F456224

General Info

Members Datasets Scaffolds Average Seq Length
504 231 1008 158

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0037381|Ga0316584_0037381_520_1065
Length 181
Sequence MCNSFNKKFLDEASRHWSGSQGIEKSADLSFLKMAAELGLKGVENSEGGPFGCVIVKDGKVIGRGNNRVTSRNDPTAHAEILAIREACAYLGSHQLTGCVLYTSCEPCPMCLGAIYWARPDKVFYSATKEDAASSGFDDHFIYKEINLPPQDRSIEFQQLGREEALRAFKAWDEKEDKIEY

Samples

Sample ID Description Type Environment
1 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
128 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
129 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
130 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
133 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
152 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
211 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
212 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
213 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
214 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
215 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
216 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
217 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
218 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
219 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
220 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
221 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
222 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
223 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
224 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
229 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
230 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
231 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 0.99
Rhizosphere 98.41
Stem 0
Stem Tuber 0
Unclassified 16.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316584_0037381 3300036712 Bacteria 3607
2 MRS1b_contig_3464428 2162886011 Bacteria 1053
3 Ga0065712_10102030 3300005290 Unclassified 2019
4 Ga0065712_10283355 3300005290 Bacteria 891
5 Ga0065715_10134722 3300005293 Unclassified 1950
6 Ga0065715_10450606 3300005293 Unclassified 809
7 Ga0070676_10012123 3300005328 Bacteria 4699
8 Ga0070676_10027881 3300005328 Bacteria 3206
9 Ga0070676_10037406 3300005328 Bacteria 2799
10 Ga0070676_10290677 3300005328 Unclassified 1104
11 Ga0070683_100015851 3300005329 Bacteria 6629
12 Ga0070683_100024534 3300005329 Bacteria 5403
13 Ga0070683_100185647 3300005329 Bacteria 1974
14 Ga0070683_100517650 3300005329 Bacteria 1140
15 Ga0070683_101217963 3300005329 Bacteria 723
16 Ga0070690_100047047 3300005330 Bacteria 2744
17 Ga0070690_100052860 3300005330 Unclassified 2597
18 Ga0070690_100092330 3300005330 Bacteria 1996
19 Ga0070690_100092338 3300005330 Bacteria 1996
20 Ga0070670_100027935 3300005331 Bacteria 4855
21 Ga0070670_100028202 3300005331 Bacteria 4832
22 Ga0070670_100052359 3300005331 Bacteria 3506
23 Ga0070670_100178866 3300005331 Bacteria 1841
24 Ga0070670_100391946 3300005331 Bacteria 1225
25 Ga0070670_100715915 3300005331 Unclassified 901
26 Ga0068869_100002729 3300005334 Bacteria 10689
27 Ga0068869_100003249 3300005334 Bacteria 9933
28 Ga0068869_100005384 3300005334 Bacteria 8043
29 Ga0068869_100038040 3300005334 Bacteria 3426
30 Ga0068869_100331814 3300005334 Bacteria 1236
31 Ga0070666_10044961 3300005335 Bacteria 2960
32 Ga0070682_100283036 3300005337 Bacteria 1209
33 Ga0068868_100004505 3300005338 Bacteria 9774
34 Ga0068868_100039486 3300005338 Bacteria 3668
35 Ga0068868_100086703 3300005338 Bacteria 2517
36 Ga0070660_100127621 3300005339 Bacteria 2033
37 Ga0070660_101435606 3300005339 Bacteria 586
38 Ga0070689_100004819 3300005340 Bacteria 9156
39 Ga0070689_100038565 3300005340 Bacteria 3656
40 Ga0070689_100822284 3300005340 Unclassified 818
41 Ga0070661_100017275 3300005344 Bacteria 5117
42 Ga0070661_100490824 3300005344 Bacteria 982
43 Ga0070661_101510551 3300005344 Unclassified 567
44 Ga0070668_100037375 3300005347 Bacteria 3708
45 Ga0070669_100001663 3300005353 Bacteria 16089
46 Ga0070669_100027006 3300005353 Bacteria 4132
47 Ga0070675_100006589 3300005354 Bacteria 8927
48 Ga0070675_100086343 3300005354 Unclassified 2622
49 Ga0070675_101455160 3300005354 Unclassified 632
50 Ga0070671_100147034 3300005355 Bacteria 1989
51 Ga0070671_100151311 3300005355 Unclassified 1959
52 Ga0070671_100192367 3300005355 Bacteria 1729
53 Ga0070671_100250817 3300005355 Bacteria 1503
54 Ga0070674_100312779 3300005356 Bacteria 1256
55 Ga0070674_100858700 3300005356 Unclassified 788
56 Ga0070673_100029312 3300005364 Unclassified 4103
57 Ga0070673_100034546 3300005364 Bacteria 3827
58 Ga0070688_100004946 3300005365 Bacteria 6972
59 Ga0070688_100072333 3300005365 Unclassified 2209
60 Ga0070688_100315356 3300005365 Bacteria 1134
61 Ga0070659_100067597 3300005366 Unclassified 2834
62 Ga0070667_100010081 3300005367 Bacteria 7823
63 Ga0070667_101411556 3300005367 Bacteria 653
64 Ga0070667_101490859 3300005367 Bacteria 635
65 Ga0070701_10172946 3300005438 Bacteria 1259
66 Ga0070701_10618362 3300005438 Bacteria 719
67 Ga0070700_100150696 3300005441 Unclassified 1590
68 Ga0070663_100106442 3300005455 Unclassified 2101
69 Ga0070678_100902667 3300005456 Unclassified 808
70 Ga0070662_100004418 3300005457 Bacteria 8888
71 Ga0070662_100026225 3300005457 Bacteria 4035
72 Ga0070662_100027817 3300005457 Bacteria 3930
73 Ga0070662_100108240 3300005457 Bacteria 2114
74 Ga0070662_100495901 3300005457 Bacteria 1018
75 Ga0068867_100021828 3300005459 Bacteria 4570
76 Ga0068867_100069744 3300005459 Unclassified 2626
77 Ga0068867_100300552 3300005459 Unclassified 1323
78 Ga0068867_101308306 3300005459 Bacteria 669
79 Ga0070685_10072464 3300005466 Bacteria 2045
80 Ga0070685_10113646 3300005466 Bacteria 1672
81 Ga0070685_10926970 3300005466 Bacteria 650
82 Ga0070698_100761299 3300005471 Bacteria 912
83 Ga0070684_100002466 3300005535 Bacteria 13612
84 Ga0070684_100004924 3300005535 Bacteria 10189
85 Ga0070684_100019362 3300005535 Bacteria 5628
86 Ga0070684_100040227 3300005535 Bacteria 4025
87 Ga0070697_100382422 3300005536 Bacteria 1219
88 Ga0068853_100008314 3300005539 Bacteria 8335
89 Ga0068853_100111719 3300005539 Bacteria 2428
90 Ga0068853_100261513 3300005539 Bacteria 1591
91 Ga0070686_100199214 3300005544 Bacteria 1434
92 Ga0070686_100200928 3300005544 Unclassified 1429
93 Ga0070686_100897566 3300005544 Unclassified 721
94 Ga0070686_101389579 3300005544 Bacteria 589
95 Ga0070665_100686786 3300005548 Bacteria 1037
96 Ga0068855_102393291 3300005563 Bacteria 527
97 Ga0070664_100008221 3300005564 Bacteria 8437
98 Ga0070664_100027311 3300005564 Bacteria 4742
99 Ga0070664_100040321 3300005564 Bacteria 3936
100 Ga0070664_100040374 3300005564 Unclassified 3933
101 Ga0070664_100208030 3300005564 Bacteria 1748
102 Ga0070664_101067959 3300005564 Bacteria 760
103 Ga0068857_100039434 3300005577 Unclassified 4184
104 Ga0068857_100091152 3300005577 Bacteria 2728
105 Ga0068857_100148933 3300005577 Bacteria 2119
106 Ga0068857_100494025 3300005577 Bacteria 1148
107 Ga0068857_100620804 3300005577 Bacteria 1023
108 Ga0068857_101230512 3300005577 Bacteria 725
109 Ga0068854_100141284 3300005578 Bacteria 1848
110 Ga0068854_100525119 3300005578 Bacteria 1000
111 Ga0068854_100541110 3300005578 Bacteria 986
112 Ga0068856_100548432 3300005614 Bacteria 1177
113 Ga0068856_102329601 3300005614 Bacteria 543
114 Ga0068852_100330705 3300005616 Bacteria 1482
115 Ga0068852_100844259 3300005616 Bacteria 931
116 Ga0068852_101245624 3300005616 Bacteria 765
117 Ga0068859_100059337 3300005617 Bacteria 3855
118 Ga0068859_100084296 3300005617 Bacteria 3223
119 Ga0068859_100120979 3300005617 Bacteria 2684
120 Ga0068859_100134838 3300005617 Bacteria 2541
121 Ga0068859_100303029 3300005617 Bacteria 1691
122 Ga0068859_100440054 3300005617 Unclassified 1400
123 Ga0068864_100010021 3300005618 Bacteria 7823
124 Ga0068864_100010208 3300005618 Bacteria 7755
125 Ga0068864_100130828 3300005618 Unclassified 2254
126 Ga0068864_100164490 3300005618 Bacteria 2019
127 Ga0068864_100259167 3300005618 Bacteria 1617
128 Ga0068866_10659626 3300005718 Bacteria 713
129 Ga0068861_100043098 3300005719 Bacteria 3384
130 Ga0068861_100163698 3300005719 Bacteria 1837
131 Ga0068861_100505496 3300005719 Bacteria 1093
132 Ga0068851_10038135 3300005834 Bacteria 2410
133 Ga0068851_10806568 3300005834 Bacteria 583
134 Ga0068863_100206608 3300005841 Bacteria 1890
135 Ga0068863_100625635 3300005841 Bacteria 1066
136 Ga0068863_101016328 3300005841 Unclassified 832
137 Ga0068863_101382010 3300005841 Bacteria 712
138 Ga0068858_100000474 3300005842 Bacteria 41776
139 Ga0068858_100081212 3300005842 Bacteria 3013
140 Ga0068858_100171800 3300005842 Bacteria 2044
141 Ga0068858_100335627 3300005842 Unclassified 1446
142 Ga0068858_100708402 3300005842 Bacteria 980
143 Ga0068858_101326685 3300005842 Bacteria 708
144 Ga0068860_100023933 3300005843 Bacteria 5903
145 Ga0068860_100079998 3300005843 Bacteria 3108
146 Ga0068860_100204004 3300005843 Bacteria 1917
147 Ga0068860_100279091 3300005843 Bacteria 1632
148 Ga0068862_100004512 3300005844 Bacteria 11736
149 Ga0068862_100563915 3300005844 Bacteria 1089
150 Ga0068862_100606530 3300005844 Bacteria 1051
151 Ga0070715_10125616 3300006163 Unclassified 1228
152 Ga0097621_100202712 3300006237 Bacteria 1723
153 Ga0097621_100704526 3300006237 Bacteria 930
154 Ga0097621_101164064 3300006237 Unclassified 725
155 Ga0068871_100026145 3300006358 Bacteria 4551
156 Ga0068871_100302105 3300006358 Bacteria 1405
157 Ga0068871_101114163 3300006358 Unclassified 738
158 Ga0075428_101581333 3300006844 Unclassified 686
159 Ga0075429_100903609 3300006880 Bacteria 773
160 Ga0068865_100273961 3300006881 Bacteria 1341
161 Ga0068865_100328261 3300006881 Bacteria 1233
162 Ga0068865_100756392 3300006881 Bacteria 835
163 Ga0068865_101516396 3300006881 Bacteria 601
164 Ga0068865_102089802 3300006881 Unclassified 515
165 Ga0097620_100059338 3300006931 Bacteria 3855
166 Ga0097620_100084293 3300006931 Bacteria 3223
167 Ga0097620_100120974 3300006931 Bacteria 2684
168 Ga0097620_100134842 3300006931 Bacteria 2541
169 Ga0097620_100303021 3300006931 Bacteria 1691
170 Ga0097620_100440048 3300006931 Unclassified 1400
171 Ga0097620_100835474 3300006931 Bacteria 1007
172 Ga0105244_10001053 3300009036 Bacteria 23071
173 Ga0105240_10630241 3300009093 Bacteria 1177
174 Ga0111539_10442905 3300009094 Bacteria 1513
175 Ga0105245_10021721 3300009098 Bacteria 5635
176 Ga0105243_10857605 3300009148 Unclassified 900
177 Ga0105242_10093498 3300009176 Bacteria 2535
178 Ga0105242_10670488 3300009176 Bacteria 1011
179 Ga0105242_11710727 3300009176 Unclassified 665
180 Ga0105248_10006730 3300009177 Bacteria 12610
181 Ga0105248_10336550 3300009177 Bacteria 1699
182 Ga0105249_10001462 3300009553 Bacteria 20700
183 Ga0105249_10117987 3300009553 Bacteria 2518
184 Ga0105249_10238517 3300009553 Bacteria 1797
185 Ga0105249_10257674 3300009553 Unclassified 1732
186 Ga0105249_11055655 3300009553 Bacteria 882
187 Ga0105246_10129502 3300011119 Bacteria 1882
188 Ga0105246_10174639 3300011119 Bacteria 1649
189 Ga0157371_10127080 3300013102 Unclassified 1813
190 Ga0157371_10136957 3300013102 Bacteria 1743
191 Ga0157371_10197204 3300013102 Bacteria 1442
192 Ga0157371_10227573 3300013102 Bacteria 1340
193 Ga0157374_10020128 3300013296 Bacteria 5916
194 Ga0157374_10043721 3300013296 Unclassified 4139
195 Ga0157374_10100046 3300013296 Bacteria 2778
196 Ga0157374_10647671 3300013296 Bacteria 1068
197 Ga0157378_10019739 3300013297 Bacteria 5926
198 Ga0157378_10063092 3300013297 Unclassified 3310
199 Ga0157378_10118512 3300013297 Bacteria 2437
200 Ga0163162_10001732 3300013306 Bacteria 20439
201 Ga0163162_10005098 3300013306 Bacteria 12662
202 Ga0163162_10047958 3300013306 Unclassified 4280
203 Ga0163162_10169556 3300013306 Bacteria 2307
204 Ga0163162_10332511 3300013306 Bacteria 1652
205 Ga0163162_10922897 3300013306 Bacteria 985
206 Ga0157372_11036400 3300013307 Bacteria 950
207 Ga0157375_10000276 3300013308 Bacteria 46617
208 Ga0157375_10007748 3300013308 Bacteria 9398
209 Ga0157375_10040832 3300013308 Bacteria 4475
210 Ga0157375_10047931 3300013308 Bacteria 4176
211 Ga0157375_10191015 3300013308 Bacteria 2203
212 Ga0163163_10000078 3300014325 Bacteria 107017
213 Ga0163163_10000557 3300014325 Bacteria 32741
214 Ga0163163_10114242 3300014325 Bacteria 2730
215 Ga0163163_10309979 3300014325 Bacteria 1631
216 Ga0163163_10438305 3300014325 Unclassified 1366
217 Ga0163163_10871057 3300014325 Bacteria 964
218 Ga0157380_10008074 3300014326 Bacteria 7498
219 Ga0157380_10046919 3300014326 Unclassified 3395
220 Ga0157380_10446787 3300014326 Bacteria 1240
221 Ga0157380_11195913 3300014326 Bacteria 804
222 Ga0157380_11270040 3300014326 Unclassified 782
223 Ga0157380_11396964 3300014326 Bacteria 750
224 Ga0157377_10002736 3300014745 Bacteria 7846
225 Ga0157377_10065160 3300014745 Bacteria 2092
226 Ga0157377_10107343 3300014745 Bacteria 1673
227 Ga0157377_10462653 3300014745 Bacteria 878
228 Ga0157379_10060917 3300014968 Bacteria 3375
229 Ga0157379_10127135 3300014968 Bacteria 2293
230 Ga0157379_10738852 3300014968 Unclassified 926
231 Ga0157376_10492560 3300014969 Bacteria 1203
232 Ga0157376_10620610 3300014969 Bacteria 1078
233 Ga0157376_10633622 3300014969 Bacteria 1068
234 Ga0157376_11965035 3300014969 Unclassified 622
235 Ga0163161_10044239 3300017792 Bacteria 3207
236 Ga0163161_10134974 3300017792 Bacteria 1865
237 Ga0163161_10158885 3300017792 Bacteria 1723
238 Ga0228598_1003826 3300024227 Bacteria 3210
239 Ga0207697_10019690 3300025315 Unclassified 2765
240 Ga0207656_10412079 3300025321 Bacteria 680
241 Ga0207655_1000184 3300025728 Bacteria 111832
242 Ga0207642_10351785 3300025899 Bacteria 869
243 Ga0207688_10191501 3300025901 Bacteria 1223
244 Ga0207680_10289067 3300025903 Bacteria 1140
245 Ga0207647_10008381 3300025904 Bacteria 7415
246 Ga0207647_10011384 3300025904 Bacteria 6239
247 Ga0207645_10002700 3300025907 Bacteria 13825
248 Ga0207645_10043328 3300025907 Bacteria 2880
249 Ga0207645_10321464 3300025907 Unclassified 1032
250 Ga0207684_10109267 3300025910 Bacteria 2367
251 Ga0207649_10003172 3300025920 Bacteria 9021
252 Ga0207649_10012896 3300025920 Unclassified 4655
253 Ga0207649_11518552 3300025920 Bacteria 530
254 Ga0207681_10001827 3300025923 Bacteria 13645
255 Ga0207681_10030979 3300025923 Bacteria 3491
256 Ga0207650_10029640 3300025925 Bacteria 3935
257 Ga0207650_10148349 3300025925 Bacteria 1849
258 Ga0207650_10153425 3300025925 Bacteria 1820
259 Ga0207650_10286896 3300025925 Unclassified 1341
260 Ga0207650_11061799 3300025925 Unclassified 689
261 Ga0207650_11563393 3300025925 Bacteria 560
262 Ga0207659_10007092 3300025926 Bacteria 6880
263 Ga0207659_10039355 3300025926 Unclassified 3297
264 Ga0207659_10148247 3300025926 Bacteria 1829
265 Ga0207659_10795264 3300025926 Bacteria 812
266 Ga0207644_10164155 3300025931 Bacteria 1729
267 Ga0207644_10228000 3300025931 Bacteria 1479
268 Ga0207644_10326195 3300025931 Unclassified 1242
269 Ga0207644_10676936 3300025931 Unclassified 860
270 Ga0207706_10005994 3300025933 Bacteria 11302
271 Ga0207706_10048725 3300025933 Bacteria 3747
272 Ga0207706_10070762 3300025933 Bacteria 3068
273 Ga0207706_10076142 3300025933 Bacteria 2951
274 Ga0207686_10041634 3300025934 Bacteria 2802
275 Ga0207686_10277351 3300025934 Bacteria 1236
276 Ga0207686_10927446 3300025934 Unclassified 704
277 Ga0207670_10026753 3300025936 Bacteria 3639
278 Ga0207670_10161959 3300025936 Bacteria 1670
279 Ga0207670_10259623 3300025936 Bacteria 1346
280 Ga0207669_10748732 3300025937 Bacteria 807
281 Ga0207704_10614674 3300025938 Unclassified 891
282 Ga0207704_11264115 3300025938 Unclassified 630
283 Ga0207691_10060623 3300025940 Bacteria 3437
284 Ga0207691_11036793 3300025940 Bacteria 684
285 Ga0207689_10002521 3300025942 Bacteria 17012
286 Ga0207689_10009467 3300025942 Bacteria 8410
287 Ga0207689_10019352 3300025942 Bacteria 5738
288 Ga0207689_10045699 3300025942 Bacteria 3620
289 Ga0207689_10102437 3300025942 Bacteria 2352
290 Ga0207689_10321865 3300025942 Bacteria 1283
291 Ga0207661_10050175 3300025944 Bacteria 3323
292 Ga0207661_10067384 3300025944 Unclassified 2911
293 Ga0207661_10400783 3300025944 Bacteria 1244
294 Ga0207661_10517702 3300025944 Bacteria 1091
295 Ga0207679_10000720 3300025945 Bacteria 21987
296 Ga0207679_10038078 3300025945 Bacteria 3424
297 Ga0207679_10087376 3300025945 Unclassified 2400
298 Ga0207679_10121186 3300025945 Bacteria 2082
299 Ga0207679_10843910 3300025945 Unclassified 836
300 Ga0207651_10075227 3300025960 Bacteria 2409
301 Ga0207651_10204276 3300025960 Bacteria 1586
302 Ga0207651_10237681 3300025960 Unclassified 1483
303 Ga0207712_10024751 3300025961 Bacteria 3981
304 Ga0207712_10502526 3300025961 Bacteria 1037
305 Ga0207668_10064360 3300025972 Unclassified 2591
306 Ga0207640_10143412 3300025981 Bacteria 1744
307 Ga0207640_10475794 3300025981 Bacteria 1035
308 Ga0207658_10395118 3300025986 Unclassified 1214
309 Ga0207658_10942591 3300025986 Bacteria 787
310 Ga0207677_10007509 3300026023 Bacteria 6040
311 Ga0207677_10034282 3300026023 Bacteria 3286
312 Ga0207677_10064144 3300026023 Bacteria 2557
313 Ga0207677_10319593 3300026023 Bacteria 1289
314 Ga0207677_10719355 3300026023 Bacteria 887
315 Ga0207703_10001520 3300026035 Bacteria 21065
316 Ga0207703_10284465 3300026035 Unclassified 1503
317 Ga0207703_10353251 3300026035 Bacteria 1354
318 Ga0207703_10772059 3300026035 Bacteria 916
319 Ga0207703_11114625 3300026035 Bacteria 758
320 Ga0207639_10004707 3300026041 Bacteria 9187
321 Ga0207639_10147769 3300026041 Bacteria 1965
322 Ga0207639_10431672 3300026041 Bacteria 1193
323 Ga0207678_10020356 3300026067 Bacteria 5821
324 Ga0207678_10091256 3300026067 Bacteria 2603
325 Ga0207708_10212975 3300026075 Unclassified 1545
326 Ga0207708_10652043 3300026075 Bacteria 896
327 Ga0207702_10872803 3300026078 Bacteria 891
328 Ga0207641_10006923 3300026088 Bacteria 9489
329 Ga0207641_10222437 3300026088 Unclassified 1751
330 Ga0207648_10055888 3300026089 Bacteria 3445
331 Ga0207648_10055991 3300026089 Bacteria 3442
332 Ga0207648_10082752 3300026089 Bacteria 2799
333 Ga0207648_10092536 3300026089 Unclassified 2644
334 Ga0207648_10233688 3300026089 Bacteria 1636
335 Ga0207676_10006913 3300026095 Bacteria 8041
336 Ga0207676_10011185 3300026095 Bacteria 6407
337 Ga0207676_10102998 3300026095 Bacteria 2371
338 Ga0207676_10469253 3300026095 Bacteria 1190
339 Ga0207676_10837545 3300026095 Bacteria 899
340 Ga0207674_10005440 3300026116 Bacteria 15123
341 Ga0207674_10007360 3300026116 Bacteria 12822
342 Ga0207674_10041302 3300026116 Bacteria 4771
343 Ga0207674_10467977 3300026116 Bacteria 1218
344 Ga0207674_10488570 3300026116 Bacteria 1190
345 Ga0207675_100000477 3300026118 Bacteria 38985
346 Ga0207675_100085121 3300026118 Bacteria 2967
347 Ga0207675_100209357 3300026118 Bacteria 1875
348 Ga0207675_101671007 3300026118 Bacteria 657
349 Ga0207683_10100822 3300026121 Unclassified 2578
350 Ga0207698_10061971 3300026142 Bacteria 2918
351 Ga0207698_11372026 3300026142 Bacteria 722
352 Ga0207428_10025061 3300027907 Bacteria 4996
353 Ga0268266_10523690 3300028379 Bacteria 1134
354 Ga0268266_11124901 3300028379 Unclassified 760
355 Ga0268265_10344231 3300028380 Bacteria 1359
356 Ga0268265_10375787 3300028380 Unclassified 1306
357 Ga0268265_10814133 3300028380 Bacteria 911
358 Ga0268264_10016711 3300028381 Bacteria 6007
359 Ga0268264_10145109 3300028381 Bacteria 2121
360 Ga0268264_10505334 3300028381 Bacteria 1179
361 Ga0268264_10897051 3300028381 Bacteria 890
362 Ga0265337_1005892 3300028556 Bacteria 4800
363 Ga0265326_10000415 3300028558 Bacteria 17009
364 Ga0265319_1000545 3300028563 Bacteria 25590
365 Ga0265334_10045683 3300028573 Bacteria 1695
366 Ga0265318_10034824 3300028577 Unclassified 1938
367 Ga0265318_10147463 3300028577 Bacteria 863
368 Ga0265322_10012506 3300028654 Unclassified 2456
369 Ga0265336_10002041 3300028666 Bacteria 8611
370 Ga0265336_10100129 3300028666 Bacteria 864
371 Ga0265338_10001321 3300028800 Bacteria 40561
372 Ga0265338_10164458 3300028800 Bacteria 1710
373 Ga0265324_10014514 3300029957 Bacteria 2912
374 Ga0265330_10183599 3300031235 Unclassified 886
375 Ga0265332_10013676 3300031238 Bacteria 3595
376 Ga0265320_10006625 3300031240 Bacteria 7279
377 Ga0265325_10060537 3300031241 Bacteria 1923
378 Ga0265329_10042334 3300031242 Bacteria 1459
379 Ga0265340_10036695 3300031247 Bacteria 2428
380 Ga0265339_10024510 3300031249 Bacteria 3475
381 Ga0265331_10009788 3300031250 Bacteria 5349
382 Ga0265316_10000750 3300031344 Bacteria 35817
383 Ga0265316_10003739 3300031344 Bacteria 15289
384 Ga0265316_10217872 3300031344 Bacteria 1409
385 Ga0307509_10188221 3300031507 Bacteria 1919
386 Ga0265313_10008607 3300031595 Bacteria 6750
387 Ga0265342_10015410 3300031712 Bacteria 5028
388 Ga0316576_10296152 3300031727 Bacteria 1210
389 Ga0307410_10712070 3300031852 Bacteria 847
390 Ga0307415_100349467 3300032126 Bacteria 1244
391 Ga0373926_0027426 3300035083 Bacteria 1996
392 Ga0373953_0450793 3300035117 Bacteria 568
393 Ga0373954_0122097 3300035118 Bacteria 1265
394 Ga0373954_0191824 3300035118 Bacteria 1003
395 Ga0373956_0057092 3300035119 Bacteria 1763
396 Ga0373955_0008007 3300035172 Bacteria 4886
397 Ga0373955_0214846 3300035172 Bacteria 1147
398 Ga0373924_0188215 3300035410 Bacteria 909
399 Ga0373924_0271554 3300035410 Unclassified 752
400 Ga0373935_0041270 3300035692 Bacteria 2898
401 Ga0373927_0001200 3300035695 Bacteria 19664
402 Ga0373927_0105446 3300035695 Bacteria 1835
403 Ga0373927_0173289 3300035695 Bacteria 1415
404 Ga0373933_0000292 3300035724 Bacteria 32432
405 Ga0373933_0081592 3300035724 Bacteria 1984
406 Ga0373947_0302411 3300035725 Bacteria 1067
407 Ga0373937_0001235 3300036401 Bacteria 21497
408 Ga0373937_0853342 3300036401 Bacteria 859
409 Ga0373925_0303833 3300037068 Bacteria 1289
410 Ga0395900_1547888 3300037418 Bacteria 575
411 Ga0395905_0130224 3300037471 Bacteria 2366
412 Ga0395905_0147537 3300037471 Bacteria 2213
413 Ga0395905_0780927 3300037471 Bacteria 858
414 Ga0395905_1187008 3300037471 Bacteria 667
415 Ga0395901_0680029 3300038443 Bacteria 1029
416 Ga0495592_0026987 3300046454 Bacteria 4354
417 Ga0495592_0093113 3300046454 Bacteria 2159
418 Ga0495651_0005675 3300046462 Bacteria 9509
419 Ga0495653_0021948 3300046463 Bacteria 5167
420 Ga0495653_0147358 3300046463 Bacteria 1648
421 Ga0495580_0006576 3300046472 Bacteria 9447
422 Ga0495664_0083783 3300046477 Bacteria 1913
423 Ga0495608_0008962 3300046511 Bacteria 6993
424 Ga0495608_0025715 3300046511 Bacteria 4018
425 Ga0495608_0196804 3300046511 Bacteria 1271
426 Ga0495618_0124846 3300046514 Unclassified 1648
427 Ga0495628_0000100 3300046516 Bacteria 68834
428 Ga0495628_0027302 3300046516 Bacteria 4646
429 Ga0495630_0032370 3300046517 Unclassified 3896
430 Ga0495666_0211154 3300046526 Bacteria 890
431 Ga0495652_0002958 3300046529 Bacteria 17098
432 Ga0495652_0096999 3300046529 Bacteria 2399
433 Ga0495652_0385698 3300046529 Bacteria 995
434 Ga0495652_0791846 3300046529 Bacteria 632
435 Ga0495665_0053058 3300046531 Bacteria 2145
436 Ga0495640_0057831 3300046533 Unclassified 2646
437 Ga0495586_0003724 3300046535 Bacteria 8173
438 Ga0495587_0000258 3300046536 Bacteria 38131
439 Ga0495587_0000765 3300046536 Bacteria 21421
440 Ga0495587_0010070 3300046536 Bacteria 6033
441 Ga0495645_0048880 3300046543 Bacteria 3080
442 Ga0495645_0110815 3300046543 Bacteria 1942
443 Ga0495667_0001446 3300046559 Bacteria 15640
444 Ga0495667_0195906 3300046559 Bacteria 1294
445 Ga0495635_0007465 3300046663 Bacteria 7632
446 Ga0495635_0072333 3300046663 Unclassified 2363
447 Ga0495588_0294359 3300046674 Bacteria 855
448 Ga0495657_0006868 3300046675 Bacteria 8845
449 Ga0495599_0001187 3300046678 Bacteria 14781
450 Ga0495599_0064888 3300046678 Bacteria 2281
451 Ga0495623_0001574 3300046679 Bacteria 15368
452 Ga0495623_0060081 3300046679 Bacteria 2386
453 Ga0495623_0210781 3300046679 Unclassified 1112
454 Ga0495646_0044842 3300046680 Bacteria 2702
455 Ga0495658_0263247 3300046683 Unclassified 1086
456 Ga0495613_0014943 3300046689 Bacteria 5762
457 Ga0495624_0035768 3300046690 Bacteria 3205
458 Ga0495600_0006912 3300046809 Bacteria 6920
459 Ga0495604_0000537 3300047317 Bacteria 33451
460 Ga0495604_0014905 3300047317 Bacteria 6201
461 Ga0495604_0018747 3300047317 Bacteria 5540
462 Ga0495674_0004294 3300047319 Bacteria 13713
463 Ga0495676_0473157 3300047321 Bacteria 825
464 Ga0495680_0000436 3300047322 Bacteria 46842
465 Ga0495675_0000068 3300047444 Bacteria 71584
466 Ga0495675_0001001 3300047444 Bacteria 17210
467 Ga0495675_0014103 3300047444 Bacteria 5052
468 Ga0495684_0008543 3300047471 Bacteria 7931
469 Ga0495684_0609624 3300047471 Bacteria 735
470 Ga0495684_0796518 3300047471 Unclassified 618
471 Ga0495593_0009181 3300047673 Bacteria 5731
472 Ga0495602_0001306 3300048088 Bacteria 24577
473 Ga0495602_0004826 3300048088 Bacteria 14108
474 Ga0495626_0015643 3300048091 Bacteria 3878
475 Ga0496102_0745448 3300048905 Bacteria 902
476 Ga0496108_0314320 3300048911 Bacteria 1365
477 Ga0496110_0241960 3300048913 Bacteria 1642
478 Ga0496112_0000961 3300048915 Bacteria 20945
479 Ga0496114_1006248 3300048917 Unclassified 717
480 Ga0501037_0135104 3300049573 Bacteria 1767
481 Ga0501039_0316527 3300049575 Unclassified 1227
482 Ga0501071_1083340 3300049587 Bacteria 619
483 Ga0501202_001931 3300049652 Bacteria 3415
484 Ga0501223_039986 3300049663 Bacteria 910
485 Ga0501227_056683 3300049665 Bacteria 998
486 Ga0501235_040306 3300049669 Bacteria 1067
487 Ga0501242_011475 3300049674 Bacteria 1070
488 Ga0501252_045463 3300049682 Unclassified 649
489 Ga0501257_002920 3300049686 Bacteria 3628
490 Ga0501259_001612 3300049688 Bacteria 3763
491 Ga0501225_0252275 3300049705 Bacteria 581
492 Ga0501234_035404 3300049707 Bacteria 811
493 Ga0501232_034772 3300049757 Bacteria 717
494 Ga0501241_072280 3300049758 Bacteria 707
495 Ga0501266_000726 3300049763 Bacteria 4280
496 Ga0501268_001979 3300049765 Bacteria 2632
497 Ga0501283_065820 3300049779 Bacteria 661
498 nmdc:mga09592_751750_c1 3300050508 Bacteria 827
499 nmdc:mga0qj67_899398_c1 3300050509 Bacteria 698
500 nmdc:mga08y16_235436_c1 3300050511 Bacteria 1894
501 Ga0495612_0007892 3300053078 Bacteria 4338
502 Ga0500559_0028978 3300053136 Unclassified 2368
503 Ga0500622_0218007 3300053156 Bacteria 857
504 3006880495 3006879489 Bacteria 4064221
505 Ga0316584_0037381
506 MRS1b_contig_3464428
507 Ga0065712_10102030
508 Ga0065712_10283355
509 Ga0065715_10134722
510 Ga0065715_10450606
511 Ga0070676_10012123
512 Ga0070676_10027881
513 Ga0070676_10037406
514 Ga0070676_10290677
515 Ga0070683_100015851
516 Ga0070683_100024534
517 Ga0070683_100185647
518 Ga0070683_100517650
519 Ga0070683_101217963
520 Ga0070690_100047047
521 Ga0070690_100052860
522 Ga0070690_100092330
523 Ga0070690_100092338
524 Ga0070670_100027935
525 Ga0070670_100028202
526 Ga0070670_100052359
527 Ga0070670_100178866
528 Ga0070670_100391946
529 Ga0070670_100715915
530 Ga0068869_100002729
531 Ga0068869_100003249
532 Ga0068869_100005384
533 Ga0068869_100038040
534 Ga0068869_100331814
535 Ga0070666_10044961
536 Ga0070682_100283036
537 Ga0068868_100004505
538 Ga0068868_100039486
539 Ga0068868_100086703
540 Ga0070660_100127621
541 Ga0070660_101435606
542 Ga0070689_100004819
543 Ga0070689_100038565
544 Ga0070689_100822284
545 Ga0070661_100017275
546 Ga0070661_100490824
547 Ga0070661_101510551
548 Ga0070668_100037375
549 Ga0070669_100001663
550 Ga0070669_100027006
551 Ga0070675_100006589
552 Ga0070675_100086343
553 Ga0070675_101455160
554 Ga0070671_100147034
555 Ga0070671_100151311
556 Ga0070671_100192367
557 Ga0070671_100250817
558 Ga0070674_100312779
559 Ga0070674_100858700
560 Ga0070673_100029312
561 Ga0070673_100034546
562 Ga0070688_100004946
563 Ga0070688_100072333
564 Ga0070688_100315356
565 Ga0070659_100067597
566 Ga0070667_100010081
567 Ga0070667_101411556
568 Ga0070667_101490859
569 Ga0070701_10172946
570 Ga0070701_10618362
571 Ga0070700_100150696
572 Ga0070663_100106442
573 Ga0070678_100902667
574 Ga0070662_100004418
575 Ga0070662_100026225
576 Ga0070662_100027817
577 Ga0070662_100108240
578 Ga0070662_100495901
579 Ga0068867_100021828
580 Ga0068867_100069744
581 Ga0068867_100300552
582 Ga0068867_101308306
583 Ga0070685_10072464
584 Ga0070685_10113646
585 Ga0070685_10926970
586 Ga0070698_100761299
587 Ga0070684_100002466
588 Ga0070684_100004924
589 Ga0070684_100019362
590 Ga0070684_100040227
591 Ga0070697_100382422
592 Ga0068853_100008314
593 Ga0068853_100111719
594 Ga0068853_100261513
595 Ga0070686_100199214
596 Ga0070686_100200928
597 Ga0070686_100897566
598 Ga0070686_101389579
599 Ga0070665_100686786
600 Ga0068855_102393291
601 Ga0070664_100008221
602 Ga0070664_100027311
603 Ga0070664_100040321
604 Ga0070664_100040374
605 Ga0070664_100208030
606 Ga0070664_101067959
607 Ga0068857_100039434
608 Ga0068857_100091152
609 Ga0068857_100148933
610 Ga0068857_100494025
611 Ga0068857_100620804
612 Ga0068857_101230512
613 Ga0068854_100141284
614 Ga0068854_100525119
615 Ga0068854_100541110
616 Ga0068856_100548432
617 Ga0068856_102329601
618 Ga0068852_100330705
619 Ga0068852_100844259
620 Ga0068852_101245624
621 Ga0068859_100059337
622 Ga0068859_100084296
623 Ga0068859_100120979
624 Ga0068859_100134838
625 Ga0068859_100303029
626 Ga0068859_100440054
627 Ga0068864_100010021
628 Ga0068864_100010208
629 Ga0068864_100130828
630 Ga0068864_100164490
631 Ga0068864_100259167
632 Ga0068866_10659626
633 Ga0068861_100043098
634 Ga0068861_100163698
635 Ga0068861_100505496
636 Ga0068851_10038135
637 Ga0068851_10806568
638 Ga0068863_100206608
639 Ga0068863_100625635
640 Ga0068863_101016328
641 Ga0068863_101382010
642 Ga0068858_100000474
643 Ga0068858_100081212
644 Ga0068858_100171800
645 Ga0068858_100335627
646 Ga0068858_100708402
647 Ga0068858_101326685
648 Ga0068860_100023933
649 Ga0068860_100079998
650 Ga0068860_100204004
651 Ga0068860_100279091
652 Ga0068862_100004512
653 Ga0068862_100563915
654 Ga0068862_100606530
655 Ga0070715_10125616
656 Ga0097621_100202712
657 Ga0097621_100704526
658 Ga0097621_101164064
659 Ga0068871_100026145
660 Ga0068871_100302105
661 Ga0068871_101114163
662 Ga0075428_101581333
663 Ga0075429_100903609
664 Ga0068865_100273961
665 Ga0068865_100328261
666 Ga0068865_100756392
667 Ga0068865_101516396
668 Ga0068865_102089802
669 Ga0097620_100059338
670 Ga0097620_100084293
671 Ga0097620_100120974
672 Ga0097620_100134842
673 Ga0097620_100303021
674 Ga0097620_100440048
675 Ga0097620_100835474
676 Ga0105244_10001053
677 Ga0105240_10630241
678 Ga0111539_10442905
679 Ga0105245_10021721
680 Ga0105243_10857605
681 Ga0105242_10093498
682 Ga0105242_10670488
683 Ga0105242_11710727
684 Ga0105248_10006730
685 Ga0105248_10336550
686 Ga0105249_10001462
687 Ga0105249_10117987
688 Ga0105249_10238517
689 Ga0105249_10257674
690 Ga0105249_11055655
691 Ga0105246_10129502
692 Ga0105246_10174639
693 Ga0157371_10127080
694 Ga0157371_10136957
695 Ga0157371_10197204
696 Ga0157371_10227573
697 Ga0157374_10020128
698 Ga0157374_10043721
699 Ga0157374_10100046
700 Ga0157374_10647671
701 Ga0157378_10019739
702 Ga0157378_10063092
703 Ga0157378_10118512
704 Ga0163162_10001732
705 Ga0163162_10005098
706 Ga0163162_10047958
707 Ga0163162_10169556
708 Ga0163162_10332511
709 Ga0163162_10922897
710 Ga0157372_11036400
711 Ga0157375_10000276
712 Ga0157375_10007748
713 Ga0157375_10040832
714 Ga0157375_10047931
715 Ga0157375_10191015
716 Ga0163163_10000078
717 Ga0163163_10000557
718 Ga0163163_10114242
719 Ga0163163_10309979
720 Ga0163163_10438305
721 Ga0163163_10871057
722 Ga0157380_10008074
723 Ga0157380_10046919
724 Ga0157380_10446787
725 Ga0157380_11195913
726 Ga0157380_11270040
727 Ga0157380_11396964
728 Ga0157377_10002736
729 Ga0157377_10065160
730 Ga0157377_10107343
731 Ga0157377_10462653
732 Ga0157379_10060917
733 Ga0157379_10127135
734 Ga0157379_10738852
735 Ga0157376_10492560
736 Ga0157376_10620610
737 Ga0157376_10633622
738 Ga0157376_11965035
739 Ga0163161_10044239
740 Ga0163161_10134974
741 Ga0163161_10158885
742 Ga0228598_1003826
743 Ga0207697_10019690
744 Ga0207656_10412079
745 Ga0207655_1000184
746 Ga0207642_10351785
747 Ga0207688_10191501
748 Ga0207680_10289067
749 Ga0207647_10008381
750 Ga0207647_10011384
751 Ga0207645_10002700
752 Ga0207645_10043328
753 Ga0207645_10321464
754 Ga0207684_10109267
755 Ga0207649_10003172
756 Ga0207649_10012896
757 Ga0207649_11518552
758 Ga0207681_10001827
759 Ga0207681_10030979
760 Ga0207650_10029640
761 Ga0207650_10148349
762 Ga0207650_10153425
763 Ga0207650_10286896
764 Ga0207650_11061799
765 Ga0207650_11563393
766 Ga0207659_10007092
767 Ga0207659_10039355
768 Ga0207659_10148247
769 Ga0207659_10795264
770 Ga0207644_10164155
771 Ga0207644_10228000
772 Ga0207644_10326195
773 Ga0207644_10676936
774 Ga0207706_10005994
775 Ga0207706_10048725
776 Ga0207706_10070762
777 Ga0207706_10076142
778 Ga0207686_10041634
779 Ga0207686_10277351
780 Ga0207686_10927446
781 Ga0207670_10026753
782 Ga0207670_10161959
783 Ga0207670_10259623
784 Ga0207669_10748732
785 Ga0207704_10614674
786 Ga0207704_11264115
787 Ga0207691_10060623
788 Ga0207691_11036793
789 Ga0207689_10002521
790 Ga0207689_10009467
791 Ga0207689_10019352
792 Ga0207689_10045699
793 Ga0207689_10102437
794 Ga0207689_10321865
795 Ga0207661_10050175
796 Ga0207661_10067384
797 Ga0207661_10400783
798 Ga0207661_10517702
799 Ga0207679_10000720
800 Ga0207679_10038078
801 Ga0207679_10087376
802 Ga0207679_10121186
803 Ga0207679_10843910
804 Ga0207651_10075227
805 Ga0207651_10204276
806 Ga0207651_10237681
807 Ga0207712_10024751
808 Ga0207712_10502526
809 Ga0207668_10064360
810 Ga0207640_10143412
811 Ga0207640_10475794
812 Ga0207658_10395118
813 Ga0207658_10942591
814 Ga0207677_10007509
815 Ga0207677_10034282
816 Ga0207677_10064144
817 Ga0207677_10319593
818 Ga0207677_10719355
819 Ga0207703_10001520
820 Ga0207703_10284465
821 Ga0207703_10353251
822 Ga0207703_10772059
823 Ga0207703_11114625
824 Ga0207639_10004707
825 Ga0207639_10147769
826 Ga0207639_10431672
827 Ga0207678_10020356
828 Ga0207678_10091256
829 Ga0207708_10212975
830 Ga0207708_10652043
831 Ga0207702_10872803
832 Ga0207641_10006923
833 Ga0207641_10222437
834 Ga0207648_10055888
835 Ga0207648_10055991
836 Ga0207648_10082752
837 Ga0207648_10092536
838 Ga0207648_10233688
839 Ga0207676_10006913
840 Ga0207676_10011185
841 Ga0207676_10102998
842 Ga0207676_10469253
843 Ga0207676_10837545
844 Ga0207674_10005440
845 Ga0207674_10007360
846 Ga0207674_10041302
847 Ga0207674_10467977
848 Ga0207674_10488570
849 Ga0207675_100000477
850 Ga0207675_100085121
851 Ga0207675_100209357
852 Ga0207675_101671007
853 Ga0207683_10100822
854 Ga0207698_10061971
855 Ga0207698_11372026
856 Ga0207428_10025061
857 Ga0268266_10523690
858 Ga0268266_11124901
859 Ga0268265_10344231
860 Ga0268265_10375787
861 Ga0268265_10814133
862 Ga0268264_10016711
863 Ga0268264_10145109
864 Ga0268264_10505334
865 Ga0268264_10897051
866 Ga0265337_1005892
867 Ga0265326_10000415
868 Ga0265319_1000545
869 Ga0265334_10045683
870 Ga0265318_10034824
871 Ga0265318_10147463
872 Ga0265322_10012506
873 Ga0265336_10002041
874 Ga0265336_10100129
875 Ga0265338_10001321
876 Ga0265338_10164458
877 Ga0265324_10014514
878 Ga0265330_10183599
879 Ga0265332_10013676
880 Ga0265320_10006625
881 Ga0265325_10060537
882 Ga0265329_10042334
883 Ga0265340_10036695
884 Ga0265339_10024510
885 Ga0265331_10009788
886 Ga0265316_10000750
887 Ga0265316_10003739
888 Ga0265316_10217872
889 Ga0307509_10188221
890 Ga0265313_10008607
891 Ga0265342_10015410
892 Ga0316576_10296152
893 Ga0307410_10712070
894 Ga0307415_100349467
895 Ga0373926_0027426
896 Ga0373953_0450793
897 Ga0373954_0122097
898 Ga0373954_0191824
899 Ga0373956_0057092
900 Ga0373955_0008007
901 Ga0373955_0214846
902 Ga0373924_0188215
903 Ga0373924_0271554
904 Ga0373935_0041270
905 Ga0373927_0001200
906 Ga0373927_0105446
907 Ga0373927_0173289
908 Ga0373933_0000292
909 Ga0373933_0081592
910 Ga0373947_0302411
911 Ga0373937_0001235
912 Ga0373937_0853342
913 Ga0373925_0303833
914 Ga0395900_1547888
915 Ga0395905_0130224
916 Ga0395905_0147537
917 Ga0395905_0780927
918 Ga0395905_1187008
919 Ga0395901_0680029
920 Ga0495592_0026987
921 Ga0495592_0093113
922 Ga0495651_0005675
923 Ga0495653_0021948
924 Ga0495653_0147358
925 Ga0495580_0006576
926 Ga0495664_0083783
927 Ga0495608_0008962
928 Ga0495608_0025715
929 Ga0495608_0196804
930 Ga0495618_0124846
931 Ga0495628_0000100
932 Ga0495628_0027302
933 Ga0495630_0032370
934 Ga0495666_0211154
935 Ga0495652_0002958
936 Ga0495652_0096999
937 Ga0495652_0385698
938 Ga0495652_0791846
939 Ga0495665_0053058
940 Ga0495640_0057831
941 Ga0495586_0003724
942 Ga0495587_0000258
943 Ga0495587_0000765
944 Ga0495587_0010070
945 Ga0495645_0048880
946 Ga0495645_0110815
947 Ga0495667_0001446
948 Ga0495667_0195906
949 Ga0495635_0007465
950 Ga0495635_0072333
951 Ga0495588_0294359
952 Ga0495657_0006868
953 Ga0495599_0001187
954 Ga0495599_0064888
955 Ga0495623_0001574
956 Ga0495623_0060081
957 Ga0495623_0210781
958 Ga0495646_0044842
959 Ga0495658_0263247
960 Ga0495613_0014943
961 Ga0495624_0035768
962 Ga0495600_0006912
963 Ga0495604_0000537
964 Ga0495604_0014905
965 Ga0495604_0018747
966 Ga0495674_0004294
967 Ga0495676_0473157
968 Ga0495680_0000436
969 Ga0495675_0000068
970 Ga0495675_0001001
971 Ga0495675_0014103
972 Ga0495684_0008543
973 Ga0495684_0609624
974 Ga0495684_0796518
975 Ga0495593_0009181
976 Ga0495602_0001306
977 Ga0495602_0004826
978 Ga0495626_0015643
979 Ga0496102_0745448
980 Ga0496108_0314320
981 Ga0496110_0241960
982 Ga0496112_0000961
983 Ga0496114_1006248
984 Ga0501037_0135104
985 Ga0501039_0316527
986 Ga0501071_1083340
987 Ga0501202_001931
988 Ga0501223_039986
989 Ga0501227_056683
990 Ga0501235_040306
991 Ga0501242_011475
992 Ga0501252_045463
993 Ga0501257_002920
994 Ga0501259_001612
995 Ga0501225_0252275
996 Ga0501234_035404
997 Ga0501232_034772
998 Ga0501241_072280
999 Ga0501266_000726
1000 Ga0501268_001979
1001 Ga0501283_065820
1002 nmdc:mga09592_751750_c1
1003 nmdc:mga0qj67_899398_c1
1004 nmdc:mga08y16_235436_c1
1005 Ga0495612_0007892
1006 Ga0500559_0028978
1007 Ga0500622_0218007
1008 3006880495

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

25

127

0.96

PF14437

MafB19-deam

MafB19-like deaminase

27

154

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b3j-assembly2.cif.gz_D crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna 0.9791 11 112
5jfy-assembly1.cif.gz_B crystal structure of a plant cytidine deaminase 0.9717 6 108
5jfy-assembly2.cif.gz_D crystal structure of a plant cytidine deaminase 0.9645 6 108
6vpc-assembly1.cif.gz_F structure of the spcas9 dna adenine base editor - abe8e 0.9631 8 108
3ocq-assembly1.cif.gz_A-2 crystal structure of trna-specific adenosine deaminase from salmonella enterica 0.9611 8 112
ID Description Score Start End Superfamily
af_A0A1D6PV52_1_75_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9867 52 108 3.40.140.10
af_A0A1D6ELV0_114_227_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.981 12 120 3.40.140.10
2b3jA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9769 8 112 3.40.140.10
af_K7K815_1119_1301_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9739 10 113 3.40.140.10
af_A0A2R8Q5F2_236_349_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9656 34 47 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7W1FG80-F1-model_v4 Nucleoside deaminase 0.9978 7 116 GO:0006152
GO:0008270
GO:0047974
AF-A0A2H9LF16-F1-model_v4 Nucleoside deaminase 0.9896 12 109 GO:0006152
GO:0008270
GO:0047974
AF-A0A7X8VJ74-F1-model_v4 Nucleoside deaminase 0.9888 12 122 GO:0006152
GO:0008270
GO:0047974
AF-A0A7Y5M5X1-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9833 16 112 GO:0002100
GO:0008270
GO:0052717
AF-A0A2H9SCA5-F1-model_v4 CMP/dCMP-type deaminase domain-containing protein 0.983 11 121 GO:0003824

Map