F456302

General Info

Members Datasets Scaffolds Average Seq Length
505 255 1010 82

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10000065|Ga0070658_1000006551
Length 82
Sequence MARSTTRTKPERPQGTRSGDDAPNPIWFKPIMFGLMIVGLAWIIVFYVSGEVKLPVPELDNWNILVGFGILFVGFLMTTRWR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
137 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
138 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
139 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
140 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
141 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
142 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
143 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
144 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
145 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
146 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
147 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
156 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
166 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
172 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
222 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
223 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
224 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
225 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
226 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
227 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
228 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
229 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
230 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
231 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
232 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
233 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
234 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
235 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
236 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
240 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
241 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
242 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
243 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
244 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
245 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
246 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
247 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
248 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
249 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
250 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
251 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
252 2928153084 Leifsonia sp. 563 Isolate Unclassified
253 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
254 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
255 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.84
Metatranscriptomes 0.99
Isolates 3.17

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 14.46
Nodule 0
Rhizoplane 7.52
Rhizosphere 66.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10000065 3300005327 Bacteria 104621
2 JGI24740J21852_10018873 3300001979 Bacteria 2438
3 JGI24740J21852_10132270 3300001979 Bacteria 622
4 JGI24739J22299_10051332 3300001989 Bacteria 1330
5 JGI24739J22299_10055218 3300001989 Bacteria 1270
6 JGI24737J22298_10002447 3300001990 Bacteria 6611
7 JGI24735J21928_10030800 3300002067 Bacteria 1592
8 JGI25162J39368_1009301 3300002737 Bacteria 1326
9 JGI25164J39214_1000299 3300002772 Bacteria 33711
10 JGI25165J46597_1000005 3300003214 Bacteria 623702
11 rootH2_10026753 3300003320 Bacteria 1329
12 rootH2_10207306 3300003320 Bacteria 1466
13 rootL2_10153718 3300003322 Bacteria 1274
14 rootH1_10201160 3300003323 Bacteria 2081
15 Ga0006562J51391_1045993 3300003578 Bacteria 5887
16 Ga0006562J51391_1045994 3300003578 Bacteria 6190
17 Ga0055539_1000060 3300003752 Bacteria 146006
18 Ga0055539_1002686 3300003752 Bacteria 2641
19 Ga0055533_1000002 3300003756 Bacteria 1196393
20 Ga0055532_1007802 3300003758 Bacteria 1361
21 Ga0055525_1000683 3300003759 Bacteria 12751
22 Ga0055527_1000004 3300003760 Bacteria 570634
23 Ga0055542_1000019 3300003762 Bacteria 341174
24 Ga0055529_1000008 3300003763 Bacteria 394786
25 Ga0055541_1001479 3300003841 Bacteria 5078
26 Ga0070658_10077964 3300005327 Bacteria 2718
27 Ga0070658_10207526 3300005327 Bacteria 1654
28 Ga0070683_102167241 3300005329 Bacteria 534
29 Ga0070670_100072877 3300005331 Bacteria 2949
30 Ga0068869_101332352 3300005334 Bacteria 634
31 Ga0070680_101569999 3300005336 Bacteria 570
32 Ga0070682_100571498 3300005337 Bacteria 888
33 Ga0070682_100911386 3300005337 Bacteria 723
34 Ga0068868_100015383 3300005338 Bacteria 5657
35 Ga0070661_100138094 3300005344 Bacteria 1835
36 Ga0070671_100025022 3300005355 Bacteria 4893
37 Ga0070659_100010637 3300005366 Bacteria 6776
38 Ga0070667_100064353 3300005367 Bacteria 3111
39 Ga0070714_100262353 3300005435 Bacteria 1600
40 Ga0070714_101631736 3300005435 Bacteria 630
41 Ga0070708_100461611 3300005445 Bacteria 1198
42 Ga0070663_100168300 3300005455 Bacteria 1692
43 Ga0070663_101523462 3300005455 Bacteria 595
44 Ga0070678_100753440 3300005456 Bacteria 881
45 Ga0070685_10012953 3300005466 Bacteria 4391
46 Ga0070679_101333974 3300005530 Bacteria 663
47 Ga0068853_100011624 3300005539 Bacteria 7155
48 Ga0068853_100187070 3300005539 Bacteria 1880
49 Ga0070672_100015768 3300005543 Bacteria 5396
50 Ga0070665_102622320 3300005548 Bacteria 505
51 Ga0068855_100001284 3300005563 Bacteria 31118
52 Ga0068855_100025736 3300005563 Bacteria 7036
53 Ga0068855_100113293 3300005563 Bacteria 3111
54 Ga0068855_100173810 3300005563 Bacteria 2438
55 Ga0068855_100175471 3300005563 Bacteria 2425
56 Ga0068855_100372245 3300005563 Bacteria 1570
57 Ga0068857_100006665 3300005577 Bacteria 9924
58 Ga0068857_100534731 3300005577 Bacteria 1103
59 Ga0068857_100762947 3300005577 Bacteria 922
60 Ga0068854_100624422 3300005578 Bacteria 922
61 Ga0068856_100085089 3300005614 Bacteria 3142
62 Ga0068856_100236424 3300005614 Bacteria 1842
63 Ga0068856_100269425 3300005614 Bacteria 1719
64 Ga0068856_100388264 3300005614 Bacteria 1416
65 Ga0068856_100487274 3300005614 Bacteria 1254
66 Ga0068852_100115576 3300005616 Bacteria 2446
67 Ga0068852_100208541 3300005616 Bacteria 1852
68 Ga0068864_100168976 3300005618 Bacteria 1993
69 Ga0068851_10000053 3300005834 Bacteria 71192
70 Ga0068851_11114356 3300005834 Bacteria 501
71 Ga0068863_100029030 3300005841 Bacteria 5283
72 Ga0068863_100052986 3300005841 Bacteria 3845
73 Ga0068858_100000176 3300005842 Bacteria 68056
74 Ga0068858_101998311 3300005842 Bacteria 573
75 Ga0075365_10010587 3300006038 Bacteria 5380
76 Ga0075368_10395784 3300006042 Bacteria 606
77 Ga0075368_10505343 3300006042 Bacteria 540
78 Ga0075367_10246678 3300006178 Bacteria 1119
79 Ga0075367_10668316 3300006178 Bacteria 660
80 Ga0075367_10737448 3300006178 Bacteria 627
81 Ga0075369_10165212 3300006186 Bacteria 1015
82 Ga0075370_10208675 3300006353 Bacteria 1153
83 Ga0075370_10849511 3300006353 Bacteria 557
84 Ga0068871_100477021 3300006358 Bacteria 1121
85 Ga0105251_10378118 3300009011 Bacteria 649
86 Ga0105240_10007542 3300009093 Bacteria 15768
87 Ga0105240_10036834 3300009093 Bacteria 6289
88 Ga0105240_10345709 3300009093 Bacteria 1689
89 Ga0105240_10625144 3300009093 Bacteria 1183
90 Ga0105245_10004574 3300009098 Bacteria 12215
91 Ga0105245_10053417 3300009098 Bacteria 3626
92 Ga0105247_10008688 3300009101 Bacteria 6191
93 Ga0105247_10458874 3300009101 Bacteria 920
94 Ga0105247_10617420 3300009101 Bacteria 806
95 Ga0105243_11238484 3300009148 Bacteria 761
96 Ga0105243_11612078 3300009148 Bacteria 676
97 Ga0105241_10005110 3300009174 Bacteria 9680
98 Ga0105241_10285393 3300009174 Bacteria 1411
99 Ga0105241_10379961 3300009174 Bacteria 1234
100 Ga0105241_11233952 3300009174 Bacteria 709
101 Ga0105242_11732596 3300009176 Bacteria 662
102 Ga0105248_10001620 3300009177 Bacteria 24994
103 Ga0105248_10103795 3300009177 Bacteria 3204
104 Ga0105248_13187540 3300009177 Bacteria 522
105 Ga0105237_10004244 3300009545 Bacteria 16680
106 Ga0105237_10045306 3300009545 Bacteria 4427
107 Ga0105237_10058463 3300009545 Bacteria 3859
108 Ga0105237_10511221 3300009545 Bacteria 1208
109 Ga0105237_11400428 3300009545 Bacteria 706
110 Ga0105237_11700971 3300009545 Bacteria 638
111 Ga0105238_10083363 3300009551 Bacteria 3186
112 Ga0105238_10137493 3300009551 Bacteria 2421
113 Ga0105238_10154123 3300009551 Bacteria 2272
114 Ga0105238_10776511 3300009551 Bacteria 973
115 Ga0105238_11068962 3300009551 Bacteria 829
116 Ga0105249_11480287 3300009553 Bacteria 751
117 Ga0105239_10141585 3300010375 Bacteria 2680
118 Ga0105239_10199544 3300010375 Bacteria 2241
119 Ga0105239_10760980 3300010375 Bacteria 1109
120 Ga0105246_10333172 3300011119 Bacteria 1238
121 Ga0157371_10001247 3300013102 Bacteria 26898
122 Ga0157371_10463970 3300013102 Bacteria 932
123 Ga0157371_11085470 3300013102 Bacteria 613
124 Ga0157370_10013223 3300013104 Bacteria 8508
125 Ga0157370_10018974 3300013104 Bacteria 6915
126 Ga0157370_10508306 3300013104 Bacteria 1106
127 Ga0157370_10728522 3300013104 Bacteria 904
128 Ga0157370_11070186 3300013104 Bacteria 729
129 Ga0157370_11992430 3300013104 Bacteria 521
130 Ga0157369_10000615 3300013105 Bacteria 46292
131 Ga0157369_10058255 3300013105 Bacteria 4167
132 Ga0157369_10122636 3300013105 Bacteria 2757
133 Ga0157369_10613682 3300013105 Bacteria 1122
134 Ga0157369_10915707 3300013105 Bacteria 899
135 Ga0157369_11216979 3300013105 Bacteria 769
136 Ga0157369_12130701 3300013105 Bacteria 569
137 Ga0157369_12287073 3300013105 Bacteria 548
138 Ga0157374_10130613 3300013296 Bacteria 2431
139 Ga0157374_12929987 3300013296 Bacteria 504
140 Ga0163162_10991339 3300013306 Bacteria 950
141 Ga0163162_13376944 3300013306 Bacteria 510
142 Ga0157372_10141543 3300013307 Bacteria 2771
143 Ga0157372_10467076 3300013307 Bacteria 1471
144 Ga0157372_10483198 3300013307 Bacteria 1444
145 Ga0157375_10335678 3300013308 Bacteria 1677
146 Ga0157375_12502816 3300013308 Bacteria 616
147 Ga0163163_10002981 3300014325 Bacteria 14322
148 Ga0163163_13021499 3300014325 Bacteria 525
149 Ga0157380_10172269 3300014326 Bacteria 1892
150 Ga0157380_11642840 3300014326 Bacteria 699
151 Ga0157380_12070562 3300014326 Bacteria 632
152 Ga0157379_10002984 3300014968 Bacteria 14273
153 Ga0157376_10074067 3300014969 Bacteria 2902
154 Ga0157376_10096336 3300014969 Bacteria 2575
155 Ga0206354_11070239 3300020081 Bacteria 1021
156 Ga0206353_10801333 3300020082 Bacteria 3349
157 Ga0154015_1341444 3300020610 Bacteria 1119
158 Ga0209566_100013 3300025225 Bacteria 474033
159 Ga0209674_100001 3300025226 Bacteria 4013750
160 Ga0209672_100011 3300025228 Bacteria 856297
161 Ga0209147_100289 3300025229 Bacteria 42738
162 Ga0209563_100001 3300025230 Bacteria 4013775
163 Ga0209563_100158 3300025230 Bacteria 60951
164 Ga0207427_100024 3300025231 Bacteria 438403
165 Ga0209437_100243 3300025233 Bacteria 88712
166 Ga0209258_103433 3300025242 Bacteria 3416
167 Ga0209677_100001 3300025253 Bacteria 4013787
168 Ga0209677_102441 3300025253 Bacteria 6992
169 Ga0209148_1000023 3300025254 Bacteria 680511
170 Ga0209129_1020496 3300025258 Bacteria 1230
171 Ga0209233_1000001 3300025261 Bacteria 2992747
172 Ga0209455_1000023 3300025272 Bacteria 680449
173 Ga0209455_1006498 3300025272 Bacteria 3440
174 Ga0207692_10706798 3300025898 Bacteria 654
175 Ga0207710_10025456 3300025900 Bacteria 2553
176 Ga0207647_10006645 3300025904 Bacteria 8403
177 Ga0207647_10064390 3300025904 Bacteria 2228
178 Ga0207647_10502298 3300025904 Bacteria 676
179 Ga0207705_10000001 3300025909 Bacteria 2061880
180 Ga0207705_10101366 3300025909 Bacteria 2118
181 Ga0207705_10264607 3300025909 Bacteria 1314
182 Ga0207695_10001399 3300025913 Bacteria 40720
183 Ga0207695_10633267 3300025913 Bacteria 951
184 Ga0207671_10046931 3300025914 Bacteria 3196
185 Ga0207671_10453150 3300025914 Bacteria 1022
186 Ga0207671_11349099 3300025914 Bacteria 554
187 Ga0207671_11607682 3300025914 Bacteria 500
188 Ga0207657_10023110 3300025919 Bacteria 5798
189 Ga0207694_10139044 3300025924 Bacteria 1952
190 Ga0207694_10399718 3300025924 Bacteria 1142
191 Ga0207650_10990721 3300025925 Bacteria 715
192 Ga0207687_10005067 3300025927 Bacteria 8724
193 Ga0207664_11130722 3300025929 Bacteria 700
194 Ga0207644_10120243 3300025931 Bacteria 1999
195 Ga0207690_10000757 3300025932 Bacteria 20846
196 Ga0207709_10463252 3300025935 Bacteria 982
197 Ga0207711_10004219 3300025941 Bacteria 12307
198 Ga0207689_11188445 3300025942 Bacteria 642
199 Ga0207667_10000498 3300025949 Bacteria 51911
200 Ga0207667_10051989 3300025949 Bacteria 4317
201 Ga0207667_10092820 3300025949 Bacteria 3117
202 Ga0207667_10132507 3300025949 Bacteria 2567
203 Ga0207667_11111539 3300025949 Bacteria 773
204 Ga0207640_10288095 3300025981 Bacteria 1293
205 Ga0207658_11183861 3300025986 Bacteria 698
206 Ga0207703_10000121 3300026035 Bacteria 94523
207 Ga0207639_10003956 3300026041 Bacteria 9998
208 Ga0207639_10119634 3300026041 Bacteria 2162
209 Ga0207639_11609914 3300026041 Bacteria 609
210 Ga0207678_10012731 3300026067 Bacteria 7386
211 Ga0207678_10991801 3300026067 Bacteria 743
212 Ga0207678_11055650 3300026067 Bacteria 719
213 Ga0207702_10100697 3300026078 Bacteria 2550
214 Ga0207702_10241371 3300026078 Bacteria 1693
215 Ga0207702_10413940 3300026078 Bacteria 1302
216 Ga0207641_10333146 3300026088 Bacteria 1442
217 Ga0207674_10382137 3300026116 Bacteria 1361
218 Ga0207674_11514431 3300026116 Bacteria 640
219 Ga0207675_100765663 3300026118 Bacteria 977
220 Ga0207683_11980714 3300026121 Bacteria 531
221 Ga0207698_10281560 3300026142 Bacteria 1538
222 Ga0209813_10175831 3300027866 Bacteria 780
223 Ga0268266_11775312 3300028379 Bacteria 592
224 Ga0268265_12285084 3300028380 Bacteria 548
225 Ga0307513_10368173 3300031456 Bacteria 1180
226 Ga0307513_10369502 3300031456 Bacteria 1177
227 Ga0307509_10745319 3300031507 Bacteria 645
228 Ga0307514_10017602 3300031649 Bacteria 5875
229 Ga0307514_10035893 3300031649 Bacteria 3943
230 Ga0307514_10399306 3300031649 Bacteria 703
231 Ga0307514_10411957 3300031649 Bacteria 684
232 Ga0307405_11484469 3300031731 Bacteria 595
233 Ga0307413_11240145 3300031824 Bacteria 650
234 Ga0307518_10343727 3300031838 Bacteria 874
235 Ga0395899_0003191 3300037312 Bacteria 12989
236 Ga0395899_0018016 3300037312 Bacteria 5374
237 Ga0395900_0000888 3300037418 Bacteria 39271
238 Ga0395898_0000355 3300037466 Bacteria 101003
239 Ga0395901_0691061 3300038443 Bacteria 1019
240 Ga0451789_0519420 3300041443 Bacteria 900
241 Ga0451791_0189905 3300041451 Bacteria 666
242 Ga0451791_0242384 3300041451 Bacteria 652
243 Ga0451791_1676698 3300041451 Bacteria 662
244 Ga0451793_1024107 3300041452 Bacteria 1365
245 Ga0451793_1440237 3300041452 Bacteria 724
246 Ga0451793_1530252 3300041452 Bacteria 2485
247 Ga0451797_0983294 3300041453 Bacteria 1661
248 Ga0451795_0060667 3300041456 Bacteria 592
249 Ga0451800_0899573 3300041459 Bacteria 535
250 Ga0451802_1176402 3300041460 Bacteria 855
251 Ga0451804_0482329 3300041463 Bacteria 522
252 Ga0451807_0044788 3300041486 Bacteria 804
253 Ga0451833_0791961 3300041491 Bacteria 634
254 Ga0451839_0045750 3300041496 Bacteria 656
255 Ga0451843_0603848 3300041509 Bacteria 524
256 Ga0451853_3653965 3300041512 Bacteria 1144
257 Ga0439462_0041011 3300042015 Bacteria 1236
258 Ga0466969_0331208 3300044656 Bacteria 689
259 Ga0466972_0017901 3300044658 Bacteria 3544
260 Ga0466972_0028650 3300044658 Bacteria 2746
261 Ga0466972_0090984 3300044658 Bacteria 1447
262 Ga0466972_0104186 3300044658 Bacteria 1342
263 Ga0466965_0028442 3300044683 Bacteria 2716
264 Ga0466965_0073324 3300044683 Bacteria 1723
265 Ga0466966_0103332 3300044684 Bacteria 1761
266 Ga0466966_0213571 3300044684 Bacteria 1165
267 Ga0466961_0031224 3300044693 Bacteria 3425
268 Ga0466961_0143049 3300044693 Bacteria 1496
269 Ga0466971_0171036 3300044719 Bacteria 1020
270 Ga0466971_0180155 3300044719 Bacteria 993
271 Ga0466971_0240124 3300044719 Bacteria 862
272 Ga0466968_0098542 3300044735 Bacteria 1303
273 Ga0466968_0136789 3300044735 Bacteria 1118
274 Ga0466970_0010248 3300044765 Bacteria 4752
275 Ga0466970_0014190 3300044765 Bacteria 4086
276 Ga0466970_0069971 3300044765 Bacteria 1886
277 Ga0466970_0105538 3300044765 Bacteria 1536
278 Ga0466970_0127256 3300044765 Bacteria 1397
279 Ga0466970_0137768 3300044765 Bacteria 1343
280 Ga0466970_0332133 3300044765 Bacteria 861
281 Ga0466970_0665834 3300044765 Bacteria 606
282 Ga0466957_0002577 3300044842 Bacteria 9755
283 Ga0466957_0238795 3300044842 Bacteria 1205
284 Ga0466957_0950971 3300044842 Bacteria 615
285 Ga0466960_0008850 3300044901 Bacteria 4135
286 Ga0466960_0017114 3300044901 Bacteria 3155
287 Ga0466960_0414042 3300044901 Bacteria 778
288 Ga0466959_0018906 3300045049 Bacteria 5062
289 Ga0466959_0026535 3300045049 Bacteria 4293
290 Ga0466958_0730003 3300045836 Bacteria 645
291 Ga0495590_0000502 3300046457 Bacteria 19199
292 Ga0495650_0000211 3300046471 Bacteria 125248
293 Ga0495606_0383277 3300046507 Bacteria 737
294 Ga0495644_0154990 3300046523 Bacteria 877
295 Ga0495609_0164554 3300046538 Bacteria 939
296 Ga0495656_0042012 3300046615 Bacteria 1913
297 Ga0495589_0347880 3300046794 Bacteria 683
298 Ga0495672_0293824 3300047320 Bacteria 772
299 Ga0495672_0351024 3300047320 Bacteria 685
300 Ga0495686_0089180 3300047472 Bacteria 1874
301 Ga0495686_0376603 3300047472 Bacteria 766
302 Ga0495615_0167079 3300048090 Bacteria 664
303 Ga0495626_0023911 3300048091 Bacteria 3002
304 Ga0496100_0145759 3300048903 Bacteria 1683
305 Ga0496100_0321682 3300048903 Bacteria 1162
306 Ga0496101_0234133 3300048904 Bacteria 1428
307 Ga0496101_0285977 3300048904 Bacteria 1289
308 Ga0496102_0055201 3300048905 Bacteria 3623
309 Ga0496102_0088326 3300048905 Bacteria 2865
310 Ga0496102_0251146 3300048905 Bacteria 1668
311 Ga0496103_0017715 3300048906 Bacteria 4265
312 Ga0496103_0409681 3300048906 Bacteria 871
313 Ga0496103_0418684 3300048906 Bacteria 860
314 Ga0496104_0273640 3300048907 Bacteria 1601
315 Ga0496105_0067335 3300048908 Bacteria 2957
316 Ga0496105_0278406 3300048908 Bacteria 1349
317 Ga0496105_0435703 3300048908 Bacteria 1036
318 Ga0496106_0389674 3300048909 Bacteria 1120
319 Ga0496107_0108381 3300048910 Bacteria 2040
320 Ga0496107_0270904 3300048910 Bacteria 1264
321 Ga0496114_0227693 3300048917 Bacteria 1637
322 Ga0496114_0350518 3300048917 Bacteria 1305
323 Ga0496114_0700586 3300048917 Bacteria 888
324 Ga0496114_1160220 3300048917 Bacteria 658
325 Ga0496115_0018850 3300048918 Bacteria 5305
326 Ga0496115_0047724 3300048918 Bacteria 3424
327 Ga0496115_0230863 3300048918 Bacteria 1526
328 Ga0496115_0633900 3300048918 Bacteria 846
329 Ga0496117_0000184 3300048920 Bacteria 127675
330 Ga0496117_0000239 3300048920 Bacteria 104054
331 Ga0496117_0007338 3300048920 Bacteria 10806
332 Ga0496117_0159654 3300048920 Bacteria 1323
333 Ga0496117_0493710 3300048920 Bacteria 595
334 Ga0496118_0000985 3300048921 Bacteria 44347
335 Ga0496118_0002061 3300048921 Bacteria 28314
336 Ga0496118_0399653 3300048921 Bacteria 714
337 Ga0496119_0000553 3300048922 Bacteria 50775
338 Ga0496119_0065088 3300048922 Bacteria 2161
339 Ga0496119_0121542 3300048922 Bacteria 1435
340 Ga0496119_0210436 3300048922 Bacteria 1001
341 Ga0496119_0238498 3300048922 Bacteria 922
342 Ga0496119_0342212 3300048922 Bacteria 726
343 Ga0496120_0071349 3300048923 Bacteria 1907
344 Ga0496120_0089384 3300048923 Bacteria 1649
345 Ga0496120_0294732 3300048923 Bacteria 745
346 Ga0496120_0353758 3300048923 Bacteria 659
347 Ga0496120_0381539 3300048923 Bacteria 626
348 Ga0496121_0000046 3300048924 Bacteria 335942
349 Ga0496121_0138398 3300048924 Bacteria 1810
350 Ga0496121_0172910 3300048924 Bacteria 1567
351 Ga0496121_0807464 3300048924 Bacteria 551
352 Ga0496121_0857966 3300048924 Bacteria 527
353 Ga0496122_0002555 3300048925 Bacteria 25570
354 Ga0496122_0008548 3300048925 Bacteria 11012
355 Ga0496123_0017813 3300048926 Bacteria 5689
356 Ga0496123_0019884 3300048926 Bacteria 5271
357 Ga0496123_0206963 3300048926 Bacteria 1001
358 Ga0496124_0000090 3300048927 Bacteria 192095
359 Ga0496124_0055321 3300048927 Bacteria 3353
360 Ga0496124_0198998 3300048927 Bacteria 1525
361 Ga0496124_0266967 3300048927 Bacteria 1255
362 Ga0496126_0204062 3300048929 Bacteria 1667
363 Ga0496126_0240993 3300048929 Bacteria 1511
364 Ga0496126_0610874 3300048929 Bacteria 858
365 Ga0496126_1287342 3300048929 Bacteria 533
366 Ga0501031_0047180 3300049568 Bacteria 2808
367 Ga0501032_0008462 3300049569 Bacteria 7500
368 Ga0501032_0018532 3300049569 Bacteria 4875
369 Ga0501032_0051997 3300049569 Bacteria 2761
370 Ga0501032_0055687 3300049569 Bacteria 2660
371 Ga0501032_0081487 3300049569 Bacteria 2153
372 Ga0501033_0003572 3300049570 Bacteria 12723
373 Ga0501033_0094000 3300049570 Bacteria 2192
374 Ga0501033_0635125 3300049570 Bacteria 730
375 Ga0501034_0002069 3300049571 Bacteria 25050
376 Ga0501034_0013349 3300049571 Bacteria 8458
377 Ga0501034_0048738 3300049571 Bacteria 4275
378 Ga0501034_0067816 3300049571 Bacteria 3579
379 Ga0501034_0086352 3300049571 Bacteria 3138
380 Ga0501034_0110448 3300049571 Bacteria 2740
381 Ga0501034_0261430 3300049571 Bacteria 1673
382 Ga0501034_0312956 3300049571 Bacteria 1504
383 Ga0501034_0319253 3300049571 Bacteria 1486
384 Ga0501034_0971178 3300049571 Bacteria 734
385 Ga0501034_1064967 3300049571 Bacteria 690
386 Ga0501036_0162336 3300049572 Bacteria 1884
387 Ga0501036_0219950 3300049572 Bacteria 1595
388 Ga0501036_0268024 3300049572 Bacteria 1430
389 Ga0501036_0394544 3300049572 Bacteria 1154
390 Ga0501037_0008696 3300049573 Bacteria 7442
391 Ga0501037_0018977 3300049573 Bacteria 5069
392 Ga0501037_0030933 3300049573 Bacteria 3953
393 Ga0501037_0047434 3300049573 Bacteria 3148
394 Ga0501037_0063217 3300049573 Bacteria 2698
395 Ga0501037_0177569 3300049573 Bacteria 1512
396 Ga0501038_0008304 3300049574 Bacteria 9557
397 Ga0501038_0010718 3300049574 Bacteria 8380
398 Ga0501038_0036160 3300049574 Bacteria 4334
399 Ga0501038_0216041 3300049574 Bacteria 1532
400 Ga0501038_0327021 3300049574 Bacteria 1198
401 Ga0501038_0766442 3300049574 Bacteria 719
402 Ga0501038_1162550 3300049574 Bacteria 561
403 Ga0501039_0004737 3300049575 Bacteria 10303
404 Ga0501039_0345402 3300049575 Bacteria 1169
405 Ga0501039_0511693 3300049575 Bacteria 943
406 Ga0501042_0099641 3300049578 Bacteria 2089
407 Ga0501043_0002406 3300049579 Bacteria 15835
408 Ga0501043_0024245 3300049579 Bacteria 4761
409 Ga0501043_0059385 3300049579 Bacteria 3002
410 Ga0501043_0080079 3300049579 Bacteria 2566
411 Ga0501043_0137611 3300049579 Bacteria 1913
412 Ga0501043_0639161 3300049579 Bacteria 782
413 Ga0501046_0001009 3300049580 Bacteria 27472
414 Ga0501046_0853322 3300049580 Bacteria 637
415 Ga0501047_0098788 3300049581 Bacteria 2797
416 Ga0501047_0110875 3300049581 Bacteria 2626
417 Ga0501047_0307833 3300049581 Bacteria 1425
418 Ga0501047_0401594 3300049581 Bacteria 1203
419 Ga0501048_0003662 3300049582 Bacteria 11709
420 Ga0501048_0522901 3300049582 Bacteria 851
421 Ga0501068_0831294 3300049584 Bacteria 606
422 Ga0501070_0000269 3300049586 Bacteria 49060
423 Ga0501070_0041237 3300049586 Bacteria 3846
424 Ga0501070_0044738 3300049586 Bacteria 3682
425 Ga0501070_0253105 3300049586 Bacteria 1440
426 Ga0501071_0002444 3300049587 Bacteria 11271
427 Ga0501071_0570256 3300049587 Bacteria 870
428 Ga0501071_1093817 3300049587 Bacteria 616
429 Ga0501072_0444719 3300049588 Bacteria 1027
430 Ga0501072_0651183 3300049588 Bacteria 829
431 Ga0501073_0055893 3300049589 Bacteria 2761
432 Ga0501073_0085544 3300049589 Bacteria 2194
433 Ga0501073_0131347 3300049589 Bacteria 1736
434 Ga0501073_0529368 3300049589 Bacteria 814
435 Ga0501077_0953086 3300049593 Bacteria 552
436 Ga0501080_0000521 3300049742 Bacteria 30252
437 Ga0501080_1067118 3300049742 Bacteria 698
438 Ga0501080_1817516 3300049742 Bacteria 512
439 Ga0501083_0005268 3300049744 Bacteria 9151
440 Ga0501035_0002020 3300049822 Bacteria 20228
441 Ga0501035_0149630 3300049822 Bacteria 2026
442 Ga0501035_0443200 3300049822 Bacteria 1075
443 Ga0501035_0448001 3300049822 Bacteria 1068
444 Ga0501035_1215058 3300049822 Bacteria 584
445 Ga0501044_0000521 3300049823 Bacteria 46867
446 Ga0501044_0026778 3300049823 Bacteria 6101
447 Ga0501044_0123083 3300049823 Bacteria 2593
448 Ga0501044_0424641 3300049823 Bacteria 1239
449 Ga0501044_1659498 3300049823 Bacteria 504
450 Ga0501045_0153506 3300049824 Bacteria 1713
451 Ga0501045_1185939 3300049824 Bacteria 557
452 nmdc:mga03n38_115656_c2 3300050490 Bacteria 982
453 nmdc:mga0yw44_377863_c1 3300050492 Bacteria 956
454 nmdc:mga0yw44_877983_c1 3300050492 Bacteria 608
455 nmdc:mga06z11_1029011_c1 3300050494 Bacteria 502
456 nmdc:mga06z11_828714_c1 3300050494 Bacteria 564
457 nmdc:mga04h51_202455_c1 3300050495 Bacteria 780
458 nmdc:mga07m45_45720_c1 3300050496 Bacteria 2458
459 nmdc:mga0sz30_119956_c1 3300050516 Bacteria 1155
460 nmdc:mga0sz30_222339_c1 3300050516 Bacteria 839
461 Ga0500635_0000066 3300053080 Bacteria 69274
462 Ga0500635_0287990 3300053080 Bacteria 647
463 Ga0500643_000124 3300053087 Bacteria 79663
464 Ga0500651_0000041 3300053093 Bacteria 88035
465 Ga0500554_064467 3300053102 Bacteria 1182
466 Ga0500556_0000008 3300053104 Bacteria 304943
467 Ga0500621_078124 3300053126 Bacteria 1329
468 Ga0500559_0003211 3300053136 Bacteria 8130
469 Ga0500559_0094582 3300053136 Bacteria 1371
470 Ga0500559_0219151 3300053136 Bacteria 897
471 Ga0500559_0309870 3300053136 Bacteria 741
472 Ga0500564_171835 3300053138 Bacteria 910
473 Ga0500568_0000003 3300053139 Bacteria 863587
474 Ga0500568_0000099 3300053139 Bacteria 80197
475 Ga0500568_0004949 3300053139 Bacteria 7000
476 Ga0500573_0000005 3300053140 Bacteria 315762
477 Ga0500573_0006885 3300053140 Bacteria 6169
478 Ga0500573_0055933 3300053140 Bacteria 2264
479 Ga0500573_0076953 3300053140 Bacteria 1899
480 Ga0500573_0082408 3300053140 Bacteria 1827
481 Ga0500573_0270772 3300053140 Bacteria 864
482 Ga0500577_0137857 3300053142 Bacteria 1027
483 Ga0500590_358440 3300053148 Bacteria 517
484 Ga0500616_0000010 3300053153 Bacteria 761410
485 Ga0500620_000160 3300053155 Bacteria 13526
486 Ga0500636_0464816 3300053177 Bacteria 568
487 Ga0501084_0102278 3300054114 Bacteria 2406
488 Ga0501082_1189493 3300060353 Bacteria 666
489 Ga0466962_0335568 3300061719 Bacteria 751
490 2753300165 2751185788 Bacteria 4541048
491 2844844351 2844841374 Bacteria 3917147
492 2852643969 2852643534 Bacteria 3013378
493 2904432155 2904430863 Bacteria 3486923
494 2904502060 2904501621 Bacteria 3401437
495 2908677833 2908674828 Bacteria 3382763
496 2909076378 2909074476 Bacteria 3436050
497 2919040347 2919039151 Bacteria 3391018
498 2919044431 2919042368 Bacteria 3905917
499 2919056302 2919055335 Bacteria 3875751
500 2919526303 2919523602 Bacteria 3788128
501 2928105721 2928104781 Bacteria 3877447
502 2928154434 2928153084 Bacteria 4020257
503 2928502505 2928500415 Bacteria 3384541
504 2984552226 2984551494 Bacteria 3877562
505 8057346638 8057345674 Bacteria 4160394
506 Ga0070658_10000065
507 JGI24740J21852_10018873
508 JGI24740J21852_10132270
509 JGI24739J22299_10051332
510 JGI24739J22299_10055218
511 JGI24737J22298_10002447
512 JGI24735J21928_10030800
513 JGI25162J39368_1009301
514 JGI25164J39214_1000299
515 JGI25165J46597_1000005
516 rootH2_10026753
517 rootH2_10207306
518 rootL2_10153718
519 rootH1_10201160
520 Ga0006562J51391_1045993
521 Ga0006562J51391_1045994
522 Ga0055539_1000060
523 Ga0055539_1002686
524 Ga0055533_1000002
525 Ga0055532_1007802
526 Ga0055525_1000683
527 Ga0055527_1000004
528 Ga0055542_1000019
529 Ga0055529_1000008
530 Ga0055541_1001479
531 Ga0070658_10077964
532 Ga0070658_10207526
533 Ga0070683_102167241
534 Ga0070670_100072877
535 Ga0068869_101332352
536 Ga0070680_101569999
537 Ga0070682_100571498
538 Ga0070682_100911386
539 Ga0068868_100015383
540 Ga0070661_100138094
541 Ga0070671_100025022
542 Ga0070659_100010637
543 Ga0070667_100064353
544 Ga0070714_100262353
545 Ga0070714_101631736
546 Ga0070708_100461611
547 Ga0070663_100168300
548 Ga0070663_101523462
549 Ga0070678_100753440
550 Ga0070685_10012953
551 Ga0070679_101333974
552 Ga0068853_100011624
553 Ga0068853_100187070
554 Ga0070672_100015768
555 Ga0070665_102622320
556 Ga0068855_100001284
557 Ga0068855_100025736
558 Ga0068855_100113293
559 Ga0068855_100173810
560 Ga0068855_100175471
561 Ga0068855_100372245
562 Ga0068857_100006665
563 Ga0068857_100534731
564 Ga0068857_100762947
565 Ga0068854_100624422
566 Ga0068856_100085089
567 Ga0068856_100236424
568 Ga0068856_100269425
569 Ga0068856_100388264
570 Ga0068856_100487274
571 Ga0068852_100115576
572 Ga0068852_100208541
573 Ga0068864_100168976
574 Ga0068851_10000053
575 Ga0068851_11114356
576 Ga0068863_100029030
577 Ga0068863_100052986
578 Ga0068858_100000176
579 Ga0068858_101998311
580 Ga0075365_10010587
581 Ga0075368_10395784
582 Ga0075368_10505343
583 Ga0075367_10246678
584 Ga0075367_10668316
585 Ga0075367_10737448
586 Ga0075369_10165212
587 Ga0075370_10208675
588 Ga0075370_10849511
589 Ga0068871_100477021
590 Ga0105251_10378118
591 Ga0105240_10007542
592 Ga0105240_10036834
593 Ga0105240_10345709
594 Ga0105240_10625144
595 Ga0105245_10004574
596 Ga0105245_10053417
597 Ga0105247_10008688
598 Ga0105247_10458874
599 Ga0105247_10617420
600 Ga0105243_11238484
601 Ga0105243_11612078
602 Ga0105241_10005110
603 Ga0105241_10285393
604 Ga0105241_10379961
605 Ga0105241_11233952
606 Ga0105242_11732596
607 Ga0105248_10001620
608 Ga0105248_10103795
609 Ga0105248_13187540
610 Ga0105237_10004244
611 Ga0105237_10045306
612 Ga0105237_10058463
613 Ga0105237_10511221
614 Ga0105237_11400428
615 Ga0105237_11700971
616 Ga0105238_10083363
617 Ga0105238_10137493
618 Ga0105238_10154123
619 Ga0105238_10776511
620 Ga0105238_11068962
621 Ga0105249_11480287
622 Ga0105239_10141585
623 Ga0105239_10199544
624 Ga0105239_10760980
625 Ga0105246_10333172
626 Ga0157371_10001247
627 Ga0157371_10463970
628 Ga0157371_11085470
629 Ga0157370_10013223
630 Ga0157370_10018974
631 Ga0157370_10508306
632 Ga0157370_10728522
633 Ga0157370_11070186
634 Ga0157370_11992430
635 Ga0157369_10000615
636 Ga0157369_10058255
637 Ga0157369_10122636
638 Ga0157369_10613682
639 Ga0157369_10915707
640 Ga0157369_11216979
641 Ga0157369_12130701
642 Ga0157369_12287073
643 Ga0157374_10130613
644 Ga0157374_12929987
645 Ga0163162_10991339
646 Ga0163162_13376944
647 Ga0157372_10141543
648 Ga0157372_10467076
649 Ga0157372_10483198
650 Ga0157375_10335678
651 Ga0157375_12502816
652 Ga0163163_10002981
653 Ga0163163_13021499
654 Ga0157380_10172269
655 Ga0157380_11642840
656 Ga0157380_12070562
657 Ga0157379_10002984
658 Ga0157376_10074067
659 Ga0157376_10096336
660 Ga0206354_11070239
661 Ga0206353_10801333
662 Ga0154015_1341444
663 Ga0209566_100013
664 Ga0209674_100001
665 Ga0209672_100011
666 Ga0209147_100289
667 Ga0209563_100001
668 Ga0209563_100158
669 Ga0207427_100024
670 Ga0209437_100243
671 Ga0209258_103433
672 Ga0209677_100001
673 Ga0209677_102441
674 Ga0209148_1000023
675 Ga0209129_1020496
676 Ga0209233_1000001
677 Ga0209455_1000023
678 Ga0209455_1006498
679 Ga0207692_10706798
680 Ga0207710_10025456
681 Ga0207647_10006645
682 Ga0207647_10064390
683 Ga0207647_10502298
684 Ga0207705_10000001
685 Ga0207705_10101366
686 Ga0207705_10264607
687 Ga0207695_10001399
688 Ga0207695_10633267
689 Ga0207671_10046931
690 Ga0207671_10453150
691 Ga0207671_11349099
692 Ga0207671_11607682
693 Ga0207657_10023110
694 Ga0207694_10139044
695 Ga0207694_10399718
696 Ga0207650_10990721
697 Ga0207687_10005067
698 Ga0207664_11130722
699 Ga0207644_10120243
700 Ga0207690_10000757
701 Ga0207709_10463252
702 Ga0207711_10004219
703 Ga0207689_11188445
704 Ga0207667_10000498
705 Ga0207667_10051989
706 Ga0207667_10092820
707 Ga0207667_10132507
708 Ga0207667_11111539
709 Ga0207640_10288095
710 Ga0207658_11183861
711 Ga0207703_10000121
712 Ga0207639_10003956
713 Ga0207639_10119634
714 Ga0207639_11609914
715 Ga0207678_10012731
716 Ga0207678_10991801
717 Ga0207678_11055650
718 Ga0207702_10100697
719 Ga0207702_10241371
720 Ga0207702_10413940
721 Ga0207641_10333146
722 Ga0207674_10382137
723 Ga0207674_11514431
724 Ga0207675_100765663
725 Ga0207683_11980714
726 Ga0207698_10281560
727 Ga0209813_10175831
728 Ga0268266_11775312
729 Ga0268265_12285084
730 Ga0307513_10368173
731 Ga0307513_10369502
732 Ga0307509_10745319
733 Ga0307514_10017602
734 Ga0307514_10035893
735 Ga0307514_10399306
736 Ga0307514_10411957
737 Ga0307405_11484469
738 Ga0307413_11240145
739 Ga0307518_10343727
740 Ga0395899_0003191
741 Ga0395899_0018016
742 Ga0395900_0000888
743 Ga0395898_0000355
744 Ga0395901_0691061
745 Ga0451789_0519420
746 Ga0451791_0189905
747 Ga0451791_0242384
748 Ga0451791_1676698
749 Ga0451793_1024107
750 Ga0451793_1440237
751 Ga0451793_1530252
752 Ga0451797_0983294
753 Ga0451795_0060667
754 Ga0451800_0899573
755 Ga0451802_1176402
756 Ga0451804_0482329
757 Ga0451807_0044788
758 Ga0451833_0791961
759 Ga0451839_0045750
760 Ga0451843_0603848
761 Ga0451853_3653965
762 Ga0439462_0041011
763 Ga0466969_0331208
764 Ga0466972_0017901
765 Ga0466972_0028650
766 Ga0466972_0090984
767 Ga0466972_0104186
768 Ga0466965_0028442
769 Ga0466965_0073324
770 Ga0466966_0103332
771 Ga0466966_0213571
772 Ga0466961_0031224
773 Ga0466961_0143049
774 Ga0466971_0171036
775 Ga0466971_0180155
776 Ga0466971_0240124
777 Ga0466968_0098542
778 Ga0466968_0136789
779 Ga0466970_0010248
780 Ga0466970_0014190
781 Ga0466970_0069971
782 Ga0466970_0105538
783 Ga0466970_0127256
784 Ga0466970_0137768
785 Ga0466970_0332133
786 Ga0466970_0665834
787 Ga0466957_0002577
788 Ga0466957_0238795
789 Ga0466957_0950971
790 Ga0466960_0008850
791 Ga0466960_0017114
792 Ga0466960_0414042
793 Ga0466959_0018906
794 Ga0466959_0026535
795 Ga0466958_0730003
796 Ga0495590_0000502
797 Ga0495650_0000211
798 Ga0495606_0383277
799 Ga0495644_0154990
800 Ga0495609_0164554
801 Ga0495656_0042012
802 Ga0495589_0347880
803 Ga0495672_0293824
804 Ga0495672_0351024
805 Ga0495686_0089180
806 Ga0495686_0376603
807 Ga0495615_0167079
808 Ga0495626_0023911
809 Ga0496100_0145759
810 Ga0496100_0321682
811 Ga0496101_0234133
812 Ga0496101_0285977
813 Ga0496102_0055201
814 Ga0496102_0088326
815 Ga0496102_0251146
816 Ga0496103_0017715
817 Ga0496103_0409681
818 Ga0496103_0418684
819 Ga0496104_0273640
820 Ga0496105_0067335
821 Ga0496105_0278406
822 Ga0496105_0435703
823 Ga0496106_0389674
824 Ga0496107_0108381
825 Ga0496107_0270904
826 Ga0496114_0227693
827 Ga0496114_0350518
828 Ga0496114_0700586
829 Ga0496114_1160220
830 Ga0496115_0018850
831 Ga0496115_0047724
832 Ga0496115_0230863
833 Ga0496115_0633900
834 Ga0496117_0000184
835 Ga0496117_0000239
836 Ga0496117_0007338
837 Ga0496117_0159654
838 Ga0496117_0493710
839 Ga0496118_0000985
840 Ga0496118_0002061
841 Ga0496118_0399653
842 Ga0496119_0000553
843 Ga0496119_0065088
844 Ga0496119_0121542
845 Ga0496119_0210436
846 Ga0496119_0238498
847 Ga0496119_0342212
848 Ga0496120_0071349
849 Ga0496120_0089384
850 Ga0496120_0294732
851 Ga0496120_0353758
852 Ga0496120_0381539
853 Ga0496121_0000046
854 Ga0496121_0138398
855 Ga0496121_0172910
856 Ga0496121_0807464
857 Ga0496121_0857966
858 Ga0496122_0002555
859 Ga0496122_0008548
860 Ga0496123_0017813
861 Ga0496123_0019884
862 Ga0496123_0206963
863 Ga0496124_0000090
864 Ga0496124_0055321
865 Ga0496124_0198998
866 Ga0496124_0266967
867 Ga0496126_0204062
868 Ga0496126_0240993
869 Ga0496126_0610874
870 Ga0496126_1287342
871 Ga0501031_0047180
872 Ga0501032_0008462
873 Ga0501032_0018532
874 Ga0501032_0051997
875 Ga0501032_0055687
876 Ga0501032_0081487
877 Ga0501033_0003572
878 Ga0501033_0094000
879 Ga0501033_0635125
880 Ga0501034_0002069
881 Ga0501034_0013349
882 Ga0501034_0048738
883 Ga0501034_0067816
884 Ga0501034_0086352
885 Ga0501034_0110448
886 Ga0501034_0261430
887 Ga0501034_0312956
888 Ga0501034_0319253
889 Ga0501034_0971178
890 Ga0501034_1064967
891 Ga0501036_0162336
892 Ga0501036_0219950
893 Ga0501036_0268024
894 Ga0501036_0394544
895 Ga0501037_0008696
896 Ga0501037_0018977
897 Ga0501037_0030933
898 Ga0501037_0047434
899 Ga0501037_0063217
900 Ga0501037_0177569
901 Ga0501038_0008304
902 Ga0501038_0010718
903 Ga0501038_0036160
904 Ga0501038_0216041
905 Ga0501038_0327021
906 Ga0501038_0766442
907 Ga0501038_1162550
908 Ga0501039_0004737
909 Ga0501039_0345402
910 Ga0501039_0511693
911 Ga0501042_0099641
912 Ga0501043_0002406
913 Ga0501043_0024245
914 Ga0501043_0059385
915 Ga0501043_0080079
916 Ga0501043_0137611
917 Ga0501043_0639161
918 Ga0501046_0001009
919 Ga0501046_0853322
920 Ga0501047_0098788
921 Ga0501047_0110875
922 Ga0501047_0307833
923 Ga0501047_0401594
924 Ga0501048_0003662
925 Ga0501048_0522901
926 Ga0501068_0831294
927 Ga0501070_0000269
928 Ga0501070_0041237
929 Ga0501070_0044738
930 Ga0501070_0253105
931 Ga0501071_0002444
932 Ga0501071_0570256
933 Ga0501071_1093817
934 Ga0501072_0444719
935 Ga0501072_0651183
936 Ga0501073_0055893
937 Ga0501073_0085544
938 Ga0501073_0131347
939 Ga0501073_0529368
940 Ga0501077_0953086
941 Ga0501080_0000521
942 Ga0501080_1067118
943 Ga0501080_1817516
944 Ga0501083_0005268
945 Ga0501035_0002020
946 Ga0501035_0149630
947 Ga0501035_0443200
948 Ga0501035_0448001
949 Ga0501035_1215058
950 Ga0501044_0000521
951 Ga0501044_0026778
952 Ga0501044_0123083
953 Ga0501044_0424641
954 Ga0501044_1659498
955 Ga0501045_0153506
956 Ga0501045_1185939
957 nmdc:mga03n38_115656_c2
958 nmdc:mga0yw44_377863_c1
959 nmdc:mga0yw44_877983_c1
960 nmdc:mga06z11_1029011_c1
961 nmdc:mga06z11_828714_c1
962 nmdc:mga04h51_202455_c1
963 nmdc:mga07m45_45720_c1
964 nmdc:mga0sz30_119956_c1
965 nmdc:mga0sz30_222339_c1
966 Ga0500635_0000066
967 Ga0500635_0287990
968 Ga0500643_000124
969 Ga0500651_0000041
970 Ga0500554_064467
971 Ga0500556_0000008
972 Ga0500621_078124
973 Ga0500559_0003211
974 Ga0500559_0094582
975 Ga0500559_0219151
976 Ga0500559_0309870
977 Ga0500564_171835
978 Ga0500568_0000003
979 Ga0500568_0000099
980 Ga0500568_0004949
981 Ga0500573_0000005
982 Ga0500573_0006885
983 Ga0500573_0055933
984 Ga0500573_0076953
985 Ga0500573_0082408
986 Ga0500573_0270772
987 Ga0500577_0137857
988 Ga0500590_358440
989 Ga0500616_0000010
990 Ga0500620_000160
991 Ga0500636_0464816
992 Ga0501084_0102278
993 Ga0501082_1189493
994 Ga0466962_0335568
995 2753300165
996 2844844351
997 2852643969
998 2904432155
999 2904502060
1000 2908677833
1001 2909076378
1002 2919040347
1003 2919044431
1004 2919056302
1005 2919526303
1006 2928105721
1007 2928154434
1008 2928502505
1009 2984552226
1010 8057346638

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06781

CrgA

Cell division protein CrgA

1

82

0.87

Map