ga0207426_1009484
606 Ga0209257_1004231
607 Ga0207653_10026991
608 Ga0207688_10019674
609 Ga0207688_10140003
610 Ga0207647_10017832
611 Ga0207643_10039093
612 Ga0207705_10057530
613 Ga0207684_10002963
614 Ga0207654_10032163
615 Ga0207654_10066481
616 Ga0207707_10049575
617 Ga0207695_10000148
618 Ga0207695_10301863
619 Ga0207671_10003051
620 Ga0207671_10034623
621 Ga0207693_10042386
622 Ga0207693_10208860
623 Ga0207662_10001498
624 Ga0207657_10009668
625 Ga0207652_10254390
626 Ga0207681_10157303
627 Ga0207687_10020164
628 Ga0207700_10177259
629 Ga0207706_10046199
630 Ga0207691_10210121
631 Ga0207711_10102758
632 Ga0207689_10109515
633 Ga0207668_10060578
634 Ga0207668_10198841
635 Ga0207639_10260111
636 Ga0207678_10019439
637 Ga0207678_10041095
638 Ga0207678_10044257
639 Ga0207678_10142722
640 Ga0207708_10005274
641 Ga0207702_10262432
642 Ga0207683_10003631
643 Ga0209389_1000157
644 Ga0209389_1000349
645 Ga0209589_1003843
646 Ga0209489_101111
647 Ga0209489_103974
648 Ga0209700_100011
649 Ga0209588_1010749
650 Ga0207428_10046668
651 Ga0268266_10001906
652 Ga0268266_10012729
653 Ga0268264_10000062
654 Ga0268264_10042144
655 Ga0268264_10060938
656 Ga0268264_10129272
657 Ga0307511_10054505
658 Ga0265325_10037182
659 Ga0307509_10006160
660 Ga0307508_10000045
661 Ga0307516_10098273
662 Ga0307516_10102757
663 Ga0307510_10005941
664 Ga0373926_0014155
665 Ga0373941_0017370
666 Ga0395900_0161552
667 Ga0395905_0001948
668 Ga0395905_0184358
669 Ga0436360_1001815
670 Ga0436363_0576644
671 Ga0466969_0046141
672 Ga0466972_0000299
673 Ga0466972_0009358
674 Ga0466963_0028548
675 Ga0466963_0043770
676 Ga0466964_0090035
677 Ga0466960_0015037
678 Ga0495617_012208
679 Ga0495592_0017976
680 Ga0495603_0003728
681 Ga0495629_0002800
682 Ga0495638_0003712
683 Ga0495651_0003711
684 Ga0495605_0054070
685 Ga0495664_0006292
686 Ga0495606_0102378
687 Ga0495608_0035508
688 Ga0495628_0010065
689 Ga0495630_0162403
690 Ga0495648_0087765
691 Ga0495652_0029791
692 Ga0495652_0064757
693 Ga0495640_0025238
694 Ga0495587_0007773
695 Ga0495597_0021201
696 Ga0495645_0010485
697 Ga0495622_0036397
698 Ga0495622_0041899
699 Ga0495667_0005488
700 Ga0495667_0061433
701 Ga0495668_0063674
702 Ga0495635_0024401
703 Ga0495657_0011486
704 Ga0495599_0125623
705 Ga0495623_0002368
706 Ga0495646_0016460
707 Ga0495646_0033708
708 Ga0495649_0120602
709 Ga0495604_0001746
710 Ga0495604_0115401
711 Ga0495680_0000836
712 Ga0495683_0018622
713 Ga0495675_0007267
714 Ga0495684_0006597
715 Ga0495684_0060653
716 Ga0495602_0013506
717 Ga0496103_0009968
718 Ga0496104_0000431
719 Ga0496104_0005504
720 Ga0496104_0032629
721 Ga0496104_0100734
722 Ga0496104_0187614
723 Ga0496105_0076146
724 Ga0496106_0001644
725 Ga0496106_0190745
726 Ga0496107_0110108
727 Ga0496108_0038530
728 Ga0496108_0059276
729 Ga0496108_0104573
730 Ga0496108_0163483
731 Ga0496109_0000404
732 Ga0496109_0215437
733 Ga0496110_0004921
734 Ga0496110_0024049
735 Ga0496110_0344167
736 Ga0496111_0030535
737 Ga0496112_0001354
738 Ga0496112_0148240
739 Ga0496113_0001624
740 Ga0496113_0009496
741 Ga0496113_0058133
742 Ga0496113_0073952
743 Ga0496114_0070158
744 Ga0496114_0212372
745 Ga0496114_0263917
746 Ga0496115_0020680
747 Ga0496117_0046301
748 Ga0496118_0023464
749 Ga0496118_0135291
750 Ga0496119_0030236
751 Ga0496121_0000654
752 Ga0496121_0019391
753 Ga0496121_0054271
754 Ga0496125_0055518
755 Ga0496126_0114164
756 Ga0501032_0018276
757 Ga0501033_0042439
758 Ga0501033_0081539
759 Ga0501034_0047608
760 Ga0501034_0057543
761 Ga0501034_0242705
762 Ga0501036_0061136
763 Ga0501037_0006762
764 Ga0501037_0011748
765 Ga0501037_0055834
766 Ga0501038_0022622
767 Ga0501038_0029585
768 Ga0501038_0112876
769 Ga0501038_0129001
770 Ga0501039_0019466
771 Ga0501039_0055331
772 Ga0501043_0029469
773 Ga0501043_0030336
774 Ga0501046_0006647
775 Ga0501046_0023536
776 Ga0501047_0027786
777 Ga0501047_0101585
778 Ga0501048_0094283
779 Ga0501069_0026587
780 Ga0501070_0103505
781 Ga0501070_0189983
782 Ga0501071_0022461
783 Ga0501071_0067878
784 Ga0501072_0023228
785 Ga0501073_0031245
786 Ga0501073_0078944
787 Ga0501080_0020427
788 Ga0501080_0031459
789 Ga0501080_0073718
790 Ga0501035_0043306
791 Ga0501035_0130879
792 Ga0501044_0071002
793 Ga0501044_0127545
794 nmdc:mga03n38_788_c1
795 nmdc:mga06z11_6741_c1
796 nmdc:mga07m45_3103_c1
797 nmdc:mga07m45_74977_c1
798 nmdc:mga05p37_191184_c1
799 nmdc:mga08y16_337547_c1
800 nmdc:mga0n895_30842_c1
801 nmdc:mga0sz30_19967_c1
802 Ga0495601_0006579
803 Ga0495655_0010864
804 Ga0495619_0020301
805 Ga0495619_0116346
806 Ga0495619_0194939
807 Ga0500643_000076
808 Ga0500566_0000107
809 Ga0500566_0002998
810 Ga0500557_000021
811 Ga0500572_002265
812 Ga0500572_015068
813 Ga0500595_039094
814 Ga0500608_047467
815 Ga0500614_006565
816 Ga0500642_0000225
817 Ga0500559_0001471
818 Ga0500559_0055039
819 Ga0500568_0016005
820 Ga0500577_0017947
821 Ga0500616_0013699
822 Ga0500627_0075722
823 Ga0500636_0001726
824 Ga0500636_0019278
825 Ga0500625_001964
826 Ga0500596_002404
827 Ga0500596_003276
828 Ga0500596_010501
829 Ga0500599_006139
830 Ga0500601_001452
831 Ga0500661_014696
832 Ga0501082_0025665
833 2507505427
834 2508539313
835 2508695640
836 2511399102
837 2513623948
838 2513642166
839 2513651357
840 2513695265
841 2513700741
842 2513718218
843 2513873372
844 2514014702
845 2515627623
846 2517106302
847 2524441419
848 2528853341
849 2617352083
850 2617373552
851 2723841794
852 2745077553
853 2793062212
854 2805920720
855 2818237832
856 2824609014
857 2824617720
858 2824624805
859 2824633729
860 2824643265
861 2824652827
862 2824661009
863 2824670012
864 2824676598
865 2824696017
866 2824702629
867 2824711056
868 2824723451
869 2824731806
870 2824740604
871 2824752118
872 2824761778
873 2824772277
874 2824780867
875 2838124673
876 2841945365
877 2841952150
878 2841965369
879 2841970462
880 2841981710
881 2841984991
882 2842043345
883 2842052665
884 2844315520
885 2847931225
886 2847942316
887 2849083188
888 2874592572
889 2874607909
890 2874618003
891 2874621227
892 2874628625
893 2874646140
894 2876769617
895 2876771184
896 2876814211
897 2876818496
898 2879074913
899 2879083153
900 2879105862
901 2879113336
902 2879128462
903 2879150859
904 2881368903
905 2881669970
906 2885369358
907 2885418592
908 2888379426
909 2888390524
910 2888420147
911 2903733712
912 2904667772
913 2904716353
914 2906609484
915 2906652366
916 2922369412
917 2922400050
918 2929618760
919 2929628555
920 2932790942
921 2932794167
922 2932809243
923 2932812007
924 2932825542
925 2932833658
926 2933580530
927 2935615544
928 2935623184
929 2935644259
930 2935654474
931 2935663354
932 2935672159
933 2935679318
934 2935686561
935 2935700344
936 2935710292
937 2935716249
938 2935723627
939 2935735182
940 2935744027
941 2935752527
942 2935763341
943 2935772888
944 2935783322
945 2935788124
946 2935796300
947 2935808283
948 2935816106
949 2935825655
950 2935833497
951 2935844450
952 2935853419
953 2935861432
954 2935869551
955 2935879880
956 2935889194
957 2935915021
958 2935918869
959 2935931414
960 2935940011
961 2935947642
962 2935956413
963 2935973207
964 2935980549
965 2935990099
966 2935997897
967 2936008838
968 2936017487
969 2936026012
970 2936034854
971 2936041111
972 2936052888
973 2936060253
974 2940558440
975 2941543377
976 3005486699
977 3005509004
978 3005594113
979 3005595210
980 3005711153
981 3005718450
982 8006931945
983 8006991083
984 8016518017
985 8016526302
986 8016557497
987 8016565853
988 8016569631
989 8016582240
990 8016586269
991 8016603452
992 8016606392
993 8016618298
994 8016622946
995 8016635450
996 8017058626
997 8019540355
998 8019549950
999 8019595100
1000 8019611871
1001 8019623140
1002 8019629960
1003 8019640647
1004 8019652306
1005 8019666800
1006 8019676558
1007 8019679432
1008 8019696073
1009 8055742609
1010 8056971467

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

161

334

0.94

PF00919

UPF0004

Uncharacterized protein family UPF0004

17

104

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mjx-assembly1.cif.gz_A miab in the complex with 5'-deoxyadenosine, methionine and rna 0.8647 2 417
7mjx-assembly1.cif.gz_A miab in the complex with 5'-deoxyadenosine, methionine and rna 0.8589 2 417
7mjz-assembly1.cif.gz_A the structure of miab with pentasulfide bridge 0.8348 2 417
7mjz-assembly1.cif.gz_A the structure of miab with pentasulfide bridge 0.8292 2 417
4jc0-assembly2.cif.gz_B crystal structure of thermotoga maritima holo rimo in complex with pentasulfide, northeast structural genomics consortium target vr77 0.8274 4 417
ID Description Score Start End Superfamily
af_Q2FXZ6_140_373_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.9197 139 369 3.80.30.20
af_Q2FXZ6_140_373_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.901 139 369 3.80.30.20
af_Q96SZ6_246_518_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.8933 139 371 3.80.30.20
af_Q2FZ02_212_444_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.886 140 369 3.80.30.20
af_P9WK05_198_439_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.878 140 371 3.80.30.20
ID Description Score Start End GO Terms
AF-A0A401TUT9-F1-model_v4 MTTase N-terminal domain-containing protein 0.9889 1 86 GO:0035598
GO:0046872
GO:0051539
AF-A0A401TUT9-F1-model_v4 MTTase N-terminal domain-containing protein 0.9776 1 86 GO:0035598
GO:0046872
GO:0051539
AF-A0A2W4SJA4-F1-model_v4 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB 0.9501 1 101 GO:0035598
GO:0046872
GO:0051539
AF-A0A4P7F2E4-F1-model_v4 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB 0.9414 2 417 GO:0035598
GO:0046872
GO:0051539
AF-A0A7C2QNT2-F1-model_v4 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB 0.9399 2 417 GO:0035598
GO:0046872
GO:0051539

Map