F456238

General Info

Members Datasets Scaffolds Average Seq Length
504 311 1008 307

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0006505|Ga0495629_0006505_5281_6297
Length 333
Sequence MATMPLHRLNSLVIGVPNVEETAAYYRDFGLVRDHAGWFATRDGGRQLKIVYAPTRRLVEISIGVDDADDLERISARLTALDLRVKRDDSALVTEEPVAGFRAVVRVADRIHQDREPPTPYNGPGRLERSNGRAPGVLRQQPVRPRKLGHVVIGSVDHLATMRFFTEGLGFRTSDYIKDHGAFLRCSTDHHNVLVLGAPVNFLHHTSWQVEDVDEVGRGASAMLEDHPDRHVWGLGRHHAGSNFFWYLKDPAGNFSEYYSDMDCVVDDQLWTPEVLDGVKGLFNWGPFLRPDDLAALMTGAHHADEPVRADPPRTPGLQEVDRPCPPSTPTCW

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
97 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
168 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
169 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
170 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
171 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
174 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
175 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
183 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
184 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
185 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
186 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
187 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
188 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
189 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
194 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
195 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
203 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
215 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
287 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
290 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
291 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
292 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
293 2558860280 Kutzneria sp. 744 Isolate Unclassified
294 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
295 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
296 2687453737 Frankia sp. BMG5.36 Isolate Nodule
297 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
298 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
299 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
300 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
301 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
302 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
303 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
304 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
305 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
306 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
307 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
308 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
309 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
310 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
311 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.45
Metatranscriptomes 0.6
Isolates 5.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.38
Nodule 0.2
Rhizoplane 3.57
Rhizosphere 87.1
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0006505 3300046459 Bacteria 8658
2 JGI24735J21928_10050790 3300002067 Bacteria 1197
3 JGI24738J21930_10004753 3300002075 Bacteria 3304
4 JGI24749J21850_1001934 3300002076 Bacteria 2928
5 JGI24744J21845_10001261 3300002077 Plasmid 4984
6 JGI24034J26672_10008099 3300002239 Bacteria 1531
7 JGI24742J22300_10001195 3300002244 Plasmid 4053
8 Ga0055540_1005559 3300003792 Bacteria 5260
9 Ga0070676_10005427 3300005328 Bacteria 6794
10 Ga0070683_100246971 3300005329 Bacteria 1697
11 Ga0070690_100067753 3300005330 Bacteria 2313
12 Ga0070690_100077242 3300005330 Bacteria 2173
13 Ga0068869_100007380 3300005334 Bacteria 7021
14 Ga0070666_10012443 3300005335 Bacteria 5368
15 Ga0070666_10176088 3300005335 Bacteria 1499
16 Ga0070680_100066484 3300005336 Bacteria 2956
17 Ga0070682_100011796 3300005337 Plasmid 4999
18 Ga0070682_100292298 3300005337 Bacteria 1192
19 Ga0068868_100011591 3300005338 Bacteria 6422
20 Ga0070660_100190663 3300005339 Bacteria 1660
21 Ga0070660_100244382 3300005339 Bacteria 1462
22 Ga0070689_100019411 3300005340 Bacteria 5027
23 Ga0070691_10001518 3300005341 Bacteria 9974
24 Ga0070687_100013097 3300005343 Bacteria 3684
25 Ga0070669_100029622 3300005353 Bacteria 3947
26 Ga0070671_100045833 3300005355 Plasmid 3635
27 Ga0070688_100050835 3300005365 Bacteria 2583
28 Ga0070659_100040225 3300005366 Bacteria 3652
29 Ga0070667_100002258 3300005367 Bacteria 16963
30 Ga0070667_100013758 3300005367 Bacteria 6690
31 Ga0070667_100115551 3300005367 Bacteria 2331
32 Ga0070667_100248769 3300005367 Bacteria 1589
33 Ga0070709_10015261 3300005434 Bacteria 4367
34 Ga0070709_10047658 3300005434 Plasmid 2670
35 Ga0070709_10141269 3300005434 Bacteria 1655
36 Ga0070709_10213619 3300005434 Bacteria 1372
37 Ga0070714_100000848 3300005435 Bacteria 21679
38 Ga0070714_100053635 3300005435 Bacteria 3442
39 Ga0070714_100135875 3300005435 Bacteria 2202
40 Ga0070714_100389312 3300005435 Bacteria 1315
41 Ga0070714_100420851 3300005435 Bacteria 1265
42 Ga0070713_100267171 3300005436 Bacteria 1565
43 Ga0070713_100381447 3300005436 Bacteria 1313
44 Ga0070710_10178935 3300005437 Bacteria 1326
45 Ga0070711_100039789 3300005439 Bacteria 3168
46 Ga0070711_100135227 3300005439 Bacteria 1841
47 Ga0070711_100242633 3300005439 Bacteria 1409
48 Ga0070705_100014461 3300005440 Plasmid 4060
49 Ga0070705_100049441 3300005440 Bacteria 2441
50 Ga0070700_100051190 3300005441 Bacteria 2570
51 Ga0070694_100003657 3300005444 Bacteria 9170
52 Ga0070694_100043634 3300005444 Bacteria 2999
53 Ga0070694_100072798 3300005444 Bacteria 2371
54 Ga0070708_100000610 3300005445 Bacteria 26932
55 Ga0070708_100058354 3300005445 Bacteria 3438
56 Ga0070663_100017792 3300005455 Plasmid 4647
57 Ga0070663_100104948 3300005455 Bacteria 2114
58 Ga0070678_100041199 3300005456 Bacteria 3272
59 Ga0070662_100003400 3300005457 Bacteria 9924
60 Ga0068867_100004377 3300005459 Bacteria 9945
61 Ga0070685_10006147 3300005466 Bacteria 6115
62 Ga0070707_100045618 3300005468 Bacteria 4195
63 Ga0070707_100085745 3300005468 Bacteria 3044
64 Ga0070698_100006091 3300005471 Bacteria 13137
65 Ga0070698_100020828 3300005471 Bacteria 6872
66 Ga0070698_100021363 3300005471 Bacteria 6781
67 Ga0070698_100051196 3300005471 Bacteria 4207
68 Ga0070698_100202464 3300005471 Bacteria 1920
69 Ga0070699_100028540 3300005518 Bacteria 4812
70 Ga0070679_100323752 3300005530 Bacteria 1490
71 Ga0070684_100078520 3300005535 Bacteria 2917
72 Ga0070697_100079605 3300005536 Plasmid 2698
73 Ga0070697_100235739 3300005536 Bacteria 1562
74 Ga0068853_100008593 3300005539 Bacteria 8210
75 Ga0068853_100061302 3300005539 Bacteria 3253
76 Ga0070672_100031560 3300005543 Plasmid 3989
77 Ga0070695_100023182 3300005545 Bacteria 3812
78 Ga0070696_100171652 3300005546 Bacteria 1603
79 Ga0070696_100201664 3300005546 Bacteria 1485
80 Ga0070693_100010079 3300005547 Bacteria 4718
81 Ga0070693_100100343 3300005547 Bacteria 1762
82 Ga0070665_100020333 3300005548 Bacteria 6667
83 Ga0068855_100046090 3300005563 Bacteria 5154
84 Ga0070702_100010415 3300005615 Bacteria 4579
85 Ga0070702_100087540 3300005615 Bacteria 1881
86 Ga0068852_100185814 3300005616 Bacteria 1957
87 Ga0068859_100024989 3300005617 Bacteria 5996
88 Ga0068859_100422296 3300005617 Bacteria 1429
89 Ga0068864_100373504 3300005618 Bacteria 1350
90 Ga0068864_100544262 3300005618 Bacteria 1121
91 Ga0068866_10004625 3300005718 Bacteria 5643
92 Ga0068861_100001942 3300005719 Bacteria 13321
93 Ga0068861_100138036 3300005719 Bacteria 1986
94 Ga0068863_100306613 3300005841 Bacteria 1540
95 Ga0068863_100761995 3300005841 Bacteria 964
96 Ga0068858_100018817 3300005842 Bacteria 6463
97 Ga0068860_100010478 3300005843 Bacteria 9163
98 Ga0068862_100007287 3300005844 Bacteria 9181
99 Ga0068862_100317923 3300005844 Bacteria 1436
100 Ga0068862_100387905 3300005844 Bacteria 1304
101 Ga0081540_1001743 3300005983 Bacteria 18315
102 Ga0070717_10073802 3300006028 Bacteria 2852
103 Ga0070717_10422970 3300006028 Bacteria 1198
104 Ga0075363_100053748 3300006048 Bacteria 2153
105 Ga0075364_10000532 3300006051 Bacteria 19421
106 Ga0070716_100032712 3300006173 Plasmid 2839
107 Ga0070716_100097758 3300006173 Bacteria 1792
108 Ga0070716_100165802 3300006173 Bacteria 1436
109 Ga0070712_100252724 3300006175 Bacteria 1409
110 Ga0070712_100374689 3300006175 Bacteria 1170
111 Ga0075362_10014268 3300006177 Bacteria 3202
112 Ga0075369_10010946 3300006186 Bacteria 3557
113 Ga0068871_100026196 3300006358 Bacteria 4548
114 Ga0075428_100000480 3300006844 Bacteria 40190
115 Ga0075430_100009302 3300006846 Bacteria 8306
116 Ga0075431_100009969 3300006847 Bacteria 9544
117 Ga0075433_10035855 3300006852 Bacteria 4269
118 Ga0075433_10379005 3300006852 Bacteria 1249
119 Ga0075434_100000775 3300006871 Bacteria 25303
120 Ga0068865_100028789 3300006881 Bacteria 3680
121 Ga0068865_100125621 3300006881 Bacteria 1914
122 Ga0075436_100047661 3300006914 Bacteria 2956
123 Ga0075436_100073799 3300006914 Bacteria 2362
124 Ga0075436_100261763 3300006914 Bacteria 1233
125 Ga0097620_100024988 3300006931 Bacteria 5996
126 Ga0097620_100422283 3300006931 Bacteria 1429
127 Ga0075435_100001754 3300007076 Bacteria 14118
128 Ga0075435_100129144 3300007076 Bacteria 2114
129 Ga0105250_10075868 3300009092 Bacteria 1360
130 Ga0105240_10398695 3300009093 Bacteria 1550
131 Ga0105245_10000724 3300009098 Bacteria 29719
132 Ga0105245_10023797 3300009098 Bacteria 5377
133 Ga0105247_10001484 3300009101 Bacteria 16875
134 Ga0114129_10015527 3300009147 Bacteria 10827
135 Ga0105243_10003143 3300009148 Bacteria 13555
136 Ga0105243_10071648 3300009148 Bacteria 2803
137 Ga0105241_10019461 3300009174 Bacteria 5006
138 Ga0105242_10023150 3300009176 Plasmid 4896
139 Ga0105248_10007131 3300009177 Bacteria 12251
140 Ga0105237_10028260 3300009545 Bacteria 5715
141 Ga0105238_10182255 3300009551 Bacteria 2077
142 Ga0105249_10017452 3300009553 Bacteria 6371
143 Ga0105249_10031362 3300009553 Plasmid 4807
144 Ga0105249_10042666 3300009553 Bacteria 4127
145 Ga0099796_10110927 3300010159 Bacteria 1044
146 Ga0105239_10006105 3300010375 Bacteria 14030
147 Ga0105239_10020617 3300010375 Bacteria 7273
148 Ga0105246_10011576 3300011119 Bacteria 5475
149 Ga0157347_1007746 3300012502 Bacteria 1080
150 Ga0157338_1004305 3300012515 Bacteria 1225
151 Ga0157370_10122936 3300013104 Bacteria 2423
152 Ga0157369_10159857 3300013105 Bacteria 2378
153 Ga0157374_10103526 3300013296 Unclassified 2731
154 Ga0157378_10053804 3300013297 Bacteria 3584
155 Ga0163162_10064639 3300013306 Bacteria 3704
156 Ga0163162_10166153 3300013306 Bacteria 2330
157 Ga0157372_10023114 3300013307 Bacteria 6737
158 Ga0157372_10037579 3300013307 Bacteria 5342
159 Ga0157375_10079834 3300013308 Bacteria 3308
160 Ga0157375_10281344 3300013308 Bacteria 1826
161 Ga0163163_10061639 3300014325 Bacteria 3716
162 Ga0157380_10001550 3300014326 Bacteria 15117
163 Ga0157379_10098597 3300014968 Bacteria 2623
164 Ga0157376_10053805 3300014969 Bacteria 3353
165 Ga0163161_10001490 3300017792 Bacteria 17293
166 Ga0197907_10032160 3300020069 Bacteria 1453
167 Ga0206353_11968973 3300020082 Bacteria 1426
168 Ga0213875_10000736 3300021388 Bacteria 24934
169 Ga0213875_10001023 3300021388 Bacteria 19832
170 Ga0213875_10017094 3300021388 Bacteria 3510
171 Ga0213875_10022651 3300021388 Bacteria 3004
172 Ga0224712_10067133 3300022467 Bacteria 1446
173 Ga0224572_1002553 3300024225 Bacteria 2963
174 Ga0207426_1004126 3300025302 Bacteria 7292
175 Ga0209051_1002588 3300025303 Bacteria 12732
176 Ga0207692_10006237 3300025898 Bacteria 4829
177 Ga0207692_10011827 3300025898 Bacteria 3730
178 Ga0207642_10001843 3300025899 Bacteria 6542
179 Ga0207710_10009802 3300025900 Bacteria 4027
180 Ga0207688_10003096 3300025901 Bacteria 9083
181 Ga0207688_10003757 3300025901 Bacteria 8283
182 Ga0207680_10087010 3300025903 Bacteria 1977
183 Ga0207680_10184178 3300025903 Bacteria 1414
184 Ga0207647_10035585 3300025904 Bacteria 3172
185 Ga0207647_10047370 3300025904 Bacteria 2674
186 Ga0207685_10043536 3300025905 Bacteria 1692
187 Ga0207685_10136529 3300025905 Bacteria 1095
188 Ga0207699_10028254 3300025906 Bacteria 3115
189 Ga0207699_10080232 3300025906 Bacteria 2021
190 Ga0207699_10143355 3300025906 Bacteria 1572
191 Ga0207645_10071501 3300025907 Bacteria 2220
192 Ga0207654_10051890 3300025911 Bacteria 2362
193 Ga0207693_10041892 3300025915 Bacteria 3604
194 Ga0207693_10259052 3300025915 Bacteria 1364
195 Ga0207663_10016818 3300025916 Bacteria 4066
196 Ga0207660_10099677 3300025917 Bacteria 2168
197 Ga0207662_10014703 3300025918 Bacteria 4394
198 Ga0207657_10009522 3300025919 Bacteria 9756
199 Ga0207657_10029978 3300025919 Bacteria 4944
200 Ga0207649_10053478 3300025920 Bacteria 2509
201 Ga0207646_10117743 3300025922 Bacteria 2386
202 Ga0207681_10004956 3300025923 Bacteria 8180
203 Ga0207694_10138934 3300025924 Bacteria 1953
204 Ga0207687_10006161 3300025927 Bacteria 7935
205 Ga0207700_10085135 3300025928 Bacteria 2480
206 Ga0207700_10239984 3300025928 Bacteria 1544
207 Ga0207700_10243960 3300025928 Bacteria 1532
208 Ga0207664_10144434 3300025929 Bacteria 2016
209 Ga0207664_10147936 3300025929 Bacteria 1993
210 Ga0207664_10168979 3300025929 Bacteria 1870
211 Ga0207664_10203924 3300025929 Bacteria 1708
212 Ga0207644_10017976 3300025931 Plasmid 4781
213 Ga0207706_10003178 3300025933 Bacteria 15786
214 Ga0207686_10046457 3300025934 Bacteria 2678
215 Ga0207709_10001631 3300025935 Bacteria 15260
216 Ga0207669_10000609 3300025937 Bacteria 15535
217 Ga0207704_10003109 3300025938 Bacteria 7502
218 Ga0207665_10007258 3300025939 Bacteria 7331
219 Ga0207665_10114963 3300025939 Bacteria 1895
220 Ga0207665_10142802 3300025939 Bacteria 1709
221 Ga0207665_10148528 3300025939 Bacteria 1677
222 Ga0207711_10004074 3300025941 Bacteria 12541
223 Ga0207711_10539416 3300025941 Bacteria 1088
224 Ga0207689_10067729 3300025942 Bacteria 2934
225 Ga0207667_10022043 3300025949 Bacteria 7048
226 Ga0207712_10009169 3300025961 Bacteria 6263
227 Ga0207668_10004500 3300025972 Bacteria 8191
228 Ga0207640_10013768 3300025981 Bacteria 4644
229 Ga0207640_10210003 3300025981 Bacteria 1482
230 Ga0207658_10001362 3300025986 Bacteria 19081
231 Ga0207658_10107772 3300025986 Bacteria 2196
232 Ga0207677_10009414 3300026023 Bacteria 5499
233 Ga0207703_10003392 3300026035 Bacteria 13382
234 Ga0207678_10002949 3300026067 Bacteria 15411
235 Ga0207678_10344618 3300026067 Bacteria 1284
236 Ga0207708_10002633 3300026075 Bacteria 13204
237 Ga0207641_10626443 3300026088 Bacteria 1055
238 Ga0207648_10003318 3300026089 Bacteria 16899
239 Ga0207648_10528164 3300026089 Bacteria 1082
240 Ga0207676_10637837 3300026095 Bacteria 1027
241 Ga0207674_10119813 3300026116 Bacteria 2600
242 Ga0207675_100000881 3300026118 Bacteria 29943
243 Ga0207675_100152776 3300026118 Bacteria 2198
244 Ga0207683_10003537 3300026121 Bacteria 13624
245 Ga0207698_10122289 3300026142 Bacteria 2205
246 Ga0207698_10173741 3300026142 Bacteria 1900
247 Ga0268266_10052195 3300028379 Plasmid 3511
248 Ga0268265_10019406 3300028380 Bacteria 4725
249 Ga0268265_10349350 3300028380 Bacteria 1350
250 Ga0268264_10006302 3300028381 Bacteria 10003
251 Ga0268264_10028139 3300028381 Bacteria 4596
252 Ga0268264_10250424 3300028381 Bacteria 1645
253 Ga0265337_1000196 3300028556 Bacteria 31946
254 Ga0265326_10002284 3300028558 Bacteria 6482
255 Ga0265319_1016966 3300028563 Bacteria 2781
256 Ga0265334_10001485 3300028573 Bacteria 11306
257 Ga0265336_10001333 3300028666 Bacteria 11499
258 Ga0265338_10001331 3300028800 Bacteria 40306
259 Ga0265324_10001438 3300029957 Bacteria 13642
260 Ga0307511_10000716 3300030521 Bacteria 35363
261 Ga0307511_10000878 3300030521 Bacteria 31864
262 Ga0307512_10004484 3300030522 Bacteria 15284
263 Ga0265332_10002395 3300031238 Bacteria 9557
264 Ga0265320_10020197 3300031240 Bacteria 3619
265 Ga0265340_10004471 3300031247 Bacteria 7807
266 Ga0307513_10000929 3300031456 Bacteria 42318
267 Ga0307513_10171349 3300031456 Bacteria 2048
268 Ga0307509_10006523 3300031507 Bacteria 15652
269 Ga0265314_10130315 3300031711 Bacteria 1570
270 Ga0265342_10001071 3300031712 Bacteria 26585
271 Ga0307507_10113246 3300033179 Bacteria 2205
272 Ga0307510_10053055 3300033180 Bacteria 4266
273 Ga0373928_0028974 3300035084 Bacteria 1215
274 Ga0373929_0023187 3300035085 Bacteria 1273
275 Ga0373934_0020088 3300035086 Bacteria 2567
276 Ga0373940_0034209 3300035088 Bacteria 1370
277 Ga0373944_0001671 3300035089 Bacteria 5611
278 Ga0373944_0003160 3300035089 Bacteria 4236
279 Ga0373923_0000825 3300035111 Bacteria 8128
280 Ga0373932_0010901 3300035112 Bacteria 2211
281 Ga0373936_0002118 3300035113 Bacteria 7374
282 Ga0373936_0009020 3300035113 Bacteria 3762
283 Ga0373936_0011602 3300035113 Bacteria 3340
284 Ga0373941_0016456 3300035115 Bacteria 2011
285 Ga0373941_0046101 3300035115 Bacteria 1368
286 Ga0373945_0002949 3300035116 Bacteria 5345
287 Ga0373953_0001761 3300035117 Bacteria 6392
288 Ga0373953_0058494 3300035117 Bacteria 1571
289 Ga0373954_0046574 3300035118 Bacteria 2027
290 Ga0373956_0112472 3300035119 Bacteria 1268
291 Ga0373957_0109135 3300035120 Bacteria 1113
292 Ga0373943_0000192 3300035170 Bacteria 24683
293 Ga0373943_0003465 3300035170 Bacteria 7173
294 Ga0373946_0000621 3300035171 Bacteria 11801
295 Ga0373946_0002583 3300035171 Bacteria 6403
296 Ga0373946_0144240 3300035171 Bacteria 1106
297 Ga0373955_0005605 3300035172 Bacteria 5647
298 Ga0373955_0066861 3300035172 Bacteria 1999
299 Ga0373942_0000083 3300035207 Bacteria 20513
300 Ga0373942_0054546 3300035207 Bacteria 1130
301 Ga0373961_0017073 3300035241 Bacteria 1877
302 Ga0373961_0029012 3300035241 Bacteria 1530
303 Ga0373924_0023624 3300035410 Bacteria 2414
304 Ga0373931_0002199 3300035691 Bacteria 8616
305 Ga0373931_0053549 3300035691 Bacteria 2153
306 Ga0373935_0014898 3300035692 Bacteria 4695
307 Ga0373935_0041107 3300035692 Bacteria 2903
308 Ga0373927_0008768 3300035695 Bacteria 6795
309 Ga0373927_0018961 3300035695 Bacteria 4513
310 Ga0373933_0032792 3300035724 Bacteria 3019
311 Ga0373947_0001383 3300035725 Bacteria 14946
312 Ga0373947_0105364 3300035725 Bacteria 1776
313 Ga0373937_0251406 3300036401 Bacteria 1666
314 Ga0373925_0001884 3300037068 Bacteria 17427
315 Ga0373925_0006172 3300037068 Bacteria 8849
316 Ga0373925_0007489 3300037068 Bacteria 7960
317 Ga0373925_0053104 3300037068 Bacteria 3029
318 Ga0373925_0055061 3300037068 Bacteria 2976
319 Ga0373925_0057156 3300037068 Bacteria 2923
320 Ga0436364_0323940 3300037853 Bacteria 18323
321 Ga0436364_0436054 3300037853 Bacteria 4273
322 Ga0436364_0477471 3300037853 Bacteria 3780
323 Ga0436364_0661034 3300037853 Bacteria 87629
324 Ga0436364_0702496 3300037853 Bacteria 5037
325 Ga0436364_1297797 3300037853 Bacteria 3073
326 Ga0436365_0590242 3300039437 Bacteria 4824
327 Ga0436365_1657937 3300039437 Bacteria 2570
328 Ga0451802_1992721 3300041460 Bacteria 2609
329 Ga0451807_2378228 3300041486 Bacteria 2069
330 Ga0466966_0007044 3300044684 Bacteria 7446
331 Ga0466966_0054157 3300044684 Bacteria 2543
332 Ga0466961_0018791 3300044693 Bacteria 4447
333 Ga0466963_0041645 3300044694 Bacteria 3013
334 Ga0466963_0088180 3300044694 Bacteria 2110
335 Ga0466970_0094453 3300044765 Bacteria 1625
336 Ga0466958_0003428 3300045836 Bacteria 8226
337 Ga0466958_0041248 3300045836 Bacteria 2776
338 Ga0466967_0000477 3300045976 Bacteria 19404
339 Ga0466967_0008577 3300045976 Bacteria 7510
340 Ga0466967_0022784 3300045976 Bacteria 5120
341 Ga0466967_0058078 3300045976 Bacteria 3418
342 Ga0495592_0005093 3300046454 Bacteria 9680
343 Ga0495592_0036240 3300046454 Bacteria 3715
344 Ga0495592_0320193 3300046454 Bacteria 1002
345 Ga0495629_0005480 3300046459 Bacteria 9474
346 Ga0495641_0006675 3300046461 Bacteria 7415
347 Ga0495651_0003821 3300046462 Bacteria 11519
348 Ga0495651_0087391 3300046462 Bacteria 2344
349 Ga0495651_0088128 3300046462 Bacteria 2332
350 Ga0495653_0003616 3300046463 Bacteria 12472
351 Ga0495653_0009517 3300046463 Bacteria 7948
352 Ga0495653_0070776 3300046463 Bacteria 2609
353 Ga0495653_0117177 3300046463 Bacteria 1903
354 Ga0495580_0039749 3300046472 Bacteria 3365
355 Ga0495639_0005706 3300046475 Bacteria 5353
356 Ga0495639_0058655 3300046475 Bacteria 1761
357 Ga0495639_0135365 3300046475 Bacteria 1182
358 Ga0495662_0012643 3300046476 Bacteria 4116
359 Ga0495664_0001073 3300046477 Bacteria 14144
360 Ga0495664_0049812 3300046477 Bacteria 2486
361 Ga0495608_0002553 3300046511 Bacteria 13068
362 Ga0495608_0011522 3300046511 Bacteria 6152
363 Ga0495608_0020456 3300046511 Bacteria 4548
364 Ga0495608_0087418 3300046511 Bacteria 2019
365 Ga0495618_0021034 3300046514 Bacteria 4020
366 Ga0495618_0034695 3300046514 Bacteria 3165
367 Ga0495618_0036904 3300046514 Bacteria 3067
368 Ga0495628_0032526 3300046516 Bacteria 4210
369 Ga0495628_0176967 3300046516 Bacteria 1615
370 Ga0495630_0033012 3300046517 Bacteria 3860
371 Ga0495630_0035702 3300046517 Bacteria 3714
372 Ga0495666_0031261 3300046526 Bacteria 2608
373 Ga0495652_0001274 3300046529 Bacteria 28201
374 Ga0495652_0005312 3300046529 Bacteria 12146
375 Ga0495652_0040179 3300046529 Bacteria 4042
376 Ga0495652_0129625 3300046529 Bacteria 1998
377 Ga0495652_0180700 3300046529 Bacteria 1619
378 Ga0495665_0014228 3300046531 Bacteria 4292
379 Ga0495665_0035079 3300046531 Bacteria 2681
380 Ga0495640_0059287 3300046533 Bacteria 2607
381 Ga0495586_0009028 3300046535 Bacteria 5302
382 Ga0495587_0003105 3300046536 Bacteria 11104
383 Ga0495645_0019343 3300046543 Bacteria 4903
384 Ga0495645_0024103 3300046543 Bacteria 4412
385 Ga0495645_0066351 3300046543 Bacteria 2608
386 Ga0495645_0165600 3300046543 Bacteria 1525
387 Ga0495667_0006111 3300046559 Bacteria 8151
388 Ga0495667_0025502 3300046559 Bacteria 3983
389 Ga0495667_0072615 3300046559 Bacteria 2242
390 Ga0495634_0003200 3300046642 Bacteria 13249
391 Ga0495634_0017511 3300046642 Bacteria 5110
392 Ga0495634_0019278 3300046642 Bacteria 4847
393 Ga0495634_0078743 3300046642 Bacteria 2159
394 Ga0495634_0171677 3300046642 Bacteria 1362
395 Ga0495635_0019358 3300046663 Bacteria 4746
396 Ga0495635_0044048 3300046663 Bacteria 3078
397 Ga0495657_0002590 3300046675 Bacteria 15134
398 Ga0495657_0028300 3300046675 Bacteria 3944
399 Ga0495657_0115755 3300046675 Bacteria 1693
400 Ga0495599_0009771 3300046678 Bacteria 5873
401 Ga0495599_0032641 3300046678 Bacteria 3268
402 Ga0495599_0083715 3300046678 Bacteria 1992
403 Ga0495623_0082467 3300046679 Bacteria 1987
404 Ga0495646_0025239 3300046680 Bacteria 3739
405 Ga0495646_0046090 3300046680 Bacteria 2660
406 Ga0495646_0053635 3300046680 Bacteria 2430
407 Ga0495646_0055266 3300046680 Bacteria 2385
408 Ga0495613_0010570 3300046689 Bacteria 6847
409 Ga0495624_0001336 3300046690 Bacteria 19300
410 Ga0495624_0003128 3300046690 Bacteria 12360
411 Ga0495589_0008676 3300046794 Bacteria 5295
412 Ga0495600_0005339 3300046809 Bacteria 7740
413 Ga0495600_0043553 3300046809 Bacteria 2927
414 Ga0495581_0010150 3300047315 Bacteria 5449
415 Ga0495604_0001464 3300047317 Bacteria 19421
416 Ga0495604_0107071 3300047317 Bacteria 2044
417 Ga0495674_0001776 3300047319 Bacteria 21265
418 Ga0495674_0010210 3300047319 Bacteria 8894
419 Ga0495674_0024721 3300047319 Bacteria 5514
420 Ga0495674_0031131 3300047319 Bacteria 4848
421 Ga0495672_0130916 3300047320 Bacteria 1320
422 Ga0495676_0007291 3300047321 Bacteria 10140
423 Ga0495676_0018236 3300047321 Bacteria 6189
424 Ga0495680_0002196 3300047322 Bacteria 20193
425 Ga0495680_0004825 3300047322 Bacteria 12794
426 Ga0495680_0011976 3300047322 Bacteria 7654
427 Ga0495687_006470 3300047443 Bacteria 7174
428 Ga0495687_033887 3300047443 Bacteria 2312
429 Ga0495675_0006564 3300047444 Bacteria 7125
430 Ga0495684_0000966 3300047471 Bacteria 23426
431 Ga0495684_0024717 3300047471 Bacteria 4620
432 Ga0495684_0061596 3300047471 Bacteria 2854
433 Ga0495593_0003389 3300047673 Bacteria 9548
434 Ga0495593_0098240 3300047673 Bacteria 1503
435 Ga0495602_0031790 3300048088 Bacteria 4983
436 Ga0495602_0064028 3300048088 Bacteria 3182
437 Ga0495614_0002535 3300048089 Bacteria 8119
438 Ga0496101_0015749 3300048904 Bacteria 5103
439 Ga0496102_0015114 3300048905 Bacteria 6720
440 Ga0496103_0005516 3300048906 Bacteria 7566
441 Ga0496104_0051038 3300048907 Bacteria 3903
442 Ga0496106_0056314 3300048909 Unclassified 2971
443 Ga0496107_0006279 3300048910 Bacteria 8169
444 Ga0496108_0270950 3300048911 Bacteria 1478
445 Ga0496108_0488207 3300048911 Bacteria 1076
446 Ga0496109_0254194 3300048912 Bacteria 1655
447 Ga0496114_0018372 3300048917 Bacteria 5653
448 Ga0496115_0000818 3300048918 Bacteria 22830
449 Ga0496115_0330022 3300048918 Bacteria 1246
450 Ga0496115_0360886 3300048918 Bacteria 1184
451 Ga0496115_0379509 3300048918 Bacteria 1150
452 Ga0496119_0150235 3300048922 Bacteria 1249
453 Ga0501042_0288789 3300049578 Bacteria 1185
454 Ga0501072_0323435 3300049588 Bacteria 1226
455 Ga0501044_0170558 3300049823 Bacteria 2148
456 nmdc:mga03683_7829_c1 3300050489 Bacteria 3728
457 nmdc:mga00v17_162_c1 3300050491 Bacteria 38755
458 nmdc:mga00v17_277913_c1 3300050491 Bacteria 1087
459 nmdc:mga05p37_462984_c1 3300050507 Bacteria 1465
460 nmdc:mga0qj67_10848_c1 3300050509 Bacteria 6816
461 nmdc:mga06r32_37662_c1 3300050510 Bacteria 4575
462 nmdc:mga0n895_128165_c1 3300050512 Bacteria 2562
463 nmdc:mga0n895_31161_c1 3300050512 Bacteria 5103
464 nmdc:mga08x19_127256_c1 3300050514 Bacteria 1711
465 nmdc:mga08x19_33405_c1 3300050514 Bacteria 3247
466 nmdc:mga0a205_169598_c1 3300050515 Bacteria 2078
467 nmdc:mga0a205_71413_c1 3300050515 Bacteria 3353
468 nmdc:mga0sz30_1433_c1 3300050516 Bacteria 6343
469 nmdc:mga0sz30_3729_c1 3300050516 Bacteria 5493
470 Ga0495601_0001952 3300053077 Bacteria 11529
471 Ga0495601_0038979 3300053077 Bacteria 2973
472 Ga0495595_0004395 3300053084 Bacteria 5671
473 Ga0495595_0039210 3300053084 Bacteria 2160
474 Ga0466962_0010151 3300061719 Bacteria 4522
475 2523385344 2523231044 Bacteria 6434991
476 2552112160 2551306166 Bacteria 9731570
477 2558914048 2558860112 Bacteria 9931328
478 2559430665 2558860280 Bacteria 11429938
479 2623497831 2622736605 Bacteria 4992138
480 2644491509 2643221687 Bacteria 6500351
481 2689958604 2687453737 Bacteria 11203906
482 2739364037 2738543034 Bacteria 6084756
483 2793975315 2791355406 Bacteria 11364898
484 2793979975 2791355406 Bacteria 11364898
485 2867352480 2867346516 Bacteria 7608576
486 2870785006 2870782633 Bacteria 9624083
487 2873319813 2873314349 Bacteria 8512634
488 2929219331 2929212328 Bacteria 7708288
489 2929219420 2929212328 Bacteria 7708288
490 3003005913 3002998708 Bacteria 11715108
491 3006500519 3006493962 Bacteria 8825450
492 8008488483 8008485437 Bacteria 7198341
493 8025527470 8025524527 Bacteria 7197316
494 8047900335 8047893842 Bacteria 11723082
495 8047900578 8047893842 Bacteria 11723082
496 8048128842 8048127548 Bacteria 11053136
497 8048132132 8048127548 Bacteria 11053136
498 8048133354 8048127548 Bacteria 11053136
499 8048358324 8048356638 Bacteria 11044339
500 8048358562 8048356638 Bacteria 11044339
501 8048377278 8048369669 Bacteria 11666822
502 8048377518 8048369669 Bacteria 11666822
503 8048386370 8048379754 Bacteria 11877923
504 8048386616 8048379754 Bacteria 11877923
505 Ga0495629_0006505
506 JGI24735J21928_10050790
507 JGI24738J21930_10004753
508 JGI24749J21850_1001934
509 JGI24744J21845_10001261
510 JGI24034J26672_10008099
511 JGI24742J22300_10001195
512 Ga0055540_1005559
513 Ga0070676_10005427
514 Ga0070683_100246971
515 Ga0070690_100067753
516 Ga0070690_100077242
517 Ga0068869_100007380
518 Ga0070666_10012443
519 Ga0070666_10176088
520 Ga0070680_100066484
521 Ga0070682_100011796
522 Ga0070682_100292298
523 Ga0068868_100011591
524 Ga0070660_100190663
525 Ga0070660_100244382
526 Ga0070689_100019411
527 Ga0070691_10001518
528 Ga0070687_100013097
529 Ga0070669_100029622
530 Ga0070671_100045833
531 Ga0070688_100050835
532 Ga0070659_100040225
533 Ga0070667_100002258
534 Ga0070667_100013758
535 Ga0070667_100115551
536 Ga0070667_100248769
537 Ga0070709_10015261
538 Ga0070709_10047658
539 Ga0070709_10141269
540 Ga0070709_10213619
541 Ga0070714_100000848
542 Ga0070714_100053635
543 Ga0070714_100135875
544 Ga0070714_100389312
545 Ga0070714_100420851
546 Ga0070713_100267171
547 Ga0070713_100381447
548 Ga0070710_10178935
549 Ga0070711_100039789
550 Ga0070711_100135227
551 Ga0070711_100242633
552 Ga0070705_100014461
553 Ga0070705_100049441
554 Ga0070700_100051190
555 Ga0070694_100003657
556 Ga0070694_100043634
557 Ga0070694_100072798
558 Ga0070708_100000610
559 Ga0070708_100058354
560 Ga0070663_100017792
561 Ga0070663_100104948
562 Ga0070678_100041199
563 Ga0070662_100003400
564 Ga0068867_100004377
565 Ga0070685_10006147
566 Ga0070707_100045618
567 Ga0070707_100085745
568 Ga0070698_100006091
569 Ga0070698_100020828
570 Ga0070698_100021363
571 Ga0070698_100051196
572 Ga0070698_100202464
573 Ga0070699_100028540
574 Ga0070679_100323752
575 Ga0070684_100078520
576 Ga0070697_100079605
577 Ga0070697_100235739
578 Ga0068853_100008593
579 Ga0068853_100061302
580 Ga0070672_100031560
581 Ga0070695_100023182
582 Ga0070696_100171652
583 Ga0070696_100201664
584 Ga0070693_100010079
585 Ga0070693_100100343
586 Ga0070665_100020333
587 Ga0068855_100046090
588 Ga0070702_100010415
589 Ga0070702_100087540
590 Ga0068852_100185814
591 Ga0068859_100024989
592 Ga0068859_100422296
593 Ga0068864_100373504
594 Ga0068864_100544262
595 Ga0068866_10004625
596 Ga0068861_100001942
597 Ga0068861_100138036
598 Ga0068863_100306613
599 Ga0068863_100761995
600 Ga0068858_100018817
601 Ga0068860_100010478
602 Ga0068862_100007287
603 Ga0068862_100317923
604 Ga0068862_100387905
605 Ga0081540_1001743
606 Ga0070717_10073802
607 Ga0070717_10422970
608 Ga0075363_100053748
609 Ga0075364_10000532
610 Ga0070716_100032712
611 Ga0070716_100097758
612 Ga0070716_100165802
613 Ga0070712_100252724
614 Ga0070712_100374689
615 Ga0075362_10014268
616 Ga0075369_10010946
617 Ga0068871_100026196
618 Ga0075428_100000480
619 Ga0075430_100009302
620 Ga0075431_100009969
621 Ga0075433_10035855
622 Ga0075433_10379005
623 Ga0075434_100000775
624 Ga0068865_100028789
625 Ga0068865_100125621
626 Ga0075436_100047661
627 Ga0075436_100073799
628 Ga0075436_100261763
629 Ga0097620_100024988
630 Ga0097620_100422283
631 Ga0075435_100001754
632 Ga0075435_100129144
633 Ga0105250_10075868
634 Ga0105240_10398695
635 Ga0105245_10000724
636 Ga0105245_10023797
637 Ga0105247_10001484
638 Ga0114129_10015527
639 Ga0105243_10003143
640 Ga0105243_10071648
641 Ga0105241_10019461
642 Ga0105242_10023150
643 Ga0105248_10007131
644 Ga0105237_10028260
645 Ga0105238_10182255
646 Ga0105249_10017452
647 Ga0105249_10031362
648 Ga0105249_10042666
649 Ga0099796_10110927
650 Ga0105239_10006105
651 Ga0105239_10020617
652 Ga0105246_10011576
653 Ga0157347_1007746
654 Ga0157338_1004305
655 Ga0157370_10122936
656 Ga0157369_10159857
657 Ga0157374_10103526
658 Ga0157378_10053804
659 Ga0163162_10064639
660 Ga0163162_10166153
661 Ga0157372_10023114
662 Ga0157372_10037579
663 Ga0157375_10079834
664 Ga0157375_10281344
665 Ga0163163_10061639
666 Ga0157380_10001550
667 Ga0157379_10098597
668 Ga0157376_10053805
669 Ga0163161_10001490
670 Ga0197907_10032160
671 Ga0206353_11968973
672 Ga0213875_10000736
673 Ga0213875_10001023
674 Ga0213875_10017094
675 Ga0213875_10022651
676 Ga0224712_10067133
677 Ga0224572_1002553
678 Ga0207426_1004126
679 Ga0209051_1002588
680 Ga0207692_10006237
681 Ga0207692_10011827
682 Ga0207642_10001843
683 Ga0207710_10009802
684 Ga0207688_10003096
685 Ga0207688_10003757
686 Ga0207680_10087010
687 Ga0207680_10184178
688 Ga0207647_10035585
689 Ga0207647_10047370
690 Ga0207685_10043536
691 Ga0207685_10136529
692 Ga0207699_10028254
693 Ga0207699_10080232
694 Ga0207699_10143355
695 Ga0207645_10071501
696 Ga0207654_10051890
697 Ga0207693_10041892
698 Ga0207693_10259052
699 Ga0207663_10016818
700 Ga0207660_10099677
701 Ga0207662_10014703
702 Ga0207657_10009522
703 Ga0207657_10029978
704 Ga0207649_10053478
705 Ga0207646_10117743
706 Ga0207681_10004956
707 Ga0207694_10138934
708 Ga0207687_10006161
709 Ga0207700_10085135
710 Ga0207700_10239984
711 Ga0207700_10243960
712 Ga0207664_10144434
713 Ga0207664_10147936
714 Ga0207664_10168979
715 Ga0207664_10203924
716 Ga0207644_10017976
717 Ga0207706_10003178
718 Ga0207686_10046457
719 Ga0207709_10001631
720 Ga0207669_10000609
721 Ga0207704_10003109
722 Ga0207665_10007258
723 Ga0207665_10114963
724 Ga0207665_10142802
725 Ga0207665_10148528
726 Ga0207711_10004074
727 Ga0207711_10539416
728 Ga0207689_10067729
729 Ga0207667_10022043
730 Ga0207712_10009169
731 Ga0207668_10004500
732 Ga0207640_10013768
733 Ga0207640_10210003
734 Ga0207658_10001362
735 Ga0207658_10107772
736 Ga0207677_10009414
737 Ga0207703_10003392
738 Ga0207678_10002949
739 Ga0207678_10344618
740 Ga0207708_10002633
741 Ga0207641_10626443
742 Ga0207648_10003318
743 Ga0207648_10528164
744 Ga0207676_10637837
745 Ga0207674_10119813
746 Ga0207675_100000881
747 Ga0207675_100152776
748 Ga0207683_10003537
749 Ga0207698_10122289
750 Ga0207698_10173741
751 Ga0268266_10052195
752 Ga0268265_10019406
753 Ga0268265_10349350
754 Ga0268264_10006302
755 Ga0268264_10028139
756 Ga0268264_10250424
757 Ga0265337_1000196
758 Ga0265326_10002284
759 Ga0265319_1016966
760 Ga0265334_10001485
761 Ga0265336_10001333
762 Ga0265338_10001331
763 Ga0265324_10001438
764 Ga0307511_10000716
765 Ga0307511_10000878
766 Ga0307512_10004484
767 Ga0265332_10002395
768 Ga0265320_10020197
769 Ga0265340_10004471
770 Ga0307513_10000929
771 Ga0307513_10171349
772 Ga0307509_10006523
773 Ga0265314_10130315
774 Ga0265342_10001071
775 Ga0307507_10113246
776 Ga0307510_10053055
777 Ga0373928_0028974
778 Ga0373929_0023187
779 Ga0373934_0020088
780 Ga0373940_0034209
781 Ga0373944_0001671
782 Ga0373944_0003160
783 Ga0373923_0000825
784 Ga0373932_0010901
785 Ga0373936_0002118
786 Ga0373936_0009020
787 Ga0373936_0011602
788 Ga0373941_0016456
789 Ga0373941_0046101
790 Ga0373945_0002949
791 Ga0373953_0001761
792 Ga0373953_0058494
793 Ga0373954_0046574
794 Ga0373956_0112472
795 Ga0373957_0109135
796 Ga0373943_0000192
797 Ga0373943_0003465
798 Ga0373946_0000621
799 Ga0373946_0002583
800 Ga0373946_0144240
801 Ga0373955_0005605
802 Ga0373955_0066861
803 Ga0373942_0000083
804 Ga0373942_0054546
805 Ga0373961_0017073
806 Ga0373961_0029012
807 Ga0373924_0023624
808 Ga0373931_0002199
809 Ga0373931_0053549
810 Ga0373935_0014898
811 Ga0373935_0041107
812 Ga0373927_0008768
813 Ga0373927_0018961
814 Ga0373933_0032792
815 Ga0373947_0001383
816 Ga0373947_0105364
817 Ga0373937_0251406
818 Ga0373925_0001884
819 Ga0373925_0006172
820 Ga0373925_0007489
821 Ga0373925_0053104
822 Ga0373925_0055061
823 Ga0373925_0057156
824 Ga0436364_0323940
825 Ga0436364_0436054
826 Ga0436364_0477471
827 Ga0436364_0661034
828 Ga0436364_0702496
829 Ga0436364_1297797
830 Ga0436365_0590242
831 Ga0436365_1657937
832 Ga0451802_1992721
833 Ga0451807_2378228
834 Ga0466966_0007044
835 Ga0466966_0054157
836 Ga0466961_0018791
837 Ga0466963_0041645
838 Ga0466963_0088180
839 Ga0466970_0094453
840 Ga0466958_0003428
841 Ga0466958_0041248
842 Ga0466967_0000477
843 Ga0466967_0008577
844 Ga0466967_0022784
845 Ga0466967_0058078
846 Ga0495592_0005093
847 Ga0495592_0036240
848 Ga0495592_0320193
849 Ga0495629_0005480
850 Ga0495641_0006675
851 Ga0495651_0003821
852 Ga0495651_0087391
853 Ga0495651_0088128
854 Ga0495653_0003616
855 Ga0495653_0009517
856 Ga0495653_0070776
857 Ga0495653_0117177
858 Ga0495580_0039749
859 Ga0495639_0005706
860 Ga0495639_0058655
861 Ga0495639_0135365
862 Ga0495662_0012643
863 Ga0495664_0001073
864 Ga0495664_0049812
865 Ga0495608_0002553
866 Ga0495608_0011522
867 Ga0495608_0020456
868 Ga0495608_0087418
869 Ga0495618_0021034
870 Ga0495618_0034695
871 Ga0495618_0036904
872 Ga0495628_0032526
873 Ga0495628_0176967
874 Ga0495630_0033012
875 Ga0495630_0035702
876 Ga0495666_0031261
877 Ga0495652_0001274
878 Ga0495652_0005312
879 Ga0495652_0040179
880 Ga0495652_0129625
881 Ga0495652_0180700
882 Ga0495665_0014228
883 Ga0495665_0035079
884 Ga0495640_0059287
885 Ga0495586_0009028
886 Ga0495587_0003105
887 Ga0495645_0019343
888 Ga0495645_0024103
889 Ga0495645_0066351
890 Ga0495645_0165600
891 Ga0495667_0006111
892 Ga0495667_0025502
893 Ga0495667_0072615
894 Ga0495634_0003200
895 Ga0495634_0017511
896 Ga0495634_0019278
897 Ga0495634_0078743
898 Ga0495634_0171677
899 Ga0495635_0019358
900 Ga0495635_0044048
901 Ga0495657_0002590
902 Ga0495657_0028300
903 Ga0495657_0115755
904 Ga0495599_0009771
905 Ga0495599_0032641
906 Ga0495599_0083715
907 Ga0495623_0082467
908 Ga0495646_0025239
909 Ga0495646_0046090
910 Ga0495646_0053635
911 Ga0495646_0055266
912 Ga0495613_0010570
913 Ga0495624_0001336
914 Ga0495624_0003128
915 Ga0495589_0008676
916 Ga0495600_0005339
917 Ga0495600_0043553
918 Ga0495581_0010150
919 Ga0495604_0001464
920 Ga0495604_0107071
921 Ga0495674_0001776
922 Ga0495674_0010210
923 Ga0495674_0024721
924 Ga0495674_0031131
925 Ga0495672_0130916
926 Ga0495676_0007291
927 Ga0495676_0018236
928 Ga0495680_0002196
929 Ga0495680_0004825
930 Ga0495680_0011976
931 Ga0495687_006470
932 Ga0495687_033887
933 Ga0495675_0006564
934 Ga0495684_0000966
935 Ga0495684_0024717
936 Ga0495684_0061596
937 Ga0495593_0003389
938 Ga0495593_0098240
939 Ga0495602_0031790
940 Ga0495602_0064028
941 Ga0495614_0002535
942 Ga0496101_0015749
943 Ga0496102_0015114
944 Ga0496103_0005516
945 Ga0496104_0051038
946 Ga0496106_0056314
947 Ga0496107_0006279
948 Ga0496108_0270950
949 Ga0496108_0488207
950 Ga0496109_0254194
951 Ga0496114_0018372
952 Ga0496115_0000818
953 Ga0496115_0330022
954 Ga0496115_0360886
955 Ga0496115_0379509
956 Ga0496119_0150235
957 Ga0501042_0288789
958 Ga0501072_0323435
959 Ga0501044_0170558
960 nmdc:mga03683_7829_c1
961 nmdc:mga00v17_162_c1
962 nmdc:mga00v17_277913_c1
963 nmdc:mga05p37_462984_c1
964 nmdc:mga0qj67_10848_c1
965 nmdc:mga06r32_37662_c1
966 nmdc:mga0n895_128165_c1
967 nmdc:mga0n895_31161_c1
968 nmdc:mga08x19_127256_c1
969 nmdc:mga08x19_33405_c1
970 nmdc:mga0a205_169598_c1
971 nmdc:mga0a205_71413_c1
972 nmdc:mga0sz30_1433_c1
973 nmdc:mga0sz30_3729_c1
974 Ga0495601_0001952
975 Ga0495601_0038979
976 Ga0495595_0004395
977 Ga0495595_0039210
978 Ga0466962_0010151
979 2523385344
980 2552112160
981 2558914048
982 2559430665
983 2623497831
984 2644491509
985 2689958604
986 2739364037
987 2793975315
988 2793979975
989 2867352480
990 2870785006
991 2873319813
992 2929219331
993 2929219420
994 3003005913
995 3006500519
996 8008488483
997 8025527470
998 8047900335
999 8047900578
1000 8048128842
1001 8048132132
1002 8048133354
1003 8048358324
1004 8048358562
1005 8048377278
1006 8048377518
1007 8048386370
1008 8048386616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

147

258

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hpy-assembly1.cif.gz_B crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas in the complex with 4-methylcatechol 0.7906 2 282
5znh-assembly1.cif.gz_A catechol 2,3-dioxygenase with 4-methyl catechol from diaphorobacter sp ds2 0.7856 1 281
2ei1-assembly1.cif.gz_A anaerobic crystal structure analysis of the 1,2-dihydroxynaphthalene dioxygeanse of pseudomonas sp. strain c18 complexes to 1,2-dihydroxynaphthalene 0.7729 1 279
3b59-assembly1.cif.gz_F crystal structure of the mn(ii)-bound glyoxalase from novosphingobium aromaticivorans 0.7723 2 298
3hpy-assembly1.cif.gz_B crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas in the complex with 4-methylcatechol 0.7702 2 282
ID Description Score Start End Superfamily
3hq0A02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8869 149 282 3.10.180.10
5znhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8773 149 281 3.10.180.10
3lm4B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8728 149 268 3.10.180.10
3vb0B02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8649 150 279 3.10.180.10
5zszA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8648 147 267 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A6G3V936-F1-model_v4 deleted 0.9458 140 210
AF-A0A6G2Y7P6-F1-model_v4 deleted 0.9416 1 112
AF-A0A6I4W9M8-F1-model_v4 Dioxygenase 0.9363 1 274 GO:0051213
AF-A0A3D2LIL4-F1-model_v4 deleted 0.9329 147 263
AF-A0A4D4LQ66-F1-model_v4 Dioxygenase 0.9271 1 244 GO:0051213

Map