F456137

General Info

Members Datasets Scaffolds Average Seq Length
504 224 1008 290

Family's Representative Sequence

Representative Sequence 3300005343|Ga0070687_100110645|Ga0070687_1001106452
Length 339
Sequence MLALSRYLRVVTQFELSAPWSATARAALCYPEQSADKSVHSREVINSKLHNISLRHGLTRIYTNKLTCGHSMNIDTKEARLREIFRELDSVIVAYSGGVDSSYVAYVANAELGPRAVCITGQSASLPAYQRAELDRVVKQFGFQHEVIQTEELDNPDYQANNPNRCFFCKDELYSKLESVARSRGIKHIVDGSTVDDLGDYRPGRQAAAEHAVRSPLIEVGLSKSEVRELSRVATLPTWDKPASPCLSSRIAYGTTVTIERLGKVDRGEEILREFGFREFRVRHHDQLVRLEIAQAEMDRVLRKELIAELARRFRELGFKYVTLDLEGFRSGSMNEILD

Samples

Sample ID Description Type Environment
1 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
169 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
170 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
171 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
172 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
173 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
188 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
189 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
190 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
191 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
192 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
193 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
197 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
198 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
199 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
200 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
201 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
202 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
203 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
204 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
207 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
208 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
211 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
212 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 1.79
Rhizosphere 97.82
Stem 0
Stem Tuber 0
Unclassified 13.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070687_100110645 3300005343 Unclassified 1554
2 CNAas_1000014 3300000532 Bacteria 10766
3 Ga0065712_10067792 3300005290 Bacteria 34297
4 Ga0065712_10103937 3300005290 Bacteria 1973
5 Ga0065715_10092230 3300005293 Bacteria 5239
6 Ga0065715_10131117 3300005293 Bacteria 1974
7 Ga0065715_10346962 3300005293 Unclassified 957
8 Ga0065707_10011098 3300005295 Bacteria 3693
9 Ga0065707_10109736 3300005295 Bacteria 2458
10 Ga0065707_10163839 3300005295 Bacteria 1540
11 Ga0070690_100002756 3300005330 Bacteria 9486
12 Ga0070690_100017510 3300005330 Bacteria 4310
13 Ga0070690_100032254 3300005330 Bacteria 3270
14 Ga0070670_100047922 3300005331 Bacteria 3678
15 Ga0070670_100118374 3300005331 Bacteria 2284
16 Ga0068869_100014151 3300005334 Bacteria 5325
17 Ga0068869_100108908 3300005334 Bacteria 2105
18 Ga0068869_100166829 3300005334 Bacteria 1718
19 Ga0068869_100347794 3300005334 Bacteria 1208
20 Ga0070666_10028056 3300005335 Unclassified 3692
21 Ga0070680_100019410 3300005336 Bacteria 5387
22 Ga0070680_100342755 3300005336 Bacteria 1270
23 Ga0070682_100160679 3300005337 Bacteria 1551
24 Ga0070660_100036113 3300005339 Bacteria 3743
25 Ga0070689_100033851 3300005340 Bacteria 3896
26 Ga0070689_100110320 3300005340 Bacteria 2187
27 Ga0070687_100004529 3300005343 Bacteria 5551
28 Ga0070687_100014435 3300005343 Unclassified 3547
29 Ga0070687_100052799 3300005343 Bacteria 2111
30 Ga0070661_100018529 3300005344 Bacteria 4950
31 Ga0070661_100510635 3300005344 Bacteria 963
32 Ga0070692_10110215 3300005345 Unclassified 1521
33 Ga0070668_100000688 3300005347 Bacteria 23027
34 Ga0070668_100260397 3300005347 Bacteria 1442
35 Ga0070668_100315672 3300005347 Unclassified 1314
36 Ga0070669_100023163 3300005353 Bacteria 4445
37 Ga0070669_100108044 3300005353 Bacteria 2108
38 Ga0070669_100171830 3300005353 Unclassified 1690
39 Ga0070675_100087851 3300005354 Bacteria 2600
40 Ga0070675_100095572 3300005354 Unclassified 2495
41 Ga0070671_100065958 3300005355 Unclassified 3017
42 Ga0070671_100083647 3300005355 Unclassified 2668
43 Ga0070673_100046347 3300005364 Unclassified 3376
44 Ga0070673_100224840 3300005364 Bacteria 1626
45 Ga0070673_100314145 3300005364 Bacteria 1383
46 Ga0070688_100055656 3300005365 Bacteria 2481
47 Ga0070688_100250050 3300005365 Bacteria 1262
48 Ga0070659_100004197 3300005366 Bacteria 10283
49 Ga0070659_100013176 3300005366 Bacteria 6150
50 Ga0070667_100340175 3300005367 Bacteria 1357
51 Ga0070701_10015597 3300005438 Unclassified 3513
52 Ga0070701_10051708 3300005438 Bacteria 2132
53 Ga0070701_10106745 3300005438 Unclassified 1559
54 Ga0070705_100166078 3300005440 Bacteria 1480
55 Ga0070700_100000270 3300005441 Bacteria 27649
56 Ga0070700_100037064 3300005441 Bacteria 2963
57 Ga0070700_100044549 3300005441 Bacteria 2733
58 Ga0070694_100005809 3300005444 Bacteria 7484
59 Ga0070694_100018242 3300005444 Bacteria 4452
60 Ga0070694_100063764 3300005444 Unclassified 2521
61 Ga0070694_100068987 3300005444 Bacteria 2431
62 Ga0070694_100159673 3300005444 Bacteria 1653
63 Ga0070694_100261681 3300005444 Unclassified 1312
64 Ga0070708_100000149 3300005445 Bacteria 48348
65 Ga0070708_100124188 3300005445 Bacteria 2384
66 Ga0070708_100147222 3300005445 Unclassified 2188
67 Ga0070708_100335250 3300005445 Bacteria 1425
68 Ga0070708_100584463 3300005445 Bacteria 1053
69 Ga0070678_100431851 3300005456 Bacteria 1150
70 Ga0070662_100068158 3300005457 Bacteria 2615
71 Ga0070662_100123520 3300005457 Bacteria 1987
72 Ga0070681_10000208 3300005458 Bacteria 45856
73 Ga0070681_10015227 3300005458 Bacteria 7650
74 Ga0070681_10038277 3300005458 Bacteria 4809
75 Ga0070681_10041906 3300005458 Bacteria 4589
76 Ga0068867_100028567 3300005459 Bacteria 4017
77 Ga0068867_100032967 3300005459 Bacteria 3748
78 Ga0068867_100067709 3300005459 Bacteria 2663
79 Ga0070685_10025355 3300005466 Bacteria 3264
80 Ga0070706_100000300 3300005467 Bacteria 60347
81 Ga0070706_100020620 3300005467 Bacteria 6074
82 Ga0070706_100037242 3300005467 Bacteria 4492
83 Ga0070706_100299503 3300005467 Bacteria 1500
84 Ga0070707_100045031 3300005468 Bacteria 4224
85 Ga0070707_100530688 3300005468 Bacteria 1139
86 Ga0070698_100001512 3300005471 Bacteria 25768
87 Ga0070698_100013276 3300005471 Bacteria 8717
88 Ga0070698_100016507 3300005471 Bacteria 7791
89 Ga0070698_100363579 3300005471 Bacteria 1379
90 Ga0070699_100000287 3300005518 Bacteria 48358
91 Ga0070699_100007766 3300005518 Bacteria 9322
92 Ga0070699_100008905 3300005518 Bacteria 8694
93 Ga0070699_100479960 3300005518 Bacteria 1128
94 Ga0070679_100000234 3300005530 Bacteria 45861
95 Ga0070679_100017426 3300005530 Bacteria 6952
96 Ga0070679_100425152 3300005530 Bacteria 1274
97 Ga0070684_100099980 3300005535 Bacteria 2589
98 Ga0070697_100000434 3300005536 Bacteria 32091
99 Ga0070697_100074886 3300005536 Unclassified 2782
100 Ga0070697_100107692 3300005536 Bacteria 2319
101 Ga0070697_100113463 3300005536 Bacteria 2261
102 Ga0070697_100173684 3300005536 Bacteria 1825
103 Ga0070672_100154528 3300005543 Bacteria 1900
104 Ga0070686_100005625 3300005544 Bacteria 6944
105 Ga0070695_100004483 3300005545 Bacteria 8201
106 Ga0070695_100042915 3300005545 Bacteria 2873
107 Ga0070695_100077639 3300005545 Bacteria 2188
108 Ga0070695_100095130 3300005545 Bacteria 1996
109 Ga0070695_100321982 3300005545 Bacteria 1150
110 Ga0070696_100012254 3300005546 Bacteria 5746
111 Ga0070696_100124718 3300005546 Bacteria 1867
112 Ga0070696_100215289 3300005546 Bacteria 1439
113 Ga0070696_100255217 3300005546 Bacteria 1327
114 Ga0070693_100011643 3300005547 Bacteria 4433
115 Ga0070693_100052740 3300005547 Bacteria 2333
116 Ga0070665_100030816 3300005548 Bacteria 5398
117 Ga0070665_100341606 3300005548 Bacteria 1502
118 Ga0070704_100046361 3300005549 Bacteria 3031
119 Ga0070704_100144937 3300005549 Bacteria 1860
120 Ga0070704_100248837 3300005549 Bacteria 1458
121 Ga0070704_100265459 3300005549 Unclassified 1416
122 Ga0068855_100170177 3300005563 Bacteria 2468
123 Ga0070664_100009418 3300005564 Bacteria 7917
124 Ga0070664_100055715 3300005564 Bacteria 3358
125 Ga0068857_100000167 3300005577 Bacteria 41275
126 Ga0068857_100192091 3300005577 Unclassified 1860
127 Ga0068854_100114155 3300005578 Bacteria 2042
128 Ga0068854_100148485 3300005578 Unclassified 1805
129 Ga0068854_100287322 3300005578 Bacteria 1326
130 Ga0068856_100012258 3300005614 Bacteria 8302
131 Ga0068859_100015212 3300005617 Bacteria 7724
132 Ga0068859_100015526 3300005617 Bacteria 7651
133 Ga0068859_100031351 3300005617 Bacteria 5338
134 Ga0068859_100142330 3300005617 Bacteria 2472
135 Ga0068859_100184501 3300005617 Bacteria 2170
136 Ga0068859_100186106 3300005617 Bacteria 2160
137 Ga0068859_100228297 3300005617 Unclassified 1949
138 Ga0068859_100299657 3300005617 Bacteria 1701
139 Ga0068864_100052805 3300005618 Bacteria 3504
140 Ga0068864_100115601 3300005618 Unclassified 2393
141 Ga0068864_100255893 3300005618 Bacteria 1627
142 Ga0068864_100351035 3300005618 Bacteria 1392
143 Ga0068866_10001857 3300005718 Bacteria 8858
144 Ga0068861_100013577 3300005719 Bacteria 5701
145 Ga0068861_100134235 3300005719 Bacteria 2012
146 Ga0068861_100718947 3300005719 Bacteria 930
147 Ga0068870_10032636 3300005840 Bacteria 2650
148 Ga0068863_100056735 3300005841 Bacteria 3707
149 Ga0068863_100255297 3300005841 Bacteria 1694
150 Ga0068858_100477839 3300005842 Unclassified 1203
151 Ga0068860_100010242 3300005843 Bacteria 9278
152 Ga0068860_100021866 3300005843 Bacteria 6189
153 Ga0068860_100076042 3300005843 Bacteria 3193
154 Ga0068860_100344818 3300005843 Unclassified 1465
155 Ga0068860_100488956 3300005843 Unclassified 1227
156 Ga0068862_100007039 3300005844 Bacteria 9339
157 Ga0068862_100016929 3300005844 Bacteria 6068
158 Ga0068862_100041052 3300005844 Bacteria 3935
159 Ga0068862_100261004 3300005844 Unclassified 1581
160 Ga0081539_10000990 3300005985 Bacteria 52811
161 Ga0081539_10003528 3300005985 Bacteria 19042
162 Ga0070715_10000058 3300006163 Bacteria 40861
163 Ga0070716_100000022 3300006173 Bacteria 77227
164 Ga0070716_100018487 3300006173 Bacteria 3633
165 Ga0070716_100113599 3300006173 Bacteria 1683
166 Ga0097621_100015887 3300006237 Bacteria 5677
167 Ga0097621_100029557 3300006237 Bacteria 4329
168 Ga0068871_100005367 3300006358 Bacteria 8982
169 Ga0068871_100017224 3300006358 Bacteria 5463
170 Ga0075430_100007689 3300006846 Bacteria 9103
171 Ga0075433_10018028 3300006852 Bacteria 5860
172 Ga0075433_10062223 3300006852 Bacteria 3269
173 Ga0075433_10456330 3300006852 Bacteria 1126
174 Ga0075434_100063161 3300006871 Bacteria 3686
175 Ga0075434_100268719 3300006871 Bacteria 1725
176 Ga0075434_100480794 3300006871 Bacteria 1263
177 Ga0075429_100301571 3300006880 Bacteria 1402
178 Ga0075429_100389991 3300006880 Unclassified 1219
179 Ga0068865_100011199 3300006881 Bacteria 5607
180 Ga0068865_100100986 3300006881 Bacteria 2112
181 Ga0075436_100078785 3300006914 Unclassified 2282
182 Ga0097620_100015211 3300006931 Bacteria 7724
183 Ga0097620_100015526 3300006931 Bacteria 7651
184 Ga0097620_100031352 3300006931 Bacteria 5338
185 Ga0097620_100050257 3300006931 Unclassified 4188
186 Ga0097620_100142336 3300006931 Bacteria 2472
187 Ga0097620_100184505 3300006931 Bacteria 2170
188 Ga0097620_100186105 3300006931 Bacteria 2160
189 Ga0097620_100228316 3300006931 Unclassified 1949
190 Ga0097620_100299668 3300006931 Bacteria 1701
191 Ga0075435_100121841 3300007076 Bacteria 2177
192 Ga0105240_10202350 3300009093 Bacteria 2326
193 Ga0111539_10155190 3300009094 Unclassified 2678
194 Ga0111539_10167935 3300009094 Unclassified 2564
195 Ga0105245_10049907 3300009098 Bacteria 3749
196 Ga0105245_10257891 3300009098 Bacteria 1696
197 Ga0105245_10501329 3300009098 Unclassified 1230
198 Ga0105247_10002513 3300009101 Bacteria 12464
199 Ga0114129_10000991 3300009147 Bacteria 37136
200 Ga0114129_10005898 3300009147 Bacteria 17336
201 Ga0114129_10235607 3300009147 Bacteria 2463
202 Ga0114129_10666515 3300009147 Bacteria 1341
203 Ga0105243_10007712 3300009148 Bacteria 8276
204 Ga0105243_10088513 3300009148 Bacteria 2544
205 Ga0105243_10097021 3300009148 Bacteria 2439
206 Ga0105243_10762178 3300009148 Unclassified 950
207 Ga0105241_10019634 3300009174 Bacteria 4986
208 Ga0105241_10110674 3300009174 Bacteria 2197
209 Ga0105241_10128197 3300009174 Bacteria 2051
210 Ga0105241_10207189 3300009174 Bacteria 1641
211 Ga0105241_10372726 3300009174 Bacteria 1245
212 Ga0105242_10000639 3300009176 Bacteria 27474
213 Ga0105248_10004560 3300009177 Bacteria 15339
214 Ga0105248_10015394 3300009177 Bacteria 8436
215 Ga0105248_10039728 3300009177 Bacteria 5274
216 Ga0105248_10047204 3300009177 Unclassified 4829
217 Ga0105248_10312350 3300009177 Bacteria 1770
218 Ga0105237_10008624 3300009545 Bacteria 11020
219 Ga0105237_10044705 3300009545 Bacteria 4459
220 Ga0105249_10000270 3300009553 Bacteria 54601
221 Ga0105249_10003336 3300009553 Bacteria 13900
222 Ga0105249_10011058 3300009553 Bacteria 7931
223 Ga0105249_10076967 3300009553 Bacteria 3093
224 Ga0105249_10236690 3300009553 Bacteria 1803
225 Ga0105249_10245288 3300009553 Bacteria 1773
226 Ga0105249_10371715 3300009553 Unclassified 1453
227 Ga0105249_10402409 3300009553 Bacteria 1399
228 Ga0105249_10432800 3300009553 Bacteria 1352
229 Ga0105239_10010221 3300010375 Bacteria 10511
230 Ga0105239_10023160 3300010375 Bacteria 6844
231 Ga0105239_10919078 3300010375 Bacteria 1005
232 Ga0105246_10006527 3300011119 Bacteria 7122
233 Ga0157373_10137088 3300013100 Bacteria 1721
234 Ga0157373_10157208 3300013100 Bacteria 1599
235 Ga0157371_10106109 3300013102 Unclassified 1994
236 Ga0157370_10128875 3300013104 Bacteria 2361
237 Ga0157374_10044899 3300013296 Bacteria 4087
238 Ga0157374_10250791 3300013296 Bacteria 1742
239 Ga0157378_10006922 3300013297 Bacteria 9903
240 Ga0157378_10012477 3300013297 Bacteria 7441
241 Ga0157378_10049829 3300013297 Bacteria 3726
242 Ga0157378_10080608 3300013297 Bacteria 2941
243 Ga0157378_10086865 3300013297 Bacteria 2836
244 Ga0163162_10000006 3300013306 Bacteria 410012
245 Ga0163162_10002634 3300013306 Bacteria 17020
246 Ga0163162_10028061 3300013306 Bacteria 5568
247 Ga0163162_10030030 3300013306 Bacteria 5382
248 Ga0163162_10079686 3300013306 Bacteria 3341
249 Ga0163162_10124325 3300013306 Unclassified 2685
250 Ga0163162_10194684 3300013306 Unclassified 2156
251 Ga0163162_10363324 3300013306 Unclassified 1580
252 Ga0157372_10002278 3300013307 Bacteria 20792
253 Ga0157372_10118635 3300013307 Bacteria 3036
254 Ga0157375_10038319 3300013308 Bacteria 4603
255 Ga0157375_10069048 3300013308 Bacteria 3538
256 Ga0157375_10083598 3300013308 Bacteria 3237
257 Ga0157375_10107919 3300013308 Bacteria 2878
258 Ga0157375_10114785 3300013308 Bacteria 2795
259 Ga0157375_10401841 3300013308 Bacteria 1537
260 Ga0157375_10403181 3300013308 Unclassified 1534
261 Ga0157375_10414260 3300013308 Bacteria 1514
262 Ga0163163_10004983 3300014325 Bacteria 11435
263 Ga0163163_10007685 3300014325 Bacteria 9525
264 Ga0163163_10009730 3300014325 Bacteria 8606
265 Ga0163163_10137221 3300014325 Bacteria 2487
266 Ga0163163_10191866 3300014325 Bacteria 2091
267 Ga0163163_10328431 3300014325 Bacteria 1583
268 Ga0157380_10000752 3300014326 Bacteria 20213
269 Ga0157380_10004518 3300014326 Bacteria 9652
270 Ga0157380_10021211 3300014326 Bacteria 4870
271 Ga0157380_10026821 3300014326 Bacteria 4377
272 Ga0157380_10042023 3300014326 Bacteria 3571
273 Ga0157380_10044795 3300014326 Bacteria 3469
274 Ga0157380_10142618 3300014326 Bacteria 2060
275 Ga0157380_10221908 3300014326 Bacteria 1692
276 Ga0157377_10050255 3300014745 Bacteria 2347
277 Ga0157377_10128766 3300014745 Bacteria 1543
278 Ga0157377_10276843 3300014745 Unclassified 1098
279 Ga0157376_10039305 3300014969 Unclassified 3858
280 Ga0157376_10039455 3300014969 Bacteria 3851
281 Ga0163161_10002459 3300017792 Bacteria 13227
282 Ga0207697_10012577 3300025315 Bacteria 3545
283 Ga0207710_10001817 3300025900 Bacteria 10288
284 Ga0207647_10044740 3300025904 Unclassified 2765
285 Ga0207685_10000150 3300025905 Bacteria 10419
286 Ga0207645_10125031 3300025907 Bacteria 1671
287 Ga0207643_10001354 3300025908 Bacteria 14155
288 Ga0207684_10000367 3300025910 Bacteria 60978
289 Ga0207684_10003627 3300025910 Bacteria 15010
290 Ga0207684_10006170 3300025910 Bacteria 10959
291 Ga0207654_10027714 3300025911 Bacteria 3082
292 Ga0207654_10281857 3300025911 Bacteria 1124
293 Ga0207707_10000031 3300025912 Bacteria 159505
294 Ga0207707_10029469 3300025912 Bacteria 4799
295 Ga0207707_10033203 3300025912 Bacteria 4517
296 Ga0207707_10090192 3300025912 Bacteria 2679
297 Ga0207671_10034763 3300025914 Bacteria 3744
298 Ga0207671_10052907 3300025914 Bacteria 3009
299 Ga0207660_10003817 3300025917 Bacteria 9818
300 Ga0207660_10017303 3300025917 Bacteria 4787
301 Ga0207660_10082156 3300025917 Bacteria 2370
302 Ga0207660_10172186 3300025917 Bacteria 1676
303 Ga0207662_10041012 3300025918 Bacteria 2724
304 Ga0207662_10069473 3300025918 Bacteria 2128
305 Ga0207662_10086158 3300025918 Bacteria 1925
306 Ga0207657_10051695 3300025919 Bacteria 3571
307 Ga0207657_10167990 3300025919 Bacteria 1778
308 Ga0207649_10058882 3300025920 Bacteria 2407
309 Ga0207652_10000063 3300025921 Bacteria 113213
310 Ga0207652_10111989 3300025921 Bacteria 2421
311 Ga0207652_10264000 3300025921 Unclassified 1553
312 Ga0207646_10095164 3300025922 Bacteria 2668
313 Ga0207646_10148286 3300025922 Bacteria 2115
314 Ga0207681_10007910 3300025923 Bacteria 6500
315 Ga0207681_10082988 3300025923 Bacteria 2267
316 Ga0207650_10109919 3300025925 Unclassified 2132
317 Ga0207650_10125229 3300025925 Bacteria 2005
318 Ga0207650_10557508 3300025925 Bacteria 961
319 Ga0207659_10071375 3300025926 Bacteria 2535
320 Ga0207687_10028546 3300025927 Bacteria 3748
321 Ga0207690_10013416 3300025932 Bacteria 4924
322 Ga0207706_10033638 3300025933 Bacteria 4561
323 Ga0207686_10091610 3300025934 Bacteria 2008
324 Ga0207709_10022376 3300025935 Unclassified 3586
325 Ga0207709_10040117 3300025935 Bacteria 2801
326 Ga0207670_10011433 3300025936 Bacteria 5154
327 Ga0207704_10023637 3300025938 Bacteria 3316
328 Ga0207704_10487734 3300025938 Bacteria 991
329 Ga0207665_10000037 3300025939 Bacteria 86011
330 Ga0207665_10069988 3300025939 Bacteria 2393
331 Ga0207665_10143758 3300025939 Bacteria 1703
332 Ga0207691_10003166 3300025940 Bacteria 16085
333 Ga0207691_10047046 3300025940 Bacteria 3962
334 Ga0207711_10002754 3300025941 Bacteria 15490
335 Ga0207711_10024358 3300025941 Bacteria 5069
336 Ga0207711_10104274 3300025941 Bacteria 2512
337 Ga0207711_10374019 3300025941 Unclassified 1321
338 Ga0207689_10001396 3300025942 Bacteria 23022
339 Ga0207689_10047467 3300025942 Bacteria 3545
340 Ga0207689_10113147 3300025942 Bacteria 2231
341 Ga0207689_10177541 3300025942 Bacteria 1756
342 Ga0207689_10270553 3300025942 Bacteria 1407
343 Ga0207661_10181668 3300025944 Bacteria 1838
344 Ga0207679_10007430 3300025945 Bacteria 6950
345 Ga0207651_10445246 3300025960 Bacteria 1110
346 Ga0207712_10001136 3300025961 Bacteria 18552
347 Ga0207712_10020783 3300025961 Bacteria 4304
348 Ga0207712_10023168 3300025961 Unclassified 4096
349 Ga0207712_10079015 3300025961 Bacteria 2389
350 Ga0207712_10199891 3300025961 Unclassified 1584
351 Ga0207668_10002121 3300025972 Bacteria 11576
352 Ga0207640_10075577 3300025981 Unclassified 2284
353 Ga0207640_10099071 3300025981 Bacteria 2039
354 Ga0207677_10173623 3300026023 Unclassified 1688
355 Ga0207677_10276944 3300026023 Unclassified 1375
356 Ga0207703_10135044 3300026035 Unclassified 2135
357 Ga0207703_10469972 3300026035 Bacteria 1177
358 Ga0207639_10012612 3300026041 Bacteria 5890
359 Ga0207708_10000087 3300026075 Bacteria 73043
360 Ga0207708_10029160 3300026075 Bacteria 4181
361 Ga0207708_10038296 3300026075 Bacteria 3653
362 Ga0207708_10055573 3300026075 Bacteria 3018
363 Ga0207708_10284006 3300026075 Bacteria 1342
364 Ga0207702_10022297 3300026078 Bacteria 5249
365 Ga0207641_10015454 3300026088 Bacteria 6254
366 Ga0207641_10035216 3300026088 Bacteria 4169
367 Ga0207641_10307449 3300026088 Bacteria 1499
368 Ga0207648_10032079 3300026089 Bacteria 4641
369 Ga0207648_10034247 3300026089 Bacteria 4477
370 Ga0207648_10203902 3300026089 Unclassified 1755
371 Ga0207676_10006790 3300026095 Bacteria 8102
372 Ga0207676_10009163 3300026095 Bacteria 7046
373 Ga0207676_10030848 3300026095 Bacteria 4027
374 Ga0207676_10143887 3300026095 Unclassified 2045
375 Ga0207674_10002619 3300026116 Bacteria 22514
376 Ga0207674_10170720 3300026116 Bacteria 2128
377 Ga0207674_10507595 3300026116 Bacteria 1165
378 Ga0207675_100005331 3300026118 Bacteria 12355
379 Ga0207675_100020173 3300026118 Bacteria 6215
380 Ga0207675_100023346 3300026118 Bacteria 5752
381 Ga0207675_100033338 3300026118 Bacteria 4798
382 Ga0207675_100144998 3300026118 Bacteria 2257
383 Ga0207683_10731329 3300026121 Bacteria 918
384 Ga0207428_10380262 3300027907 Bacteria 1036
385 Ga0268266_10095223 3300028379 Bacteria 2615
386 Ga0268265_10033088 3300028380 Bacteria 3755
387 Ga0268265_10116739 3300028380 Bacteria 2190
388 Ga0268265_10272040 3300028380 Unclassified 1511
389 Ga0268264_10002997 3300028381 Bacteria 14655
390 Ga0268264_10034154 3300028381 Bacteria 4182
391 Ga0268264_10041187 3300028381 Bacteria 3819
392 Ga0268264_10423425 3300028381 Unclassified 1284
393 Ga0307513_10154650 3300031456 Bacteria 2195
394 Ga0307408_100315439 3300031548 Bacteria 1315
395 Ga0307408_100390300 3300031548 Bacteria 1192
396 Ga0307405_10018107 3300031731 Bacteria 3880
397 Ga0307405_10057876 3300031731 Bacteria 2437
398 Ga0307405_10098902 3300031731 Bacteria 1951
399 Ga0307413_10005424 3300031824 Bacteria 5693
400 Ga0307413_10184805 3300031824 Bacteria 1490
401 Ga0307410_10004253 3300031852 Bacteria 7368
402 Ga0307410_10021872 3300031852 Unclassified 3942
403 Ga0307410_10054175 3300031852 Bacteria 2718
404 Ga0307407_10029665 3300031903 Bacteria 2942
405 Ga0307407_10043135 3300031903 Bacteria 2534
406 Ga0307412_10010089 3300031911 Bacteria 5433
407 Ga0307409_100155453 3300031995 Bacteria 1992
408 Ga0307416_100020585 3300032002 Bacteria 4712
409 Ga0307416_100022806 3300032002 Bacteria 4528
410 Ga0307416_100179998 3300032002 Bacteria 1980
411 Ga0307416_100285791 3300032002 Bacteria 1630
412 Ga0307414_10169987 3300032004 Unclassified 1741
413 Ga0307414_10209721 3300032004 Bacteria 1591
414 Ga0307411_10006298 3300032005 Bacteria 5925
415 Ga0307411_10034880 3300032005 Bacteria 3135
416 Ga0307415_100004872 3300032126 Bacteria 7047
417 Ga0307415_100010724 3300032126 Bacteria 5205
418 Ga0307415_100019221 3300032126 Bacteria 4144
419 Ga0307415_100020858 3300032126 Bacteria 4011
420 Ga0373941_0004635 3300035115 Bacteria 3188
421 Ga0395900_0150681 3300037418 Bacteria 2376
422 Ga0395900_0398131 3300037418 Bacteria 1342
423 Ga0395898_0031376 3300037466 Bacteria 5310
424 Ga0395898_0360633 3300037466 Bacteria 1386
425 Ga0395905_0019673 3300037471 Bacteria 6399
426 Ga0439439_0006831 3300041406 Bacteria 2647
427 Ga0439448_0004461 3300042005 Bacteria 3951
428 Ga0439455_0000521 3300042012 Bacteria 5374
429 Ga0439458_0002915 3300042157 Bacteria 4107
430 Ga0439434_0023880 3300042435 Bacteria 1842
431 Ga0439464_0032972 3300042439 Bacteria 1456
432 Ga0495629_0110772 3300046459 Bacteria 1914
433 Ga0495628_0081784 3300046516 Bacteria 2509
434 Ga0495598_0005788 3300046537 Bacteria 2761
435 Ga0495668_0002659 3300046616 Bacteria 14365
436 Ga0495636_0009724 3300047318 Bacteria 3787
437 Ga0496102_0019245 3300048905 Bacteria 6014
438 Ga0496103_0056035 3300048906 Bacteria 2446
439 Ga0496104_0179992 3300048907 Unclassified 2024
440 Ga0496104_0246383 3300048907 Bacteria 1700
441 Ga0496107_0064944 3300048910 Bacteria 2646
442 Ga0496108_0233605 3300048911 Bacteria 1599
443 Ga0496109_0432848 3300048912 Unclassified 1243
444 Ga0496111_0107632 3300048914 Bacteria 2053
445 Ga0496112_0480562 3300048915 Bacteria 1179
446 Ga0501290_005798 3300049513 Bacteria 1540
447 Ga0501291_000563 3300049514 Bacteria 4289
448 Ga0501292_000592 3300049515 Bacteria 4446
449 Ga0501292_001038 3300049515 Bacteria 3388
450 Ga0501296_000563 3300049519 Bacteria 3643
451 Ga0501296_001355 3300049519 Bacteria 2476
452 Ga0501297_007539 3300049520 Bacteria 1184
453 Ga0501298_006018 3300049521 Bacteria 1970
454 Ga0501298_008427 3300049521 Bacteria 1732
455 Ga0501299_006723 3300049522 Bacteria 1812
456 Ga0501038_0003172 3300049574 Bacteria 15333
457 Ga0501048_0069908 3300049582 Bacteria 2480
458 Ga0501202_013996 3300049652 Bacteria 1531
459 Ga0501202_015894 3300049652 Bacteria 1454
460 Ga0501206_003139 3300049653 Bacteria 2098
461 Ga0501207_005110 3300049654 Bacteria 1807
462 Ga0501217_002524 3300049661 Bacteria 3612
463 Ga0501217_041755 3300049661 Bacteria 1170
464 Ga0501224_003836 3300049664 Bacteria 2116
465 Ga0501224_005271 3300049664 Bacteria 1847
466 Ga0501230_010358 3300049667 Unclassified 1453
467 Ga0501235_034791 3300049669 Bacteria 1143
468 Ga0501240_003799 3300049673 Bacteria 1714
469 Ga0501246_004001 3300049676 Bacteria 1204
470 Ga0501249_012379 3300049679 Bacteria 1802
471 Ga0501249_026147 3300049679 Unclassified 1289
472 Ga0501256_001481 3300049685 Bacteria 1741
473 Ga0501257_026576 3300049686 Bacteria 1382
474 Ga0501260_000303 3300049689 Bacteria 3859
475 Ga0501225_0000834 3300049705 Bacteria 9599
476 Ga0501225_0008523 3300049705 Bacteria 2940
477 Ga0501234_002567 3300049707 Bacteria 2859
478 Ga0501245_001048 3300049708 Bacteria 3559
479 Ga0501283_002164 3300049779 Bacteria 2551
480 Ga0501283_004662 3300049779 Bacteria 1860
481 nmdc:mga05p37_133445_c1 3300050507 Bacteria 3046
482 nmdc:mga05p37_205534_c1 3300050507 Unclassified 2382
483 nmdc:mga05p37_29684_c1 3300050507 Bacteria 6672
484 nmdc:mga05p37_46664_c1 3300050507 Bacteria 5326
485 nmdc:mga09592_143693_c1 3300050508 Bacteria 2057
486 nmdc:mga09592_230713_c1 3300050508 Unclassified 1604
487 nmdc:mga0qj67_237494_c1 3300050509 Bacteria 1479
488 nmdc:mga0qj67_77882_c1 3300050509 Bacteria 2653
489 nmdc:mga06r32_63044_c1 3300050510 Bacteria 3572
490 nmdc:mga08y16_5245_c1 3300050511 Bacteria 13536
491 nmdc:mga0n895_171470_c1 3300050512 Bacteria 2202
492 nmdc:mga0n895_458407_c1 3300050512 Bacteria 1287
493 nmdc:mga0n895_69544_c1 3300050512 Unclassified 3488
494 nmdc:mga0n895_79435_c1 3300050512 Bacteria 3267
495 nmdc:mga08x19_66938_c1 3300050514 Unclassified 2336
496 nmdc:mga0a205_10513_c2 3300050515 Bacteria 3105
497 nmdc:mga0a205_10674_c1 3300050515 Bacteria 8442
498 nmdc:mga0a205_118027_c1 3300050515 Bacteria 2551
499 nmdc:mga0a205_15436_c1 3300050515 Bacteria 7138
500 nmdc:mga0a205_477597_c1 3300050515 Bacteria 1105
501 Ga0495601_0017092 3300053077 Unclassified 4402
502 Ga0495619_0200386 3300053085 Unclassified 1382
503 Ga0500616_0000469 3300053153 Bacteria 52534
504 Ga0530510_0002214 3300061734 Bacteria 13345
505 Ga0070687_100110645
506 CNAas_1000014
507 Ga0065712_10067792
508 Ga0065712_10103937
509 Ga0065715_10092230
510 Ga0065715_10131117
511 Ga0065715_10346962
512 Ga0065707_10011098
513 Ga0065707_10109736
514 Ga0065707_10163839
515 Ga0070690_100002756
516 Ga0070690_100017510
517 Ga0070690_100032254
518 Ga0070670_100047922
519 Ga0070670_100118374
520 Ga0068869_100014151
521 Ga0068869_100108908
522 Ga0068869_100166829
523 Ga0068869_100347794
524 Ga0070666_10028056
525 Ga0070680_100019410
526 Ga0070680_100342755
527 Ga0070682_100160679
528 Ga0070660_100036113
529 Ga0070689_100033851
530 Ga0070689_100110320
531 Ga0070687_100004529
532 Ga0070687_100014435
533 Ga0070687_100052799
534 Ga0070661_100018529
535 Ga0070661_100510635
536 Ga0070692_10110215
537 Ga0070668_100000688
538 Ga0070668_100260397
539 Ga0070668_100315672
540 Ga0070669_100023163
541 Ga0070669_100108044
542 Ga0070669_100171830
543 Ga0070675_100087851
544 Ga0070675_100095572
545 Ga0070671_100065958
546 Ga0070671_100083647
547 Ga0070673_100046347
548 Ga0070673_100224840
549 Ga0070673_100314145
550 Ga0070688_100055656
551 Ga0070688_100250050
552 Ga0070659_100004197
553 Ga0070659_100013176
554 Ga0070667_100340175
555 Ga0070701_10015597
556 Ga0070701_10051708
557 Ga0070701_10106745
558 Ga0070705_100166078
559 Ga0070700_100000270
560 Ga0070700_100037064
561 Ga0070700_100044549
562 Ga0070694_100005809
563 Ga0070694_100018242
564 Ga0070694_100063764
565 Ga0070694_100068987
566 Ga0070694_100159673
567 Ga0070694_100261681
568 Ga0070708_100000149
569 Ga0070708_100124188
570 Ga0070708_100147222
571 Ga0070708_100335250
572 Ga0070708_100584463
573 Ga0070678_100431851
574 Ga0070662_100068158
575 Ga0070662_100123520
576 Ga0070681_10000208
577 Ga0070681_10015227
578 Ga0070681_10038277
579 Ga0070681_10041906
580 Ga0068867_100028567
581 Ga0068867_100032967
582 Ga0068867_100067709
583 Ga0070685_10025355
584 Ga0070706_100000300
585 Ga0070706_100020620
586 Ga0070706_100037242
587 Ga0070706_100299503
588 Ga0070707_100045031
589 Ga0070707_100530688
590 Ga0070698_100001512
591 Ga0070698_100013276
592 Ga0070698_100016507
593 Ga0070698_100363579
594 Ga0070699_100000287
595 Ga0070699_100007766
596 Ga0070699_100008905
597 Ga0070699_100479960
598 Ga0070679_100000234
599 Ga0070679_100017426
600 Ga0070679_100425152
601 Ga0070684_100099980
602 Ga0070697_100000434
603 Ga0070697_100074886
604 Ga0070697_100107692
605 Ga0070697_100113463
606 Ga0070697_100173684
607 Ga0070672_100154528
608 Ga0070686_100005625
609 Ga0070695_100004483
610 Ga0070695_100042915
611 Ga0070695_100077639
612 Ga0070695_100095130
613 Ga0070695_100321982
614 Ga0070696_100012254
615 Ga0070696_100124718
616 Ga0070696_100215289
617 Ga0070696_100255217
618 Ga0070693_100011643
619 Ga0070693_100052740
620 Ga0070665_100030816
621 Ga0070665_100341606
622 Ga0070704_100046361
623 Ga0070704_100144937
624 Ga0070704_100248837
625 Ga0070704_100265459
626 Ga0068855_100170177
627 Ga0070664_100009418
628 Ga0070664_100055715
629 Ga0068857_100000167
630 Ga0068857_100192091
631 Ga0068854_100114155
632 Ga0068854_100148485
633 Ga0068854_100287322
634 Ga0068856_100012258
635 Ga0068859_100015212
636 Ga0068859_100015526
637 Ga0068859_100031351
638 Ga0068859_100142330
639 Ga0068859_100184501
640 Ga0068859_100186106
641 Ga0068859_100228297
642 Ga0068859_100299657
643 Ga0068864_100052805
644 Ga0068864_100115601
645 Ga0068864_100255893
646 Ga0068864_100351035
647 Ga0068866_10001857
648 Ga0068861_100013577
649 Ga0068861_100134235
650 Ga0068861_100718947
651 Ga0068870_10032636
652 Ga0068863_100056735
653 Ga0068863_100255297
654 Ga0068858_100477839
655 Ga0068860_100010242
656 Ga0068860_100021866
657 Ga0068860_100076042
658 Ga0068860_100344818
659 Ga0068860_100488956
660 Ga0068862_100007039
661 Ga0068862_100016929
662 Ga0068862_100041052
663 Ga0068862_100261004
664 Ga0081539_10000990
665 Ga0081539_10003528
666 Ga0070715_10000058
667 Ga0070716_100000022
668 Ga0070716_100018487
669 Ga0070716_100113599
670 Ga0097621_100015887
671 Ga0097621_100029557
672 Ga0068871_100005367
673 Ga0068871_100017224
674 Ga0075430_100007689
675 Ga0075433_10018028
676 Ga0075433_10062223
677 Ga0075433_10456330
678 Ga0075434_100063161
679 Ga0075434_100268719
680 Ga0075434_100480794
681 Ga0075429_100301571
682 Ga0075429_100389991
683 Ga0068865_100011199
684 Ga0068865_100100986
685 Ga0075436_100078785
686 Ga0097620_100015211
687 Ga0097620_100015526
688 Ga0097620_100031352
689 Ga0097620_100050257
690 Ga0097620_100142336
691 Ga0097620_100184505
692 Ga0097620_100186105
693 Ga0097620_100228316
694 Ga0097620_100299668
695 Ga0075435_100121841
696 Ga0105240_10202350
697 Ga0111539_10155190
698 Ga0111539_10167935
699 Ga0105245_10049907
700 Ga0105245_10257891
701 Ga0105245_10501329
702 Ga0105247_10002513
703 Ga0114129_10000991
704 Ga0114129_10005898
705 Ga0114129_10235607
706 Ga0114129_10666515
707 Ga0105243_10007712
708 Ga0105243_10088513
709 Ga0105243_10097021
710 Ga0105243_10762178
711 Ga0105241_10019634
712 Ga0105241_10110674
713 Ga0105241_10128197
714 Ga0105241_10207189
715 Ga0105241_10372726
716 Ga0105242_10000639
717 Ga0105248_10004560
718 Ga0105248_10015394
719 Ga0105248_10039728
720 Ga0105248_10047204
721 Ga0105248_10312350
722 Ga0105237_10008624
723 Ga0105237_10044705
724 Ga0105249_10000270
725 Ga0105249_10003336
726 Ga0105249_10011058
727 Ga0105249_10076967
728 Ga0105249_10236690
729 Ga0105249_10245288
730 Ga0105249_10371715
731 Ga0105249_10402409
732 Ga0105249_10432800
733 Ga0105239_10010221
734 Ga0105239_10023160
735 Ga0105239_10919078
736 Ga0105246_10006527
737 Ga0157373_10137088
738 Ga0157373_10157208
739 Ga0157371_10106109
740 Ga0157370_10128875
741 Ga0157374_10044899
742 Ga0157374_10250791
743 Ga0157378_10006922
744 Ga0157378_10012477
745 Ga0157378_10049829
746 Ga0157378_10080608
747 Ga0157378_10086865
748 Ga0163162_10000006
749 Ga0163162_10002634
750 Ga0163162_10028061
751 Ga0163162_10030030
752 Ga0163162_10079686
753 Ga0163162_10124325
754 Ga0163162_10194684
755 Ga0163162_10363324
756 Ga0157372_10002278
757 Ga0157372_10118635
758 Ga0157375_10038319
759 Ga0157375_10069048
760 Ga0157375_10083598
761 Ga0157375_10107919
762 Ga0157375_10114785
763 Ga0157375_10401841
764 Ga0157375_10403181
765 Ga0157375_10414260
766 Ga0163163_10004983
767 Ga0163163_10007685
768 Ga0163163_10009730
769 Ga0163163_10137221
770 Ga0163163_10191866
771 Ga0163163_10328431
772 Ga0157380_10000752
773 Ga0157380_10004518
774 Ga0157380_10021211
775 Ga0157380_10026821
776 Ga0157380_10042023
777 Ga0157380_10044795
778 Ga0157380_10142618
779 Ga0157380_10221908
780 Ga0157377_10050255
781 Ga0157377_10128766
782 Ga0157377_10276843
783 Ga0157376_10039305
784 Ga0157376_10039455
785 Ga0163161_10002459
786 Ga0207697_10012577
787 Ga0207710_10001817
788 Ga0207647_10044740
789 Ga0207685_10000150
790 Ga0207645_10125031
791 Ga0207643_10001354
792 Ga0207684_10000367
793 Ga0207684_10003627
794 Ga0207684_10006170
795 Ga0207654_10027714
796 Ga0207654_10281857
797 Ga0207707_10000031
798 Ga0207707_10029469
799 Ga0207707_10033203
800 Ga0207707_10090192
801 Ga0207671_10034763
802 Ga0207671_10052907
803 Ga0207660_10003817
804 Ga0207660_10017303
805 Ga0207660_10082156
806 Ga0207660_10172186
807 Ga0207662_10041012
808 Ga0207662_10069473
809 Ga0207662_10086158
810 Ga0207657_10051695
811 Ga0207657_10167990
812 Ga0207649_10058882
813 Ga0207652_10000063
814 Ga0207652_10111989
815 Ga0207652_10264000
816 Ga0207646_10095164
817 Ga0207646_10148286
818 Ga0207681_10007910
819 Ga0207681_10082988
820 Ga0207650_10109919
821 Ga0207650_10125229
822 Ga0207650_10557508
823 Ga0207659_10071375
824 Ga0207687_10028546
825 Ga0207690_10013416
826 Ga0207706_10033638
827 Ga0207686_10091610
828 Ga0207709_10022376
829 Ga0207709_10040117
830 Ga0207670_10011433
831 Ga0207704_10023637
832 Ga0207704_10487734
833 Ga0207665_10000037
834 Ga0207665_10069988
835 Ga0207665_10143758
836 Ga0207691_10003166
837 Ga0207691_10047046
838 Ga0207711_10002754
839 Ga0207711_10024358
840 Ga0207711_10104274
841 Ga0207711_10374019
842 Ga0207689_10001396
843 Ga0207689_10047467
844 Ga0207689_10113147
845 Ga0207689_10177541
846 Ga0207689_10270553
847 Ga0207661_10181668
848 Ga0207679_10007430
849 Ga0207651_10445246
850 Ga0207712_10001136
851 Ga0207712_10020783
852 Ga0207712_10023168
853 Ga0207712_10079015
854 Ga0207712_10199891
855 Ga0207668_10002121
856 Ga0207640_10075577
857 Ga0207640_10099071
858 Ga0207677_10173623
859 Ga0207677_10276944
860 Ga0207703_10135044
861 Ga0207703_10469972
862 Ga0207639_10012612
863 Ga0207708_10000087
864 Ga0207708_10029160
865 Ga0207708_10038296
866 Ga0207708_10055573
867 Ga0207708_10284006
868 Ga0207702_10022297
869 Ga0207641_10015454
870 Ga0207641_10035216
871 Ga0207641_10307449
872 Ga0207648_10032079
873 Ga0207648_10034247
874 Ga0207648_10203902
875 Ga0207676_10006790
876 Ga0207676_10009163
877 Ga0207676_10030848
878 Ga0207676_10143887
879 Ga0207674_10002619
880 Ga0207674_10170720
881 Ga0207674_10507595
882 Ga0207675_100005331
883 Ga0207675_100020173
884 Ga0207675_100023346
885 Ga0207675_100033338
886 Ga0207675_100144998
887 Ga0207683_10731329
888 Ga0207428_10380262
889 Ga0268266_10095223
890 Ga0268265_10033088
891 Ga0268265_10116739
892 Ga0268265_10272040
893 Ga0268264_10002997
894 Ga0268264_10034154
895 Ga0268264_10041187
896 Ga0268264_10423425
897 Ga0307513_10154650
898 Ga0307408_100315439
899 Ga0307408_100390300
900 Ga0307405_10018107
901 Ga0307405_10057876
902 Ga0307405_10098902
903 Ga0307413_10005424
904 Ga0307413_10184805
905 Ga0307410_10004253
906 Ga0307410_10021872
907 Ga0307410_10054175
908 Ga0307407_10029665
909 Ga0307407_10043135
910 Ga0307412_10010089
911 Ga0307409_100155453
912 Ga0307416_100020585
913 Ga0307416_100022806
914 Ga0307416_100179998
915 Ga0307416_100285791
916 Ga0307414_10169987
917 Ga0307414_10209721
918 Ga0307411_10006298
919 Ga0307411_10034880
920 Ga0307415_100004872
921 Ga0307415_100010724
922 Ga0307415_100019221
923 Ga0307415_100020858
924 Ga0373941_0004635
925 Ga0395900_0150681
926 Ga0395900_0398131
927 Ga0395898_0031376
928 Ga0395898_0360633
929 Ga0395905_0019673
930 Ga0439439_0006831
931 Ga0439448_0004461
932 Ga0439455_0000521
933 Ga0439458_0002915
934 Ga0439434_0023880
935 Ga0439464_0032972
936 Ga0495629_0110772
937 Ga0495628_0081784
938 Ga0495598_0005788
939 Ga0495668_0002659
940 Ga0495636_0009724
941 Ga0496102_0019245
942 Ga0496103_0056035
943 Ga0496104_0179992
944 Ga0496104_0246383
945 Ga0496107_0064944
946 Ga0496108_0233605
947 Ga0496109_0432848
948 Ga0496111_0107632
949 Ga0496112_0480562
950 Ga0501290_005798
951 Ga0501291_000563
952 Ga0501292_000592
953 Ga0501292_001038
954 Ga0501296_000563
955 Ga0501296_001355
956 Ga0501297_007539
957 Ga0501298_006018
958 Ga0501298_008427
959 Ga0501299_006723
960 Ga0501038_0003172
961 Ga0501048_0069908
962 Ga0501202_013996
963 Ga0501202_015894
964 Ga0501206_003139
965 Ga0501207_005110
966 Ga0501217_002524
967 Ga0501217_041755
968 Ga0501224_003836
969 Ga0501224_005271
970 Ga0501230_010358
971 Ga0501235_034791
972 Ga0501240_003799
973 Ga0501246_004001
974 Ga0501249_012379
975 Ga0501249_026147
976 Ga0501256_001481
977 Ga0501257_026576
978 Ga0501260_000303
979 Ga0501225_0000834
980 Ga0501225_0008523
981 Ga0501234_002567
982 Ga0501245_001048
983 Ga0501283_002164
984 Ga0501283_004662
985 nmdc:mga05p37_133445_c1
986 nmdc:mga05p37_205534_c1
987 nmdc:mga05p37_29684_c1
988 nmdc:mga05p37_46664_c1
989 nmdc:mga09592_143693_c1
990 nmdc:mga09592_230713_c1
991 nmdc:mga0qj67_237494_c1
992 nmdc:mga0qj67_77882_c1
993 nmdc:mga06r32_63044_c1
994 nmdc:mga08y16_5245_c1
995 nmdc:mga0n895_171470_c1
996 nmdc:mga0n895_458407_c1
997 nmdc:mga0n895_69544_c1
998 nmdc:mga0n895_79435_c1
999 nmdc:mga08x19_66938_c1
1000 nmdc:mga0a205_10513_c2
1001 nmdc:mga0a205_10674_c1
1002 nmdc:mga0a205_118027_c1
1003 nmdc:mga0a205_15436_c1
1004 nmdc:mga0a205_477597_c1
1005 Ga0495601_0017092
1006 Ga0495619_0200386
1007 Ga0500616_0000469
1008 Ga0530510_0002214

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6utq-assembly1.cif.gz_E lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase in complex with cadmium 0.928 34 291
6dg3-assembly2.cif.gz_D lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with caesium 0.9233 34 290
6utq-assembly1.cif.gz_E lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase in complex with cadmium 0.9207 34 291
6dg3-assembly2.cif.gz_D lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with caesium 0.9197 34 290
5udw-assembly1.cif.gz_B lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with nickel 0.9193 34 291
ID Description Score Start End Superfamily
af_Q58240_5_163_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9425 36 197 3.40.50.620
af_Q58240_5_163_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9085 36 197 3.40.50.620
2c5sA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7755 50 206 3.40.50.620
af_A0A1D8PQF2_17_249_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7525 50 158 3.40.50.620
af_P18843_1_275_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7375 33 205 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2G4I8Q6-F1-model_v4 TIGR00268 family protein 0.9883 34 238 GO:0016783
AF-A0A350I4H1-F1-model_v4 ATP-dependent sacrificial sulfur transferase LarE 0.985 38 247 GO:0016783
AF-A0A1G1QJS3-F1-model_v4 TIGR00268 family protein 0.9849 35 228 GO:0016783
AF-A0A354BF41-F1-model_v4 ATP-dependent sacrificial sulfur transferase LarE 0.9842 35 235 GO:0004066
GO:0006529
GO:0016783
AF-A0A382P008-F1-model_v4 Asparagine synthetase domain-containing protein 0.983 46 222 GO:0004066
GO:0006529
GO:0016783

Map