F456125

General Info

Members Datasets Scaffolds Average Seq Length
504 288 454 296

Family's Representative Sequence

Representative Sequence 3300005262|Ga0065165_1016467|Ga0065165_10164672
Length 325
Sequence MAKDIRGGQFSAGPPQGKLAPSGGSAAHEVASVGAKAVLALTFNAFVWGVSWWPLRQLQSLGLHPLWTTALVYAIVVAGLLVLLPRAWRGFVAHPQLWFLAAASGLTNVGFNWAVTVGDVVRVVLLFYLMPAWSVLVAWAMLGEKPTPASLLRLLLAMAGVLIVLKGPDSPWPVPQGGADWLAIMGGFSFALTNAGLRKYHHTPSESRMLAMFGGSGLMAACAALLGMSQAVVPAGIPVALGLALVFMASNACLQYGAARLAAGTTAIVMLTEILFACLSSAALGAAELTPRILLGGSLIVLAALLAAMAPSASAQTAPGGAESR

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221570 Acidovorax sp. Root568 Isolate Unclassified
9 2643221596 Acidovorax sp. Root70 Isolate Unclassified
10 2643221609 Acidovorax sp. Root217 Isolate Unclassified
11 2643221611 Acidovorax sp. Root219 Isolate Unclassified
12 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
13 2643221652 Acidovorax sp. Root402 Isolate Unclassified
14 2643221658 Variovorax sp. Root411 Isolate Unclassified
15 2643221672 Variovorax sp. Root434 Isolate Unclassified
16 2643221683 Variovorax sp. Root473 Isolate Unclassified
17 2643221717 Acidovorax sp. Root267 Isolate Unclassified
18 2738541277 Variovorax sp. GV051 Isolate Unclassified
19 2738541307 Variovorax sp. GV008 Isolate Unclassified
20 2738543019 Variovorax sp. GV040 Isolate Unclassified
21 2818991446 Variovorax sp. 1180 Isolate Unclassified
22 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
23 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
24 2842677519 Variovorax sp. R-72495 Isolate Unclassified
25 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
26 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
27 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
28 2885198086 Variovorax sp. 679 Isolate Unclassified
29 2885211737 Variovorax sp. 553 Isolate Unclassified
30 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
31 2899924645 Variovorax sp. 369 Isolate Unclassified
32 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
33 2904456579 Variovorax sp. 2002 Isolate Unclassified
34 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
35 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
36 2928037797 Variovorax sp. 1126 Isolate Unclassified
37 2928044640 Variovorax sp. 1128 Isolate Unclassified
38 2928051484 Variovorax sp. 1133 Isolate Unclassified
39 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
40 2928070936 Variovorax gossypii 1167 Isolate Unclassified
41 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
42 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
43 2929520902 Variovorax beijingensis 502 Isolate Unclassified
44 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
45 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
46 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
47 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
48 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
49 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
50 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
51 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
52 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
53 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
54 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
55 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
56 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
57 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
58 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
59 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
60 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
61 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
62 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
63 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
64 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
65 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
66 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
67 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
68 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
69 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
70 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
71 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
72 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
73 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
74 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
75 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
76 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
77 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
78 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
79 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
80 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
81 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
82 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
83 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
84 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
97 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
103 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
123 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
127 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
132 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
133 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
134 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
136 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
137 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
149 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
170 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
171 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
176 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
177 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
178 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
179 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
180 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
181 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
182 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
198 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
199 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
200 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
201 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
202 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
203 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
204 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
205 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
206 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
207 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
208 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
209 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
210 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
211 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
212 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
213 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
214 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
217 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
228 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
229 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
230 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
231 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
232 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
233 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
234 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
237 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
245 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
253 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
259 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
260 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
261 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
268 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
269 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
270 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
271 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
272 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
273 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
274 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
275 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
276 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
277 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
278 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
279 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
280 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
281 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
282 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
283 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
284 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
285 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
286 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
287 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
288 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.68
Metatranscriptomes 0.4
Isolates 9.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 43.06
Nodule 1.59
Rhizoplane 0.99
Rhizosphere 40.48
Stem 0
Stem Tuber 0
Unclassified 13.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10004830 3300001989 Bacteria 5136
2 JGI25155J39150_1000009 3300002704 Bacteria 224358
3 JGI25156J39149_1000009 3300002705 Bacteria 224379
4 JGI25154J39366_1000024 3300002738 Bacteria 211372
5 JGI25157J39369_1000007 3300002741 Bacteria 224377
6 JGI25152J39213_1008034 3300002773 Bacteria 2661
7 JGI25152J39213_1008066 3300002773 Bacteria 2652
8 JGI25150J39212_1005626 3300002774 Bacteria 2658
9 JGI25150J39212_1007023 3300002774 Bacteria 2287
10 JGI25159J45721_1000402 3300002987 Bacteria 20189
11 JGI25159J45721_1000474 3300002987 Bacteria 18495
12 JGI25159J45721_1004711 3300002987 Bacteria 4437
13 JGI25151J46595_10002245 3300003187 Bacteria 11867
14 JGI25151J46595_10004593 3300003187 Bacteria 7274
15 JGI25151J46595_10005427 3300003187 Bacteria 6588
16 JGI25151J46595_10009207 3300003187 Bacteria 4695
17 JGI25151J46595_10022047 3300003187 Bacteria 2652
18 JGI25151J46595_10023052 3300003187 Bacteria 2572
19 JGI25153J46596_10018950 3300003215 Bacteria 2652
20 JGI25153J46596_10019727 3300003215 Bacteria 2572
21 rootH2_10010858 3300003320 Bacteria 2347
22 JGI25160J50197_1000117 3300003354 Bacteria 72240
23 JGI25160J50197_1008403 3300003354 Bacteria 3937
24 JGI25160J50197_1011450 3300003354 Bacteria 3146
25 JGI25161J50226_1000009 3300003374 Bacteria 224699
26 JGI25161J50226_1009100 3300003374 Bacteria 1452
27 Ga0006562J51391_1126692 3300003578 Bacteria 4200
28 Ga0006562J51391_1126693 3300003578 Bacteria 3830
29 Ga0055535_1000125 3300003761 Bacteria 81678
30 Ga0055535_1002551 3300003761 Bacteria 6158
31 Ga0055542_1000013 3300003762 Bacteria 387560
32 Ga0055529_1000266 3300003763 Bacteria 62097
33 Ga0055526_1006870 3300003771 Bacteria 6065
34 Ga0055526_1010171 3300003771 Bacteria 4412
35 Ga0055526_1018008 3300003771 Bacteria 2662
36 Ga0055526_1018085 3300003771 Bacteria 2652
37 Ga0055537_1000020 3300003773 Bacteria 117325
38 Ga0055537_1000214 3300003773 Bacteria 42837
39 Ga0055537_1007353 3300003773 Bacteria 2662
40 Ga0055537_1007398 3300003773 Bacteria 2652
41 Ga0055524_1000047 3300003775 Bacteria 150887
42 Ga0055524_1000143 3300003775 Bacteria 84686
43 Ga0055524_1000242 3300003775 Bacteria 57160
44 Ga0055524_1016377 3300003775 Bacteria 2662
45 Ga0055524_1016465 3300003775 Bacteria 2652
46 Ga0055536_1002209 3300003781 Bacteria 11083
47 Ga0055536_1007280 3300003781 Bacteria 4981
48 Ga0055536_1015797 3300003781 Bacteria 2561
49 Ga0055536_1032157 3300003781 Bacteria 1361
50 Ga0055534_1000138 3300003784 Bacteria 54891
51 Ga0055534_1000967 3300003784 Bacteria 12750
52 Ga0055534_1007301 3300003784 Bacteria 2652
53 Ga0055528_1000812 3300003790 Bacteria 21450
54 Ga0055528_1003127 3300003790 Bacteria 8495
55 Ga0055528_1016179 3300003790 Bacteria 2652
56 Ga0055530_10000252 3300003791 Bacteria 48125
57 Ga0055530_10002944 3300003791 Bacteria 10295
58 Ga0055530_10004226 3300003791 Bacteria 7540
59 Ga0055530_10006749 3300003791 Bacteria 5015
60 Ga0055540_1000015 3300003792 Bacteria 232986
61 Ga0055540_1000027 3300003792 Bacteria 187454
62 Ga0055540_1001076 3300003792 Bacteria 17344
63 Ga0055540_1002406 3300003792 Bacteria 9910
64 Ga0055540_1004757 3300003792 Bacteria 5983
65 Ga0055540_1005798 3300003792 Bacteria 5075
66 Ga0055540_1012469 3300003792 Bacteria 2666
67 Ga0055531_10007431 3300003794 Bacteria 5983
68 Ga0055531_10014344 3300003794 Bacteria 3572
69 Ga0055531_10014413 3300003794 Bacteria 3558
70 Ga0055531_10020943 3300003794 Bacteria 2561
71 Ga0055543_1001706 3300004625 Bacteria 8290
72 Ga0055543_1005555 3300004625 Bacteria 3198
73 Ga0055543_1005588 3300004625 Bacteria 3184
74 Ga0065165_1013790 3300005262 Bacteria 3184
75 Ga0065165_1016467 3300005262 Bacteria 2766
76 Ga0065165_1019222 3300005262 Bacteria 2447
77 Ga0065165_1019695 3300005262 Bacteria 2398
78 Ga0065714_10093785 3300005288 Bacteria 1836
79 Ga0070658_10116131 3300005327 Bacteria 2220
80 Ga0068869_100154206 3300005334 Bacteria 1784
81 Ga0070666_10138653 3300005335 Bacteria 1694
82 Ga0070660_100170741 3300005339 Bacteria 1756
83 Ga0070673_100466331 3300005364 Bacteria 1138
84 Ga0070659_100098371 3300005366 Bacteria 2352
85 Ga0070659_100347577 3300005366 Bacteria 1244
86 Ga0070662_100005501 3300005457 Bacteria 8098
87 Ga0068853_100013887 3300005539 Bacteria 6584
88 Ga0068853_100014190 3300005539 Bacteria 6522
89 Ga0068853_100177777 3300005539 Bacteria 1929
90 Ga0070665_100467379 3300005548 Bacteria 1272
91 Ga0068855_100010586 3300005563 Bacteria 11117
92 Ga0070664_100026989 3300005564 Bacteria 4770
93 Ga0068857_100055664 3300005577 Bacteria 3509
94 Ga0068857_100327690 3300005577 Bacteria 1415
95 Ga0068862_100069262 3300005844 Bacteria 3045
96 Ga0075365_10004393 3300006038 Bacteria 7465
97 Ga0075363_100030228 3300006048 Bacteria 2803
98 Ga0075363_100091094 3300006048 Bacteria 1678
99 Ga0075364_10018833 3300006051 Bacteria 4329
100 Ga0075432_10004491 3300006058 Bacteria 4754
101 Ga0075432_10093299 3300006058 Bacteria 1104
102 Ga0075362_10000355 3300006177 Bacteria 13170
103 Ga0075362_10003400 3300006177 Bacteria 5555
104 Ga0075362_10026092 3300006177 Bacteria 2493
105 Ga0075362_10063545 3300006177 Bacteria 1674
106 Ga0075366_10005918 3300006195 Bacteria 6651
107 Ga0075366_10009770 3300006195 Bacteria 5364
108 Ga0097621_100103281 3300006237 Bacteria 2401
109 Ga0075370_10004520 3300006353 Bacteria 6770
110 Ga0075370_10007100 3300006353 Bacteria 5686
111 Ga0075370_10016133 3300006353 Bacteria 4015
112 Ga0075370_10041550 3300006353 Bacteria 2595
113 Ga0079104_1000040 3300006946 Bacteria 187962
114 Ga0079104_1006807 3300006946 Bacteria 4243
115 Ga0099826_10006310 3300006948 Bacteria 8624
116 Ga0099826_10050491 3300006948 Bacteria 2798
117 Ga0105244_10004516 3300009036 Bacteria 9550
118 Ga0105240_10161932 3300009093 Bacteria 2657
119 Ga0105240_10249632 3300009093 Bacteria 2053
120 Ga0105240_10383689 3300009093 Bacteria 1586
121 Ga0105245_10079170 3300009098 Bacteria 3000
122 Ga0105243_10015445 3300009148 Bacteria 5770
123 Ga0105243_10042934 3300009148 Bacteria 3542
124 Ga0105243_10047945 3300009148 Bacteria 3366
125 Ga0105243_10186794 3300009148 Bacteria 1807
126 Ga0105243_10272502 3300009148 Bacteria 1520
127 Ga0105241_10114311 3300009174 Bacteria 2165
128 Ga0105242_10215474 3300009176 Bacteria 1713
129 Ga0105237_10077552 3300009545 Bacteria 3312
130 Ga0105237_10220151 3300009545 Bacteria 1898
131 Ga0105238_10096829 3300009551 Bacteria 2937
132 Ga0105239_10017760 3300010375 Bacteria 7869
133 Ga0105239_10197715 3300010375 Bacteria 2252
134 Ga0105239_10324126 3300010375 Bacteria 1737
135 Ga0105246_10047070 3300011119 Bacteria 2944
136 Ga0157326_1001224 3300012513 Bacteria 2862
137 Ga0157373_10047612 3300013100 Bacteria 3057
138 Ga0157373_10140210 3300013100 Bacteria 1700
139 Ga0157370_10007331 3300013104 Bacteria 12037
140 Ga0157370_10053378 3300013104 Bacteria 3854
141 Ga0157370_10270206 3300013104 Bacteria 1571
142 Ga0157370_10341621 3300013104 Bacteria 1380
143 Ga0157369_10004674 3300013105 Bacteria 16095
144 Ga0157372_10060373 3300013307 Bacteria 4243
145 Ga0182008_10005416 3300014497 Bacteria 7274
146 Ga0182008_10007902 3300014497 Bacteria 5838
147 Ga0157376_10001672 3300014969 Bacteria 14728
148 Ga0182006_1005451 3300015261 Bacteria 6069
149 Ga0182007_10000359 3300015262 Bacteria 28779
150 Ga0182005_1026981 3300015265 Bacteria 1567
151 Ga0183362_10004 3300015683 Bacteria 569303
152 Ga0163161_10004277 3300017792 Bacteria 9958
153 Ga0163161_10006464 3300017792 Bacteria 8114
154 Ga0163161_10081708 3300017792 Bacteria 2380
155 Ga0213872_10078435 3300021361 Bacteria 1484
156 Ga0209435_100051 3300025206 Bacteria 90866
157 Ga0209672_100842 3300025228 Bacteria 14143
158 Ga0209147_101753 3300025229 Bacteria 6953
159 Ga0207427_100805 3300025231 Bacteria 14194
160 Ga0209258_100020 3300025242 Bacteria 565241
161 Ga0209258_100071 3300025242 Bacteria 278319
162 Ga0207425_1000286 3300025245 Bacteria 36973
163 Ga0207425_1001207 3300025245 Bacteria 11414
164 Ga0207425_1004978 3300025245 Bacteria 3869
165 Ga0209646_1000029 3300025246 Bacteria 386414
166 Ga0209026_1000016 3300025250 Bacteria 386457
167 Ga0209148_1000031 3300025254 Bacteria 564601
168 Ga0209148_1005652 3300025254 Bacteria 2828
169 Ga0209759_1000016 3300025256 Bacteria 386414
170 Ga0209759_1003065 3300025256 Bacteria 6879
171 Ga0209759_1004340 3300025256 Bacteria 5327
172 Ga0209129_1000406 3300025258 Bacteria 33954
173 Ga0209129_1006854 3300025258 Bacteria 3552
174 Ga0209129_1010455 3300025258 Bacteria 2312
175 Ga0209129_1012672 3300025258 Bacteria 1914
176 Ga0209565_1000078 3300025263 Bacteria 160838
177 Ga0209565_1000122 3300025263 Bacteria 111132
178 Ga0209565_1000181 3300025263 Bacteria 77793
179 Ga0209565_1000389 3300025263 Bacteria 37285
180 Ga0209565_1006560 3300025263 Bacteria 3251
181 Ga0209455_1000030 3300025272 Bacteria 533479
182 Ga0209673_1000302 3300025273 Bacteria 91221
183 Ga0209673_1000442 3300025273 Bacteria 71413
184 Ga0209673_1002784 3300025273 Bacteria 11379
185 Ga0209673_1003132 3300025273 Bacteria 10105
186 Ga0209130_1000014 3300025284 Bacteria 412039
187 Ga0209130_1000443 3300025284 Bacteria 43777
188 Ga0209130_1000673 3300025284 Bacteria 30982
189 Ga0209130_1000896 3300025284 Bacteria 24144
190 Ga0209675_1000055 3300025291 Bacteria 193129
191 Ga0209675_1000098 3300025291 Bacteria 130512
192 Ga0209675_1000813 3300025291 Bacteria 20583
193 Ga0209675_1002955 3300025291 Bacteria 8385
194 Ga0209675_1007067 3300025291 Bacteria 4374
195 Ga0209676_1000013 3300025292 Bacteria 816080
196 Ga0209676_1000040 3300025292 Bacteria 438184
197 Ga0209676_1000312 3300025292 Bacteria 95234
198 Ga0209676_1000403 3300025292 Bacteria 78171
199 Ga0209676_1004981 3300025292 Bacteria 7123
200 Ga0209676_1007089 3300025292 Bacteria 5365
201 Ga0209676_1008907 3300025292 Bacteria 4408
202 Ga0209025_1000242 3300025294 Bacteria 128169
203 Ga0209025_1000512 3300025294 Bacteria 74071
204 Ga0209025_1001359 3300025294 Bacteria 32831
205 Ga0209025_1006224 3300025294 Bacteria 9362
206 Ga0209025_1010557 3300025294 Bacteria 6245
207 Ga0209025_1011762 3300025294 Bacteria 5710
208 Ga0209025_1013212 3300025294 Bacteria 5211
209 Ga0209025_1063133 3300025294 Bacteria 1369
210 Ga0209564_1000157 3300025295 Bacteria 164758
211 Ga0209564_1000181 3300025295 Bacteria 151002
212 Ga0209564_1001334 3300025295 Bacteria 26281
213 Ga0209564_1002255 3300025295 Bacteria 15800
214 Ga0209564_1014126 3300025295 Bacteria 3343
215 Ga0209564_1028720 3300025295 Bacteria 1769
216 Ga0209758_1000042 3300025297 Bacteria 407145
217 Ga0209758_1009559 3300025297 Bacteria 5994
218 Ga0209758_1028484 3300025297 Bacteria 2360
219 Ga0209050_1000008 3300025298 Bacteria 1144179
220 Ga0209050_1000021 3300025298 Bacteria 574406
221 Ga0209050_1000416 3300025298 Bacteria 78976
222 Ga0209050_1001095 3300025298 Bacteria 32903
223 Ga0209050_1002484 3300025298 Bacteria 15616
224 Ga0209050_1003213 3300025298 Bacteria 12363
225 Ga0209050_1009055 3300025298 Bacteria 5175
226 Ga0209050_1027068 3300025298 Bacteria 1900
227 Ga0209256_1000039 3300025299 Bacteria 372337
228 Ga0209256_1000056 3300025299 Bacteria 283044
229 Ga0209256_1000092 3300025299 Bacteria 210547
230 Ga0209256_1000124 3300025299 Bacteria 165390
231 Ga0207426_1000055 3300025302 Bacteria 374450
232 Ga0207426_1000079 3300025302 Bacteria 314709
233 Ga0207426_1000224 3300025302 Bacteria 130233
234 Ga0207426_1000714 3300025302 Bacteria 38628
235 Ga0209051_1000005 3300025303 Bacteria 1142353
236 Ga0209051_1000020 3300025303 Bacteria 508628
237 Ga0209051_1000111 3300025303 Bacteria 153024
238 Ga0209051_1000423 3300025303 Bacteria 58174
239 Ga0209051_1000436 3300025303 Bacteria 56547
240 Ga0209051_1001711 3300025303 Bacteria 17515
241 Ga0209051_1012249 3300025303 Bacteria 4159
242 Ga0209257_1000031 3300025304 Bacteria 688770
243 Ga0209257_1000043 3300025304 Bacteria 512127
244 Ga0209257_1000215 3300025304 Bacteria 136521
245 Ga0209257_1002414 3300025304 Bacteria 18681
246 Ga0209257_1004980 3300025304 Bacteria 9718
247 Ga0209257_1009402 3300025304 Bacteria 5250
248 Ga0209257_1039284 3300025304 Bacteria 1424
249 Ga0207655_1002888 3300025728 Bacteria 13260
250 Ga0207705_10037091 3300025909 Bacteria 3488
251 Ga0207654_10023541 3300025911 Bacteria 3300
252 Ga0207695_10024120 3300025913 Bacteria 6852
253 Ga0207695_10044724 3300025913 Bacteria 4707
254 Ga0207695_10115514 3300025913 Bacteria 2658
255 Ga0207671_10319907 3300025914 Bacteria 1228
256 Ga0207657_10057984 3300025919 Bacteria 3335
257 Ga0207687_10014639 3300025927 Bacteria 5135
258 Ga0207690_10147699 3300025932 Bacteria 1740
259 Ga0207690_10300290 3300025932 Bacteria 1256
260 Ga0207706_10021609 3300025933 Bacteria 5778
261 Ga0207686_10114838 3300025934 Bacteria 1822
262 Ga0207709_10000092 3300025935 Bacteria 139154
263 Ga0207709_10003441 3300025935 Bacteria 9431
264 Ga0207709_10014960 3300025935 Bacteria 4295
265 Ga0207709_10061945 3300025935 Bacteria 2339
266 Ga0207691_10029901 3300025940 Bacteria 5096
267 Ga0207689_10143162 3300025942 Bacteria 1970
268 Ga0207679_10009878 3300025945 Bacteria 6127
269 Ga0207667_10133774 3300025949 Bacteria 2554
270 Ga0207677_10121666 3300026023 Bacteria 1964
271 Ga0207639_10085203 3300026041 Bacteria 2513
272 Ga0207639_10087118 3300026041 Bacteria 2488
273 Ga0207639_10143911 3300026041 Bacteria 1990
274 Ga0207674_10039615 3300026116 Bacteria 4884
275 Ga0207674_10169432 3300026116 Bacteria 2137
276 Ga0207674_10245201 3300026116 Bacteria 1739
277 Ga0209281_1000074 3300027111 Bacteria 267848
278 Ga0209282_1006211 3300027666 Bacteria 7407
279 Ga0209813_10034557 3300027866 Bacteria 1509
280 Ga0207428_10032174 3300027907 Bacteria 4317
281 Ga0268265_10051003 3300028380 Bacteria 3121
282 Ga0307515_10000322 3300028794 Bacteria 118563
283 Ga0307515_10154615 3300028794 Bacteria 2376
284 Ga0307515_10234451 3300028794 Bacteria 1620
285 Ga0316177_1120901 3300030731 Bacteria 3538
286 Ga0316176_1025030 3300030732 Bacteria 2737
287 Ga0314311_1202462 3300030733 Bacteria 8678
288 Ga0316179_1046469 3300030734 Bacteria 3149
289 Ga0316180_1115950 3300030736 Bacteria 3206
290 Ga0316183_1020911 3300030742 Bacteria 4082
291 Ga0316183_1088416 3300030742 Bacteria 1561
292 Ga0316181_1042333 3300030744 Bacteria 3351
293 Ga0316182_1437589 3300030745 Bacteria 4815
294 Ga0307513_10175997 3300031456 Bacteria 2010
295 Ga0307408_100000171 3300031548 Bacteria 73180
296 Ga0307408_100002947 3300031548 Bacteria 11794
297 Ga0307408_100017619 3300031548 Bacteria 4782
298 Ga0307408_100247481 3300031548 Bacteria 1468
299 Ga0307514_10010202 3300031649 Bacteria 7862
300 Ga0307516_10000669 3300031730 Bacteria 46347
301 Ga0307516_10001573 3300031730 Bacteria 31413
302 Ga0307405_10035861 3300031731 Bacteria 2966
303 Ga0307405_10216039 3300031731 Bacteria 1403
304 Ga0307405_10440258 3300031731 Bacteria 1030
305 Ga0307406_10000302 3300031901 Bacteria 29005
306 Ga0307406_10010800 3300031901 Bacteria 5159
307 Ga0307406_10429719 3300031901 Bacteria 1054
308 Ga0307407_10063177 3300031903 Bacteria 2171
309 Ga0307407_10170345 3300031903 Bacteria 1433
310 Ga0307412_10023714 3300031911 Bacteria 3779
311 Ga0307412_10033132 3300031911 Bacteria 3281
312 Ga0307412_10075178 3300031911 Bacteria 2316
313 Ga0307412_10179025 3300031911 Bacteria 1592
314 Ga0307412_10450180 3300031911 Bacteria 1060
315 Ga0307409_100328702 3300031995 Bacteria 1434
316 Ga0307416_100002326 3300032002 Bacteria 10866
317 Ga0307414_10242470 3300032004 Bacteria 1493
318 Ga0307414_10342811 3300032004 Bacteria 1280
319 Ga0307411_10134065 3300032005 Bacteria 1815
320 Ga0395905_0002408 3300037471 Bacteria 20790
321 Ga0395905_0091275 3300037471 Bacteria 2856
322 Ga0395905_0335870 3300037471 Bacteria 1402
323 Ga0436361_0581452 3300039447 Bacteria 1604
324 Ga0439436_0003801 3300041404 Bacteria 4620
325 Ga0439439_0037839 3300041406 Bacteria 1245
326 Ga0439466_0018627 3300041411 Bacteria 2490
327 Ga0439465_0020015 3300041413 Bacteria 2094
328 Ga0439431_0022557 3300041997 Bacteria 1518
329 Ga0439433_0007334 3300041999 Bacteria 2380
330 Ga0439432_007137 3300042006 Bacteria 3970
331 Ga0439432_036290 3300042006 Bacteria 1577
332 Ga0439449_0005867 3300042007 Bacteria 4693
333 Ga0439449_0007132 3300042007 Bacteria 4253
334 Ga0439449_0056936 3300042007 Bacteria 1443
335 Ga0439457_036068 3300042014 Bacteria 1100
336 Ga0439462_0001238 3300042015 Bacteria 5597
337 Ga0450919_009463 3300042121 Bacteria 1118
338 Ga0450923_001455 3300042125 Bacteria 3145
339 Ga0450923_003583 3300042125 Bacteria 2361
340 Ga0450894_005252 3300042131 Bacteria 1677
341 Ga0450906_003084 3300042145 Bacteria 3611
342 Ga0450907_009272 3300042146 Bacteria 1632
343 Ga0450910_000307 3300042147 Bacteria 5684
344 Ga0439434_0027077 3300042435 Bacteria 1732
345 Ga0439434_0042515 3300042435 Bacteria 1397
346 Ga0450893_0005005 3300042532 Bacteria 2116
347 Ga0450893_0016040 3300042532 Bacteria 1266
348 Ga0451577_0114505 3300042876 Bacteria 2414
349 Ga0466965_0022889 3300044683 Bacteria 3014
350 Ga0466966_0133539 3300044684 Bacteria 1519
351 Ga0466957_0063313 3300044842 Bacteria 2273
352 Ga0451576_0558701 3300045051 Bacteria 1202
353 Ga0495627_018518 3300046453 Bacteria 2346
354 Ga0495627_049479 3300046453 Bacteria 1269
355 Ga0495629_0205104 3300046459 Bacteria 1362
356 Ga0495638_0038867 3300046460 Bacteria 3022
357 Ga0495639_0038490 3300046475 Bacteria 2148
358 Ga0495583_0000018 3300046506 Bacteria 306541
359 Ga0495606_0152641 3300046507 Bacteria 1354
360 Ga0495608_0120892 3300046511 Bacteria 1680
361 Ga0495610_0021220 3300046512 Bacteria 3577
362 Ga0495616_0001014 3300046513 Bacteria 20099
363 Ga0495620_0101664 3300046515 Bacteria 1145
364 Ga0495631_0000623 3300046518 Bacteria 23292
365 Ga0495637_0010173 3300046520 Bacteria 4558
366 Ga0495663_0031849 3300046525 Bacteria 1568
367 Ga0495654_0017875 3300046530 Bacteria 3721
368 Ga0495656_0000344 3300046615 Bacteria 15772
369 Ga0495668_0028662 3300046616 Bacteria 3149
370 Ga0495625_0000206 3300046660 Bacteria 94070
371 Ga0495625_0209406 3300046660 Bacteria 1282
372 Ga0495625_0241254 3300046660 Bacteria 1176
373 Ga0495588_0021944 3300046674 Bacteria 3151
374 Ga0495588_0175857 3300046674 Bacteria 1131
375 Ga0495646_0253143 3300046680 Bacteria 943
376 Ga0495670_0018286 3300046691 Bacteria 3451
377 Ga0495671_0001944 3300046692 Bacteria 13254
378 Ga0495600_0089501 3300046809 Bacteria 2008
379 Ga0495676_0010564 3300047321 Bacteria 8362
380 Ga0495593_0011415 3300047673 Bacteria 5104
381 Ga0495614_0001168 3300048089 Bacteria 11252
382 Ga0495615_0011907 3300048090 Bacteria 1781
383 Ga0496101_0019692 3300048904 Bacteria 4612
384 Ga0496102_0044007 3300048905 Bacteria 4050
385 Ga0496116_0012073 3300048919 Bacteria 7081
386 Ga0496116_0039421 3300048919 Bacteria 3267
387 Ga0496117_0130098 3300048920 Bacteria 1527
388 Ga0496117_0245075 3300048920 Bacteria 981
389 Ga0496118_0015236 3300048921 Bacteria 7133
390 Ga0496118_0039468 3300048921 Bacteria 3766
391 Ga0496121_0047824 3300048924 Bacteria 3645
392 Ga0496121_0171464 3300048924 Bacteria 1575
393 Ga0496122_0003360 3300048925 Bacteria 21088
394 Ga0496122_0019803 3300048925 Bacteria 6126
395 Ga0496122_0081447 3300048925 Bacteria 2253
396 Ga0496123_0020815 3300048926 Bacteria 5117
397 Ga0496123_0044746 3300048926 Bacteria 3024
398 Ga0496123_0173972 3300048926 Bacteria 1132
399 Ga0496124_0047958 3300048927 Bacteria 3652
400 Ga0496124_0108964 3300048927 Bacteria 2233
401 Ga0496124_0232616 3300048927 Bacteria 1377
402 Ga0496125_0000233 3300048928 Bacteria 113820
403 Ga0496125_0027256 3300048928 Bacteria 5184
404 Ga0496125_0144809 3300048928 Bacteria 1645
405 Ga0496126_0235376 3300048929 Bacteria 1532
406 Ga0501031_0004024 3300049568 Bacteria 9486
407 Ga0501249_001704 3300049679 Bacteria 4477
408 Ga0501225_0009810 3300049705 Bacteria 2720
409 Ga0501262_000531 3300049759 Bacteria 4535
410 nmdc:mga03683_1119_c2 3300050489 Bacteria 6881
411 nmdc:mga03683_26314_c1 3300050489 Bacteria 2294
412 nmdc:mga03683_6009_c1 3300050489 Bacteria 4135
413 nmdc:mga03683_7868_c1 3300050489 Bacteria 3722
414 nmdc:mga03683_86962_c1 3300050489 Bacteria 1358
415 nmdc:mga00v17_29089_c1 3300050491 Bacteria 3241
416 nmdc:mga00v17_50543_c1 3300050491 Bacteria 2526
417 nmdc:mga0yw44_7162_c1 3300050492 Bacteria 5462
418 nmdc:mga0k408_24129_c1 3300050493 Bacteria 3436
419 nmdc:mga0k408_27523_c1 3300050493 Bacteria 3229
420 nmdc:mga0k408_68504_c1 3300050493 Bacteria 2070
421 nmdc:mga04h51_52265_c1 3300050495 Bacteria 1375
422 nmdc:mga07m45_105117_c1 3300050496 Bacteria 1624
423 nmdc:mga07m45_118066_c1 3300050496 Bacteria 1531
424 nmdc:mga07m45_13846_c1 3300050496 Bacteria 4286
425 nmdc:mga07m45_4236_c2 3300050496 Bacteria 4481
426 nmdc:mga07m45_482_c1 3300050496 Bacteria 16838
427 nmdc:mga07m45_7586_c1 3300050496 Bacteria 5548
428 Ga0500610_0018955 3300053079 Bacteria 3337
429 Ga0500635_0000021 3300053080 Bacteria 110194
430 Ga0500643_011226 3300053087 Bacteria 3281
431 Ga0500651_0008027 3300053093 Bacteria 6180
432 Ga0500651_0040192 3300053093 Bacteria 2946
433 Ga0500566_0028806 3300053094 Bacteria 3244
434 Ga0500571_000946 3300053110 Bacteria 12752
435 Ga0500572_049114 3300053111 Bacteria 1251
436 Ga0500593_001323 3300053117 Bacteria 8923
437 Ga0500593_007770 3300053117 Bacteria 4383
438 Ga0500607_001064 3300053121 Bacteria 25861
439 Ga0500607_068200 3300053121 Bacteria 1841
440 Ga0500608_001241 3300053122 Bacteria 9094
441 Ga0500614_087402 3300053123 Bacteria 881
442 Ga0500618_031247 3300053125 Bacteria 1249
443 Ga0500626_137298 3300053128 Bacteria 1030
444 Ga0500655_001630 3300053133 Bacteria 4223
445 Ga0500658_0137324 3300053134 Bacteria 1094
446 Ga0500658_0137326 3300053134 Bacteria 1094
447 Ga0500559_0027197 3300053136 Bacteria 2440
448 Ga0500564_032460 3300053138 Bacteria 2408
449 Ga0500568_0000624 3300053139 Bacteria 25510
450 Ga0500627_0000293 3300053158 Bacteria 13978
451 Ga0500634_0006664 3300053161 Bacteria 5612
452 Ga0500634_0039744 3300053161 Bacteria 2557
453 Ga0500638_045943 3300053162 Bacteria 2118
454 Ga0500636_0004379 3300053177 Bacteria 7987

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100000171 Ga0307408_10000017142 233
2 3300031901 Ga0307406_10000302 Ga0307406_100003029 233
3 3300006946 Ga0079104_1000040 Ga0079104_100004018 238
4 3300027111 Ga0209281_1000074 Ga0209281_100007498 238
5 3300003775 Ga0055524_1000242 Ga0055524_100024230 244
6 3300025299 Ga0209256_1000092 Ga0209256_100009278 244
7 3300021361 Ga0213872_10078435 Ga0213872_100784352 245
8 3300039447 Ga0436361_0581452 Ga0436361_0581452_291_1235 245
9 3300025298 Ga0209050_1002484 Ga0209050_10024842 246
10 3300025256 Ga0209759_1003065 Ga0209759_10030655 247
11 3300028794 Ga0307515_10234451 Ga0307515_102344512 248
12 3300050493 nmdc:mga0k408_68504_c1 nmdc:mga0k408_68504_c1_348_1244 248
13 3300050496 nmdc:mga07m45_105117_c1 nmdc:mga07m45_105117_c1_589_1485 248
14 3300048920 Ga0496117_0245075 Ga0496117_0245075_213_971 252
15 3300009093 Ga0105240_10383689 Ga0105240_103836892 253
16 3300005339 Ga0070660_100170741 Ga0070660_1001707412 254
17 3300025919 Ga0207657_10057984 Ga0207657_100579844 254
18 3300037471 Ga0395905_0335870 Ga0395905_0335870_295_1194 255
19 3300006353 Ga0075370_10007100 Ga0075370_100071003 257
20 3300050496 nmdc:mga07m45_7586_c1 nmdc:mga07m45_7586_c1_2069_2977 257
21 3300003791 Ga0055530_10004226 Ga0055530_100042265 258
22 3300003792 Ga0055540_1000015 Ga0055540_100001519 258
23 3300025298 Ga0209050_1000416 Ga0209050_100041632 258
24 3300025303 Ga0209051_1000020 Ga0209051_1000020267 258
25 3300025913 Ga0207695_10115514 Ga0207695_101155143 258
26 3300031730 Ga0307516_10001573 Ga0307516_1000157316 262
27 3300003792 Ga0055540_1005798 Ga0055540_10057982 264
28 3300025303 Ga0209051_1012249 Ga0209051_10122494 264
29 3300002987 JGI25159J45721_1000402 JGI25159J45721_100040213 266
30 3300003354 JGI25160J50197_1000117 JGI25160J50197_100011743 266
31 3300003374 JGI25161J50226_1000009 JGI25161J50226_1000009154 266
32 3300004625 Ga0055543_1001706 Ga0055543_10017068 266
33 3300005262 Ga0065165_1019222 Ga0065165_10192222 266
34 3300005327 Ga0070658_10116131 Ga0070658_101161312 266
35 3300025284 Ga0209130_1000014 Ga0209130_100001474 266
36 3300025298 Ga0209050_1003213 Ga0209050_10032137 266
37 3300025302 Ga0207426_1000224 Ga0207426_100022474 266
38 3300042532 Ga0450893_0005005 Ga0450893_0005005_315_1256 266
39 3300053080 Ga0500635_0000021 Ga0500635_0000021_32044_32937 267
40 3300042007 Ga0439449_0005867 Ga0439449_0005867_3835_4683 268
41 3300053123 Ga0500614_087402 Ga0500614_087402_59_868 269
42 3300053128 Ga0500626_137298 Ga0500626_137298_28_837 269
43 3300048925 Ga0496122_0019803 Ga0496122_0019803_5176_6081 270
44 3300049568 Ga0501031_0004024 Ga0501031_0004024_5108_5986 270
45 3300028794 Ga0307515_10000322 Ga0307515_10000322113 272
46 3300031456 Ga0307513_10175997 Ga0307513_101759972 272
47 3300044842 Ga0466957_0063313 Ga0466957_0063313_1361_2260 273
48 3300050489 nmdc:mga03683_86962_c1 nmdc:mga03683_86962_c1_456_1340 273
49 3300003781 Ga0055536_1032157 Ga0055536_10321572 275
50 3300025292 Ga0209676_1007089 Ga0209676_10070892 275
51 3300025304 Ga0209257_1039284 Ga0209257_10392842 275
52 3300006948 Ga0099826_10050491 Ga0099826_100504912 276
53 3300002774 JGI25150J39212_1007023 JGI25150J39212_10070233 277
54 3300003187 JGI25151J46595_10005427 JGI25151J46595_1000542710 277
55 3300025245 Ga0207425_1004978 Ga0207425_10049782 277
56 3300025263 Ga0209565_1000389 Ga0209565_100038935 277
57 3300025291 Ga0209675_1002955 Ga0209675_10029553 277
58 3300025294 Ga0209025_1006224 Ga0209025_10062242 277
59 3300025297 Ga0209758_1028484 Ga0209758_10284842 277
60 3300009093 Ga0105240_10249632 Ga0105240_102496322 278
61 3300046475 Ga0495639_0038490 Ga0495639_0038490_460_1320 278
62 3300046511 Ga0495608_0120892 Ga0495608_0120892_796_1656 278
63 3300003187 JGI25151J46595_10004593 JGI25151J46595_100045935 279
64 3300025294 Ga0209025_1000512 Ga0209025_100051255 279
65 3300003761 Ga0055535_1000125 Ga0055535_100012534 280
66 3300003763 Ga0055529_1000266 Ga0055529_100026620 280
67 3300003771 Ga0055526_1010171 Ga0055526_10101716 280
68 3300012513 Ga0157326_1001224 Ga0157326_10012243 280
69 3300025231 Ga0207427_100805 Ga0207427_10080515 280
70 3300025242 Ga0209258_100071 Ga0209258_100071169 280
71 3300025254 Ga0209148_1005652 Ga0209148_10056522 280
72 3300025256 Ga0209759_1004340 Ga0209759_10043406 280
73 3300025272 Ga0209455_1000030 Ga0209455_1000030102 280
74 3300025295 Ga0209564_1002255 Ga0209564_10022556 280
75 3300025913 Ga0207695_10044724 Ga0207695_100447244 280
76 3300031730 Ga0307516_10000669 Ga0307516_1000066940 280
77 3300046506 Ga0495583_0000018 Ga0495583_0000018_232912_233814 280
78 3300046616 Ga0495668_0028662 Ga0495668_0028662_402_1268 280
79 3300048925 Ga0496122_0003360 Ga0496122_0003360_4822_5727 280
80 3300048926 Ga0496123_0020815 Ga0496123_0020815_2680_3585 280
81 3300048927 Ga0496124_0232616 Ga0496124_0232616_328_1233 280
82 3300048928 Ga0496125_0000233 Ga0496125_0000233_79897_80802 280
83 3300048929 Ga0496126_0235376 Ga0496126_0235376_439_1344 280
84 3300053117 Ga0500593_001323 Ga0500593_001323_7408_8343 280
85 iso_pu_bacteria 2643221609 2644062438 280
86 iso_pu_bacteria 2643221611 2644076531 280
87 3300025294 Ga0209025_1063133 Ga0209025_10631332 281
88 3300026023 Ga0207677_10121666 Ga0207677_101216662 281
89 3300026116 Ga0207674_10169432 Ga0207674_101694322 281
90 3300032004 Ga0307414_10342811 Ga0307414_103428112 281
91 3300005334 Ga0068869_100154206 Ga0068869_1001542061 282
92 3300006946 Ga0079104_1006807 Ga0079104_10068072 282
93 3300009098 Ga0105245_10079170 Ga0105245_100791702 282
94 3300009174 Ga0105241_10114311 Ga0105241_101143112 282
95 3300014969 Ga0157376_10001672 Ga0157376_100016725 282
96 3300025911 Ga0207654_10023541 Ga0207654_100235414 282
97 3300025927 Ga0207687_10014639 Ga0207687_100146393 282
98 3300025942 Ga0207689_10143162 Ga0207689_101431622 282
99 3300031548 Ga0307408_100002947 Ga0307408_1000029473 282
100 3300031901 Ga0307406_10010800 Ga0307406_100108007 282
101 3300053134 Ga0500658_0137326 Ga0500658_0137326_149_1039 282
102 iso_pu_bacteria 2842718218 2842720589 282
103 iso_pu_bacteria 2974320154 2974321692 282
104 3300005262 Ga0065165_1019695 Ga0065165_10196953 283
105 3300005539 Ga0068853_100177777 Ga0068853_1001777772 283
106 3300005577 Ga0068857_100327690 Ga0068857_1003276902 283
107 3300025292 Ga0209676_1008907 Ga0209676_10089072 283
108 3300025295 Ga0209564_1014126 Ga0209564_10141262 283
109 3300025298 Ga0209050_1009055 Ga0209050_10090552 283
110 3300025304 Ga0209257_1009402 Ga0209257_10094022 283
111 3300026041 Ga0207639_10143911 Ga0207639_101439112 283
112 3300003187 JGI25151J46595_10009207 JGI25151J46595_100092077 284
113 3300025258 Ga0209129_1012672 Ga0209129_10126722 284
114 3300025294 Ga0209025_1013212 Ga0209025_10132122 284
115 3300042532 Ga0450893_0016040 Ga0450893_0016040_215_1069 284
116 3300006058 Ga0075432_10004491 Ga0075432_100044913 285
117 3300053093 Ga0500651_0040192 Ga0500651_0040192_360_1238 285
118 3300009148 Ga0105243_10047945 Ga0105243_100479453 286
119 3300025935 Ga0207709_10061945 Ga0207709_100619451 286
120 iso_pu_bacteria 2547132374 2548501772 286
121 iso_pu_bacteria 2643221717 2644646502 286
122 iso_pu_bacteria 2881101125 2881104517 286
123 3300037471 Ga0395905_0091275 Ga0395905_0091275_1570_2463 287
124 iso_pu_bacteria 2643221570 2643864106 287
125 iso_pu_bacteria 2643221596 2643992412 287
126 iso_pu_bacteria 2643221652 2644292194 287
127 iso_pu_bacteria 2990710928 2990714721 287
128 3300032005 Ga0307411_10134065 Ga0307411_101340652 288
129 3300041997 Ga0439431_0022557 Ga0439431_0022557_350_1264 288
130 3300042131 Ga0450894_005252 Ga0450894_005252_597_1511 288
131 3300048090 Ga0495615_0011907 Ga0495615_0011907_562_1464 288
132 iso_pu_bacteria 2894023352 2894023410 288
133 3300005262 Ga0065165_1016467 Ga0065165_10164672 289
134 3300006058 Ga0075432_10093299 Ga0075432_100932991 289
135 3300015683 Ga0183362_10004 Ga0183362_10004455 289
136 3300031548 Ga0307408_100017619 Ga0307408_1000176196 289
137 3300006353 Ga0075370_10004520 Ga0075370_100045206 290
138 3300025914 Ga0207671_10319907 Ga0207671_103199072 290
139 3300031731 Ga0307405_10035861 Ga0307405_100358612 290
140 3300041404 Ga0439436_0003801 Ga0439436_0003801_2677_3591 290
141 3300041406 Ga0439439_0037839 Ga0439439_0037839_111_1004 290
142 3300041999 Ga0439433_0007334 Ga0439433_0007334_1098_1991 290
143 3300042006 Ga0439432_007137 Ga0439432_007137_1425_2339 290
144 3300042007 Ga0439449_0007132 Ga0439449_0007132_1768_2661 290
145 3300042014 Ga0439457_036068 Ga0439457_036068_111_1004 290
146 3300042015 Ga0439462_0001238 Ga0439462_0001238_274_1188 290
147 3300042125 Ga0450923_001455 Ga0450923_001455_409_1323 290
148 3300042145 Ga0450906_003084 Ga0450906_003084_2288_3202 290
149 3300042435 Ga0439434_0042515 Ga0439434_0042515_173_1066 290
150 3300050496 nmdc:mga07m45_13846_c1 nmdc:mga07m45_13846_c1_1442_2356 290
151 3300002987 JGI25159J45721_1000474 JGI25159J45721_100047410 291
152 3300003771 Ga0055526_1006870 Ga0055526_10068709 291
153 3300003773 Ga0055537_1000020 Ga0055537_10000207 291
154 3300003775 Ga0055524_1000047 Ga0055524_100004736 291
155 3300003775 Ga0055524_1000143 Ga0055524_100014319 291
156 3300003781 Ga0055536_1015797 Ga0055536_10157972 291
157 3300003784 Ga0055534_1000967 Ga0055534_100096712 291
158 3300003790 Ga0055528_1000812 Ga0055528_100081220 291
159 3300003791 Ga0055530_10000252 Ga0055530_1000025224 291
160 3300003792 Ga0055540_1000027 Ga0055540_1000027108 291
161 3300003794 Ga0055531_10020943 Ga0055531_100209432 291
162 3300025263 Ga0209565_1000122 Ga0209565_100012237 291
163 3300025273 Ga0209673_1000302 Ga0209673_100030223 291
164 3300025284 Ga0209130_1000896 Ga0209130_100089623 291
165 3300025291 Ga0209675_1000098 Ga0209675_100009864 291
166 3300025292 Ga0209676_1000013 Ga0209676_1000013681 291
167 3300025295 Ga0209564_1000181 Ga0209564_100018114 291
168 3300025298 Ga0209050_1000008 Ga0209050_1000008681 291
169 3300025299 Ga0209256_1000039 Ga0209256_1000039280 291
170 3300025302 Ga0207426_1000714 Ga0207426_100071433 291
171 3300025303 Ga0209051_1000005 Ga0209051_1000005681 291
172 3300025304 Ga0209257_1000031 Ga0209257_1000031271 291
173 iso_pu_bacteria 2885192300 2885194691 291
174 iso_pu_bacteria 2904541872 2904543236 291
175 iso_pu_bacteria 2929160207 2929160470 291
176 3300002704 JGI25155J39150_1000009 JGI25155J39150_1000009146 292
177 3300002705 JGI25156J39149_1000009 JGI25156J39149_100000974 292
178 3300002738 JGI25154J39366_1000024 JGI25154J39366_100002474 292
179 3300002741 JGI25157J39369_1000007 JGI25157J39369_100000774 292
180 3300002773 JGI25152J39213_1008034 JGI25152J39213_10080344 292
181 3300025206 Ga0209435_100051 Ga0209435_10005122 292
182 3300025246 Ga0209646_1000029 Ga0209646_1000029298 292
183 3300025250 Ga0209026_1000016 Ga0209026_1000016298 292
184 3300025256 Ga0209759_1000016 Ga0209759_1000016298 292
185 3300037471 Ga0395905_0002408 Ga0395905_0002408_15594_16499 292
186 3300044683 Ga0466965_0022889 Ga0466965_0022889_336_1241 292
187 3300044684 Ga0466966_0133539 Ga0466966_0133539_156_1061 292
188 iso_pu_bacteria 2599185214 2599622500 292
189 iso_pu_bacteria 2599185226 2599674408 292
190 iso_pu_bacteria 2599185227 2599680093 292
191 iso_pu_bacteria 2599185229 2599692109 292
192 iso_pu_bacteria 2643221628 2644160814 292
193 iso_pu_bacteria 2643221683 2644469384 292
194 iso_pu_bacteria 2738541277 2738719260 292
195 iso_pu_bacteria 2738541307 2738883392 292
196 iso_pu_bacteria 2738543019 2739283009 292
197 iso_pu_bacteria 2818991446 2819599202 292
198 iso_pu_bacteria 2831265667 2831270978 292
199 iso_pu_bacteria 2838054893 2838059028 292
200 iso_pu_bacteria 2842677519 2842679325 292
201 iso_pu_bacteria 2885198086 2885202200 292
202 iso_pu_bacteria 2885211737 2885215853 292
203 iso_pu_bacteria 2899924645 2899930025 292
204 iso_pu_bacteria 2904449895 2904451581 292
205 iso_pu_bacteria 2904456579 2904461930 292
206 iso_pu_bacteria 2919462493 2919464446 292
207 iso_pu_bacteria 2928037797 2928043561 292
208 iso_pu_bacteria 2928044640 2928049809 292
209 iso_pu_bacteria 2928051484 2928054384 292
210 iso_pu_bacteria 2928064002 2928069970 292
211 iso_pu_bacteria 2928070936 2928074409 292
212 iso_pu_bacteria 2928084124 2928086640 292
213 iso_pu_bacteria 2929520902 2929526500 292
214 iso_pu_bacteria 2945909444 2945915474 292
215 iso_pu_bacteria 2945945610 2945950493 292
216 iso_pu_bacteria 2945972063 2945974862 292
217 iso_pu_bacteria 2945984333 2945989124 292
218 iso_pu_bacteria 2954767861 2954770060 292
219 3300042876 Ga0451577_0114505 Ga0451577_0114505_343_1227 293
220 3300045051 Ga0451576_0558701 Ga0451576_0558701_28_951 293
221 iso_pu_bacteria 2513020051 2513228414 293
222 iso_pu_bacteria 2643221672 2644396944 293
223 3300005364 Ga0070673_100466331 Ga0070673_1004663311 294
224 3300005548 Ga0070665_100467379 Ga0070665_1004673792 294
225 3300017792 Ga0163161_10081708 Ga0163161_100817084 294
226 3300025909 Ga0207705_10037091 Ga0207705_100370914 294
227 3300025940 Ga0207691_10029901 Ga0207691_100299013 294
228 3300046525 Ga0495663_0031849 Ga0495663_0031849_201_1103 294
229 3300046615 Ga0495656_0000344 Ga0495656_0000344_12093_12995 294
230 3300006048 Ga0075363_100030228 Ga0075363_1000302284 295
231 3300006177 Ga0075362_10000355 Ga0075362_100003556 295
232 3300026116 Ga0207674_10245201 Ga0207674_102452012 295
233 3300042006 Ga0439432_036290 Ga0439432_036290_139_1080 295
234 3300042007 Ga0439449_0056936 Ga0439449_0056936_219_1127 295
235 3300050489 nmdc:mga03683_7868_c1 nmdc:mga03683_7868_c1_2351_3265 295
236 iso_pu_bacteria 2511231002 2511246656 295
237 3300001989 JGI24739J22299_10004830 JGI24739J22299_100048306 296
238 3300002773 JGI25152J39213_1008066 JGI25152J39213_10080662 296
239 3300002774 JGI25150J39212_1005626 JGI25150J39212_10056262 296
240 3300002987 JGI25159J45721_1004711 JGI25159J45721_10047112 296
241 3300003187 JGI25151J46595_10002245 JGI25151J46595_1000224511 296
242 3300003187 JGI25151J46595_10022047 JGI25151J46595_100220472 296
243 3300003187 JGI25151J46595_10023052 JGI25151J46595_100230524 296
244 3300003215 JGI25153J46596_10018950 JGI25153J46596_100189502 296
245 3300003215 JGI25153J46596_10019727 JGI25153J46596_100197272 296
246 3300003320 rootH2_10010858 rootH2_100108582 296
247 3300003354 JGI25160J50197_1008403 JGI25160J50197_10084036 296
248 3300003354 JGI25160J50197_1011450 JGI25160J50197_10114504 296
249 3300003374 JGI25161J50226_1009100 JGI25161J50226_10091001 296
250 3300003578 Ga0006562J51391_1126692 Ga0006562J51391_11266924 296
251 3300003578 Ga0006562J51391_1126693 Ga0006562J51391_11266932 296
252 3300003761 Ga0055535_1002551 Ga0055535_10025515 296
253 3300003762 Ga0055542_1000013 Ga0055542_1000013256 296
254 3300003771 Ga0055526_1018008 Ga0055526_10180084 296
255 3300003771 Ga0055526_1018085 Ga0055526_10180852 296
256 3300003773 Ga0055537_1000214 Ga0055537_100021429 296
257 3300003773 Ga0055537_1007353 Ga0055537_10073534 296
258 3300003773 Ga0055537_1007398 Ga0055537_10073982 296
259 3300003775 Ga0055524_1016377 Ga0055524_10163774 296
260 3300003775 Ga0055524_1016465 Ga0055524_10164652 296
261 3300003781 Ga0055536_1002209 Ga0055536_10022096 296
262 3300003781 Ga0055536_1007280 Ga0055536_10072802 296
263 3300003784 Ga0055534_1000138 Ga0055534_100013829 296
264 3300003784 Ga0055534_1007301 Ga0055534_10073014 296
265 3300003790 Ga0055528_1003127 Ga0055528_10031276 296
266 3300003790 Ga0055528_1016179 Ga0055528_10161792 296
267 3300003791 Ga0055530_10002944 Ga0055530_100029442 296
268 3300003791 Ga0055530_10006749 Ga0055530_100067492 296
269 3300003792 Ga0055540_1001076 Ga0055540_10010769 296
270 3300003792 Ga0055540_1002406 Ga0055540_10024066 296
271 3300003792 Ga0055540_1004757 Ga0055540_10047572 296
272 3300003792 Ga0055540_1012469 Ga0055540_10124692 296
273 3300003794 Ga0055531_10007431 Ga0055531_100074312 296
274 3300003794 Ga0055531_10014344 Ga0055531_100143444 296
275 3300003794 Ga0055531_10014413 Ga0055531_100144132 296
276 3300004625 Ga0055543_1005555 Ga0055543_10055552 296
277 3300004625 Ga0055543_1005588 Ga0055543_10055882 296
278 3300005262 Ga0065165_1013790 Ga0065165_10137902 296
279 3300005288 Ga0065714_10093785 Ga0065714_100937852 296
280 3300005335 Ga0070666_10138653 Ga0070666_101386532 296
281 3300005366 Ga0070659_100098371 Ga0070659_1000983712 296
282 3300005366 Ga0070659_100347577 Ga0070659_1003475771 296
283 3300005457 Ga0070662_100005501 Ga0070662_1000055014 296
284 3300005539 Ga0068853_100013887 Ga0068853_1000138874 296
285 3300005539 Ga0068853_100014190 Ga0068853_1000141902 296
286 3300005563 Ga0068855_100010586 Ga0068855_1000105868 296
287 3300005564 Ga0070664_100026989 Ga0070664_1000269894 296
288 3300005577 Ga0068857_100055664 Ga0068857_1000556645 296
289 3300005844 Ga0068862_100069262 Ga0068862_1000692624 296
290 3300006038 Ga0075365_10004393 Ga0075365_100043935 296
291 3300006048 Ga0075363_100091094 Ga0075363_1000910942 296
292 3300006051 Ga0075364_10018833 Ga0075364_100188334 296
293 3300006177 Ga0075362_10003400 Ga0075362_100034005 296
294 3300006177 Ga0075362_10026092 Ga0075362_100260922 296
295 3300006177 Ga0075362_10063545 Ga0075362_100635452 296
296 3300006195 Ga0075366_10005918 Ga0075366_100059182 296
297 3300006195 Ga0075366_10009770 Ga0075366_100097704 296
298 3300006237 Ga0097621_100103281 Ga0097621_1001032812 296
299 3300006353 Ga0075370_10016133 Ga0075370_100161333 296
300 3300006353 Ga0075370_10041550 Ga0075370_100415502 296
301 3300006948 Ga0099826_10006310 Ga0099826_100063107 296
302 3300009036 Ga0105244_10004516 Ga0105244_100045165 296
303 3300009093 Ga0105240_10161932 Ga0105240_101619324 296
304 3300009148 Ga0105243_10015445 Ga0105243_100154455 296
305 3300009148 Ga0105243_10042934 Ga0105243_100429342 296
306 3300009148 Ga0105243_10186794 Ga0105243_101867942 296
307 3300009148 Ga0105243_10272502 Ga0105243_102725022 296
308 3300009176 Ga0105242_10215474 Ga0105242_102154742 296
309 3300009545 Ga0105237_10077552 Ga0105237_100775522 296
310 3300009545 Ga0105237_10220151 Ga0105237_102201512 296
311 3300009551 Ga0105238_10096829 Ga0105238_100968292 296
312 3300010375 Ga0105239_10017760 Ga0105239_100177605 296
313 3300010375 Ga0105239_10197715 Ga0105239_101977151 296
314 3300010375 Ga0105239_10324126 Ga0105239_103241263 296
315 3300011119 Ga0105246_10047070 Ga0105246_100470704 296
316 3300013100 Ga0157373_10047612 Ga0157373_100476122 296
317 3300013100 Ga0157373_10140210 Ga0157373_101402102 296
318 3300013104 Ga0157370_10007331 Ga0157370_1000733112 296
319 3300013104 Ga0157370_10053378 Ga0157370_100533783 296
320 3300013104 Ga0157370_10270206 Ga0157370_102702062 296
321 3300013104 Ga0157370_10341621 Ga0157370_103416212 296
322 3300013105 Ga0157369_10004674 Ga0157369_1000467413 296
323 3300013307 Ga0157372_10060373 Ga0157372_100603731 296
324 3300014497 Ga0182008_10005416 Ga0182008_100054164 296
325 3300014497 Ga0182008_10007902 Ga0182008_100079025 296
326 3300015261 Ga0182006_1005451 Ga0182006_10054515 296
327 3300015262 Ga0182007_10000359 Ga0182007_100003595 296
328 3300015265 Ga0182005_1026981 Ga0182005_10269812 296
329 3300017792 Ga0163161_10004277 Ga0163161_100042772 296
330 3300017792 Ga0163161_10006464 Ga0163161_100064645 296
331 3300025228 Ga0209672_100842 Ga0209672_1008422 296
332 3300025229 Ga0209147_101753 Ga0209147_1017536 296
333 3300025242 Ga0209258_100020 Ga0209258_100020412 296
334 3300025245 Ga0207425_1000286 Ga0207425_100028633 296
335 3300025245 Ga0207425_1001207 Ga0207425_10012074 296
336 3300025254 Ga0209148_1000031 Ga0209148_1000031412 296
337 3300025258 Ga0209129_1000406 Ga0209129_100040630 296
338 3300025258 Ga0209129_1006854 Ga0209129_10068545 296
339 3300025258 Ga0209129_1010455 Ga0209129_10104551 296
340 3300025263 Ga0209565_1000078 Ga0209565_100007853 296
341 3300025263 Ga0209565_1000181 Ga0209565_100018142 296
342 3300025263 Ga0209565_1006560 Ga0209565_10065602 296
343 3300025273 Ga0209673_1000442 Ga0209673_100044227 296
344 3300025273 Ga0209673_1002784 Ga0209673_10027848 296
345 3300025273 Ga0209673_1003132 Ga0209673_100313210 296
346 3300025284 Ga0209130_1000443 Ga0209130_100044342 296
347 3300025284 Ga0209130_1000673 Ga0209130_100067330 296
348 3300025291 Ga0209675_1000055 Ga0209675_1000055149 296
349 3300025291 Ga0209675_1000813 Ga0209675_100081315 296
350 3300025291 Ga0209675_1007067 Ga0209675_10070672 296
351 3300025292 Ga0209676_1000040 Ga0209676_1000040303 296
352 3300025292 Ga0209676_1000312 Ga0209676_100031234 296
353 3300025292 Ga0209676_1000403 Ga0209676_100040352 296
354 3300025292 Ga0209676_1004981 Ga0209676_10049817 296
355 3300025294 Ga0209025_1000242 Ga0209025_100024255 296
356 3300025294 Ga0209025_1001359 Ga0209025_100135911 296
357 3300025294 Ga0209025_1010557 Ga0209025_10105573 296
358 3300025294 Ga0209025_1011762 Ga0209025_10117623 296
359 3300025295 Ga0209564_1000157 Ga0209564_100015759 296
360 3300025295 Ga0209564_1001334 Ga0209564_100133415 296
361 3300025295 Ga0209564_1028720 Ga0209564_10287202 296
362 3300025297 Ga0209758_1000042 Ga0209758_100004290 296
363 3300025297 Ga0209758_1009559 Ga0209758_10095592 296
364 3300025298 Ga0209050_1000021 Ga0209050_100002190 296
365 3300025298 Ga0209050_1001095 Ga0209050_100109514 296
366 3300025298 Ga0209050_1027068 Ga0209050_10270682 296
367 3300025299 Ga0209256_1000056 Ga0209256_1000056181 296
368 3300025299 Ga0209256_1000124 Ga0209256_1000124114 296
369 3300025302 Ga0207426_1000055 Ga0207426_1000055241 296
370 3300025302 Ga0207426_1000079 Ga0207426_100007990 296
371 3300025303 Ga0209051_1000111 Ga0209051_100011144 296
372 3300025303 Ga0209051_1000423 Ga0209051_100042343 296
373 3300025303 Ga0209051_1000436 Ga0209051_100043636 296
374 3300025303 Ga0209051_1001711 Ga0209051_10017119 296
375 3300025304 Ga0209257_1000043 Ga0209257_100004385 296
376 3300025304 Ga0209257_1000215 Ga0209257_100021589 296
377 3300025304 Ga0209257_1002414 Ga0209257_10024142 296
378 3300025304 Ga0209257_1004980 Ga0209257_10049802 296
379 3300025728 Ga0207655_1002888 Ga0207655_10028885 296
380 3300025913 Ga0207695_10024120 Ga0207695_100241203 296
381 3300025932 Ga0207690_10147699 Ga0207690_101476992 296
382 3300025932 Ga0207690_10300290 Ga0207690_103002902 296
383 3300025933 Ga0207706_10021609 Ga0207706_100216092 296
384 3300025934 Ga0207686_10114838 Ga0207686_101148382 296
385 3300025935 Ga0207709_10000092 Ga0207709_1000009210 296
386 3300025935 Ga0207709_10003441 Ga0207709_100034415 296
387 3300025935 Ga0207709_10014960 Ga0207709_100149605 296
388 3300025945 Ga0207679_10009878 Ga0207679_100098785 296
389 3300025949 Ga0207667_10133774 Ga0207667_101337743 296
390 3300026041 Ga0207639_10085203 Ga0207639_100852034 296
391 3300026041 Ga0207639_10087118 Ga0207639_100871183 296
392 3300026116 Ga0207674_10039615 Ga0207674_100396152 296
393 3300027666 Ga0209282_1006211 Ga0209282_10062114 296
394 3300027866 Ga0209813_10034557 Ga0209813_100345572 296
395 3300027907 Ga0207428_10032174 Ga0207428_100321743 296
396 3300028380 Ga0268265_10051003 Ga0268265_100510032 296
397 3300028794 Ga0307515_10154615 Ga0307515_101546152 296
398 3300030731 Ga0316177_1120901 Ga0316177_11209012 296
399 3300030732 Ga0316176_1025030 Ga0316176_10250303 296
400 3300030733 Ga0314311_1202462 Ga0314311_12024624 296
401 3300030734 Ga0316179_1046469 Ga0316179_10464693 296
402 3300030736 Ga0316180_1115950 Ga0316180_11159502 296
403 3300030742 Ga0316183_1020911 Ga0316183_10209113 296
404 3300030742 Ga0316183_1088416 Ga0316183_10884162 296
405 3300030744 Ga0316181_1042333 Ga0316181_10423332 296
406 3300030745 Ga0316182_1437589 Ga0316182_14375895 296
407 3300031548 Ga0307408_100247481 Ga0307408_1002474812 296
408 3300031649 Ga0307514_10010202 Ga0307514_100102022 296
409 3300031731 Ga0307405_10216039 Ga0307405_102160392 296
410 3300031731 Ga0307405_10440258 Ga0307405_104402581 296
411 3300031901 Ga0307406_10429719 Ga0307406_104297191 296
412 3300031903 Ga0307407_10063177 Ga0307407_100631773 296
413 3300031903 Ga0307407_10170345 Ga0307407_101703452 296
414 3300031911 Ga0307412_10023714 Ga0307412_100237144 296
415 3300031911 Ga0307412_10033132 Ga0307412_100331324 296
416 3300031911 Ga0307412_10075178 Ga0307412_100751784 296
417 3300031911 Ga0307412_10179025 Ga0307412_101790252 296
418 3300031911 Ga0307412_10450180 Ga0307412_104501801 296
419 3300031995 Ga0307409_100328702 Ga0307409_1003287022 296
420 3300032002 Ga0307416_100002326 Ga0307416_1000023266 296
421 3300032004 Ga0307414_10242470 Ga0307414_102424702 296
422 3300041411 Ga0439466_0018627 Ga0439466_0018627_90_980 296
423 3300041413 Ga0439465_0020015 Ga0439465_0020015_1158_2048 296
424 3300042121 Ga0450919_009463 Ga0450919_009463_173_1063 296
425 3300042125 Ga0450923_003583 Ga0450923_003583_67_957 296
426 3300042146 Ga0450907_009272 Ga0450907_009272_711_1601 296
427 3300042147 Ga0450910_000307 Ga0450910_000307_492_1382 296
428 3300042435 Ga0439434_0027077 Ga0439434_0027077_259_1149 296
429 3300046453 Ga0495627_018518 Ga0495627_018518_426_1316 296
430 3300046453 Ga0495627_049479 Ga0495627_049479_104_1021 296
431 3300046459 Ga0495629_0205104 Ga0495629_0205104_423_1313 296
432 3300046460 Ga0495638_0038867 Ga0495638_0038867_276_1166 296
433 3300046507 Ga0495606_0152641 Ga0495606_0152641_80_997 296
434 3300046512 Ga0495610_0021220 Ga0495610_0021220_2211_3101 296
435 3300046513 Ga0495616_0001014 Ga0495616_0001014_15599_16489 296
436 3300046515 Ga0495620_0101664 Ga0495620_0101664_237_1127 296
437 3300046518 Ga0495631_0000623 Ga0495631_0000623_18621_19511 296
438 3300046520 Ga0495637_0010173 Ga0495637_0010173_909_1799 296
439 3300046530 Ga0495654_0017875 Ga0495654_0017875_2120_3010 296
440 3300046660 Ga0495625_0000206 Ga0495625_0000206_38265_39155 296
441 3300046660 Ga0495625_0209406 Ga0495625_0209406_244_1134 296
442 3300046660 Ga0495625_0241254 Ga0495625_0241254_183_1073 296
443 3300046674 Ga0495588_0021944 Ga0495588_0021944_1791_2681 296
444 3300046674 Ga0495588_0175857 Ga0495588_0175857_124_1014 296
445 3300046680 Ga0495646_0253143 Ga0495646_0253143_40_930 296
446 3300046691 Ga0495670_0018286 Ga0495670_0018286_122_1012 296
447 3300046692 Ga0495671_0001944 Ga0495671_0001944_645_1535 296
448 3300046809 Ga0495600_0089501 Ga0495600_0089501_565_1455 296
449 3300047321 Ga0495676_0010564 Ga0495676_0010564_1521_2411 296
450 3300047673 Ga0495593_0011415 Ga0495593_0011415_2161_3051 296
451 3300048089 Ga0495614_0001168 Ga0495614_0001168_8309_9199 296
452 3300048904 Ga0496101_0019692 Ga0496101_0019692_393_1292 296
453 3300048905 Ga0496102_0044007 Ga0496102_0044007_1497_2390 296
454 3300048919 Ga0496116_0012073 Ga0496116_0012073_5646_6539 296
455 3300048919 Ga0496116_0039421 Ga0496116_0039421_574_1473 296
456 3300048920 Ga0496117_0130098 Ga0496117_0130098_477_1370 296
457 3300048921 Ga0496118_0015236 Ga0496118_0015236_1778_2668 296
458 3300048921 Ga0496118_0039468 Ga0496118_0039468_2631_3524 296
459 3300048924 Ga0496121_0047824 Ga0496121_0047824_2694_3584 296
460 3300048924 Ga0496121_0171464 Ga0496121_0171464_625_1524 296
461 3300048925 Ga0496122_0081447 Ga0496122_0081447_1153_2043 296
462 3300048926 Ga0496123_0044746 Ga0496123_0044746_199_1089 296
463 3300048926 Ga0496123_0173972 Ga0496123_0173972_26_943 296
464 3300048927 Ga0496124_0047958 Ga0496124_0047958_1356_2249 296
465 3300048927 Ga0496124_0108964 Ga0496124_0108964_520_1437 296
466 3300048928 Ga0496125_0027256 Ga0496125_0027256_1227_2120 296
467 3300048928 Ga0496125_0144809 Ga0496125_0144809_84_1001 296
468 3300049679 Ga0501249_001704 Ga0501249_001704_1232_2125 296
469 3300049705 Ga0501225_0009810 Ga0501225_0009810_1020_1913 296
470 3300049759 Ga0501262_000531 Ga0501262_000531_1618_2511 296
471 3300050489 nmdc:mga03683_1119_c2 nmdc:mga03683_1119_c2_2021_2911 296
472 3300050489 nmdc:mga03683_26314_c1 nmdc:mga03683_26314_c1_1356_2246 296
473 3300050489 nmdc:mga03683_6009_c1 nmdc:mga03683_6009_c1_1788_2678 296
474 3300050491 nmdc:mga00v17_29089_c1 nmdc:mga00v17_29089_c1_2056_2946 296
475 3300050491 nmdc:mga00v17_50543_c1 nmdc:mga00v17_50543_c1_1234_2151 296
476 3300050492 nmdc:mga0yw44_7162_c1 nmdc:mga0yw44_7162_c1_3835_4725 296
477 3300050493 nmdc:mga0k408_24129_c1 nmdc:mga0k408_24129_c1_1904_2794 296
478 3300050493 nmdc:mga0k408_27523_c1 nmdc:mga0k408_27523_c1_1512_2402 296
479 3300050495 nmdc:mga04h51_52265_c1 nmdc:mga04h51_52265_c1_89_979 296
480 3300050496 nmdc:mga07m45_118066_c1 nmdc:mga07m45_118066_c1_516_1409 296
481 3300050496 nmdc:mga07m45_4236_c2 nmdc:mga07m45_4236_c2_1791_2681 296
482 3300050496 nmdc:mga07m45_482_c1 nmdc:mga07m45_482_c1_15750_16667 296
483 3300053079 Ga0500610_0018955 Ga0500610_0018955_1948_2838 296
484 3300053087 Ga0500643_011226 Ga0500643_011226_443_1333 296
485 3300053093 Ga0500651_0008027 Ga0500651_0008027_1451_2341 296
486 3300053094 Ga0500566_0028806 Ga0500566_0028806_806_1696 296
487 3300053110 Ga0500571_000946 Ga0500571_000946_6297_7187 296
488 3300053111 Ga0500572_049114 Ga0500572_049114_137_1027 296
489 3300053117 Ga0500593_007770 Ga0500593_007770_1546_2436 296
490 3300053121 Ga0500607_001064 Ga0500607_001064_8085_8975 296
491 3300053121 Ga0500607_068200 Ga0500607_068200_407_1306 296
492 3300053122 Ga0500608_001241 Ga0500608_001241_1918_2808 296
493 3300053125 Ga0500618_031247 Ga0500618_031247_225_1115 296
494 3300053133 Ga0500655_001630 Ga0500655_001630_1940_2830 296
495 3300053134 Ga0500658_0137324 Ga0500658_0137324_56_946 296
496 3300053136 Ga0500559_0027197 Ga0500559_0027197_560_1450 296
497 3300053138 Ga0500564_032460 Ga0500564_032460_465_1355 296
498 3300053139 Ga0500568_0000624 Ga0500568_0000624_1940_2830 296
499 3300053158 Ga0500627_0000293 Ga0500627_0000293_11396_12286 296
500 3300053161 Ga0500634_0006664 Ga0500634_0006664_4188_5078 296
501 3300053161 Ga0500634_0039744 Ga0500634_0039744_73_963 296
502 3300053162 Ga0500638_045943 Ga0500638_045943_213_1103 296
503 3300053177 Ga0500636_0004379 Ga0500636_0004379_6675_7565 296
504 iso_pu_bacteria 2643221658 2644326594 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

35

166

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.7621 2 285
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.7334 2 285
7b0k-assembly1.cif.gz_A membrane protein structure 0.7121 3 278
7b0k-assembly1.cif.gz_A membrane protein structure 0.7006 3 278
5i20-assembly2.cif.gz_B crystal structure of protein 0.6528 2 282
ID Description Score Start End Superfamily
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7647 1 282 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7338 1 283 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7306 1 282 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7037 1 283 1.20.1740.10
af_Q47377_2_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.6813 188 282 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A257H5Z3-F1-model_v4 EamA family transporter 0.9177 27 282 GO:0016020
AF-A0A257H5Z3-F1-model_v4 EamA family transporter 0.8852 27 282 GO:0016020
AF-A0A2T4WU92-F1-model_v4 EamA family transporter 0.8809 2 288 GO:0016020
AF-A0A4R3E912-F1-model_v4 Drug/metabolite transporter (DMT)-like permease 0.8726 2 282 GO:0016020
AF-A0A2S6TYW0-F1-model_v4 Riboflavin transporter 0.8681 2 282 GO:0016020

Feature Viewer

pLDDT pTM Quality
84.17 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map