F456071

General Info

Members Datasets Scaffolds Average Seq Length
503 210 499 246

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0041293|Ga0495643_0041293_1044_1793
Length 237
Sequence MFRKCLAEFIGTFWLVLGGCGSAVLAATFPDVGIGLAGVSLAFGLTVLTAAYSLGPISGGHFNPAVTVGLWAGGRFPARQIGPYIVVQVAGAIVAAAVLYAIASGKPGFDAAAGGFATLASALLTELVMTFMFVLVILGATHTRAPVGFAGLAIGLALTLIHLVSIPVTNTSVNPARSTGPALFAGAWALQQLWLFWLAPLVGGALAGVLHRTMLEHDVTKPAIEGQPDGVLQPAHR

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221684 Massilia sp. Root133 Isolate Unclassified
3 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
4 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
73 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
74 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
89 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
90 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
91 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
92 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
104 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
105 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
106 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
110 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
111 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
112 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
118 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
132 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
133 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
134 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
151 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
174 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
175 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
176 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
182 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
202 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
203 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.2
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0
Rhizoplane 4.37
Rhizosphere 92.25
Stem 0
Stem Tuber 0
Unclassified 2.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0007409J51694_1014877 3300003575 Bacteria 964
2 Ga0065165_1000286 3300005262 Bacteria 85993
3 Ga0070677_10033936 3300005333 Bacteria 1968
4 Ga0070680_100043549 3300005336 Bacteria 3646
5 Ga0068868_100317360 3300005338 Bacteria 1327
6 Ga0070660_100085399 3300005339 Bacteria 2482
7 Ga0070660_100321901 3300005339 Bacteria 1270
8 Ga0070661_100008038 3300005344 Bacteria 7283
9 Ga0070661_100024527 3300005344 Bacteria 4325
10 Ga0070674_100748231 3300005356 Bacteria 840
11 Ga0070673_100175901 3300005364 Bacteria 1829
12 Ga0070659_100012614 3300005366 Bacteria 6267
13 Ga0070659_100054667 3300005366 Bacteria 3145
14 Ga0070659_100192136 3300005366 Bacteria 1678
15 Ga0070663_100391772 3300005455 Bacteria 1134
16 Ga0070662_100115640 3300005457 Bacteria 2049
17 Ga0070681_10020138 3300005458 Bacteria 6687
18 Ga0070706_100469656 3300005467 Bacteria 1170
19 Ga0070699_100203558 3300005518 Bacteria 1761
20 Ga0070679_100047579 3300005530 Bacteria 4274
21 Ga0070679_100075091 3300005530 Bacteria 3371
22 Ga0070697_100031861 3300005536 Bacteria 4242
23 Ga0070665_100000038 3300005548 Bacteria 309230
24 Ga0068855_100028919 3300005563 Bacteria 6631
25 Ga0068855_100070433 3300005563 Bacteria 4068
26 Ga0068855_100386484 3300005563 Bacteria 1536
27 Ga0070664_100019536 3300005564 Bacteria 5574
28 Ga0068857_100123883 3300005577 Bacteria 2328
29 Ga0068857_100381484 3300005577 Bacteria 1309
30 Ga0068854_100354663 3300005578 Bacteria 1202
31 Ga0068852_100195664 3300005616 Bacteria 1910
32 Ga0068852_100206876 3300005616 Bacteria 1860
33 Ga0068866_10079670 3300005718 Bacteria 1755
34 Ga0068861_100119557 3300005719 Bacteria 2123
35 Ga0068863_100235608 3300005841 Bacteria 1766
36 Ga0068863_101042387 3300005841 Bacteria 821
37 Ga0068860_100712557 3300005843 Bacteria 1014
38 Ga0075364_10002305 3300006051 Bacteria 10698
39 Ga0097621_100026285 3300006237 Bacteria 4564
40 Ga0068871_100154506 3300006358 Bacteria 1958
41 Ga0075428_100299315 3300006844 Bacteria 1729
42 Ga0075431_100084430 3300006847 Bacteria 3278
43 Ga0075431_100181001 3300006847 Bacteria 2163
44 Ga0075433_10270088 3300006852 Bacteria 1507
45 Ga0075429_100100808 3300006880 Bacteria 2521
46 Ga0099795_10052670 3300007788 Bacteria 1487
47 Ga0105244_10056104 3300009036 Bacteria 1995
48 Ga0105240_10008454 3300009093 Bacteria 14724
49 Ga0105248_10106109 3300009177 Bacteria 3167
50 Ga0105237_10102204 3300009545 Bacteria 2858
51 Ga0105238_10423071 3300009551 Bacteria 1327
52 Ga0157374_10018708 3300013296 Bacteria 6120
53 Ga0157375_10074423 3300013308 Bacteria 3418
54 Ga0157380_10098690 3300014326 Bacteria 2427
55 Ga0163161_10021320 3300017792 Bacteria 4555
56 Ga0213872_10072570 3300021361 Bacteria 1551
57 Ga0209148_1000930 3300025254 Bacteria 19265
58 Ga0207682_10015104 3300025893 Bacteria 3007
59 Ga0207642_10035120 3300025899 Bacteria 2138
60 Ga0207645_10020891 3300025907 Bacteria 4277
61 Ga0207705_10039654 3300025909 Bacteria 3376
62 Ga0207707_10114736 3300025912 Bacteria 2354
63 Ga0207657_10013265 3300025919 Bacteria 8085
64 Ga0207652_10028076 3300025921 Bacteria 4693
65 Ga0207652_10507773 3300025921 Bacteria 1085
66 Ga0207694_10311010 3300025924 Bacteria 1299
67 Ga0207659_10583418 3300025926 Bacteria 952
68 Ga0207690_10014014 3300025932 Bacteria 4832
69 Ga0207690_10649783 3300025932 Bacteria 864
70 Ga0207706_10125937 3300025933 Bacteria 2253
71 Ga0207704_10051330 3300025938 Bacteria 2493
72 Ga0207704_10450803 3300025938 Bacteria 1027
73 Ga0207691_10038318 3300025940 Bacteria 4436
74 Ga0207689_10023854 3300025942 Bacteria 5132
75 Ga0207679_10022040 3300025945 Bacteria 4331
76 Ga0207667_10048358 3300025949 Bacteria 4497
77 Ga0207703_10153670 3300026035 Bacteria 2009
78 Ga0207678_10332397 3300026067 Bacteria 1308
79 Ga0207702_10253110 3300026078 Bacteria 1655
80 Ga0207698_10373745 3300026142 Bacteria 1354
81 Ga0209179_1038266 3300027512 Bacteria 1004
82 Ga0268266_10000634 3300028379 Bacteria 47779
83 Ga0265332_10005514 3300031238 Bacteria 5831
84 Ga0265339_10000280 3300031249 Bacteria 41086
85 Ga0265331_10010454 3300031250 Bacteria 5134
86 Ga0265331_10183669 3300031250 Bacteria 944
87 Ga0265314_10005871 3300031711 Bacteria 10989
88 Ga0265342_10034426 3300031712 Bacteria 3107
89 Ga0307413_10133851 3300031824 Bacteria 1701
90 Ga0307410_10298508 3300031852 Bacteria 1270
91 Ga0307409_100062428 3300031995 Bacteria 2917
92 Ga0373955_0119200 3300035172 Bacteria 1533
93 Ga0373925_0061109 3300037068 Bacteria 2829
94 Ga0373925_0600506 3300037068 Bacteria 906
95 Ga0395899_0000139 3300037312 Bacteria 110692
96 Ga0395899_0006007 3300037312 Bacteria 9425
97 Ga0395899_0094023 3300037312 Bacteria 2169
98 Ga0395899_0410334 3300037312 Bacteria 894
99 Ga0395900_0245724 3300037418 Bacteria 1793
100 Ga0395898_0027743 3300037466 Bacteria 5678
101 Ga0395898_0271522 3300037466 Bacteria 1617
102 Ga0395905_0041359 3300037471 Bacteria 4325
103 Ga0395905_0088159 3300037471 Bacteria 2909
104 Ga0395905_0133259 3300037471 Bacteria 2337
105 Ga0395905_0677471 3300037471 Bacteria 933
106 Ga0395901_0006677 3300038443 Bacteria 11664
107 Ga0395901_0111283 3300038443 Bacteria 2876
108 Ga0395901_0147479 3300038443 Bacteria 2472
109 Ga0395901_0273200 3300038443 Bacteria 1757
110 Ga0436361_0934543 3300039447 Bacteria 2827
111 Ga0439450_066884 3300042008 Bacteria 876
112 Ga0439455_0045419 3300042012 Bacteria 1135
113 Ga0450904_000055 3300042139 Bacteria 25247
114 Ga0439458_0020705 3300042157 Bacteria 1519
115 Ga0466969_0027876 3300044656 Bacteria 2890
116 Ga0466969_0055398 3300044656 Bacteria 1940
117 Ga0466969_0163510 3300044656 Bacteria 1022
118 Ga0466972_0100014 3300044658 Bacteria 1372
119 Ga0466982_0061820 3300044672 Bacteria 2306
120 Ga0466965_0025382 3300044683 Bacteria 2868
121 Ga0466966_0001914 3300044684 Bacteria 13489
122 Ga0466966_0014154 3300044684 Bacteria 5280
123 Ga0466966_0025583 3300044684 Bacteria 3855
124 Ga0466961_0096897 3300044693 Bacteria 1860
125 Ga0466963_0050448 3300044694 Bacteria 2754
126 Ga0466970_0107852 3300044765 Bacteria 1520
127 Ga0466957_0030026 3300044842 Bacteria 3244
128 Ga0466957_0140474 3300044842 Bacteria 1555
129 Ga0466957_0309107 3300044842 Bacteria 1064
130 Ga0466959_0178288 3300045049 Bacteria 1487
131 Ga0466959_0223099 3300045049 Bacteria 1306
132 Ga0466967_0279494 3300045976 Bacteria 1601
133 Ga0466967_1148746 3300045976 Bacteria 774
134 Ga0495617_000002 3300046452 Bacteria 710121
135 Ga0495627_000207 3300046453 Bacteria 63763
136 Ga0495627_023575 3300046453 Bacteria 2014
137 Ga0495627_030970 3300046453 Bacteria 1693
138 Ga0495603_0109716 3300046455 Bacteria 1610
139 Ga0495590_0004449 3300046457 Bacteria 5653
140 Ga0495590_0032988 3300046457 Bacteria 1810
141 Ga0495638_0151767 3300046460 Bacteria 1343
142 Ga0495653_0008877 3300046463 Bacteria 8223
143 Ga0495653_0102968 3300046463 Bacteria 2065
144 Ga0495650_0000085 3300046471 Bacteria 235655
145 Ga0495650_0032523 3300046471 Bacteria 2331
146 Ga0495650_0034818 3300046471 Bacteria 2223
147 Ga0495580_0042615 3300046472 Bacteria 3232
148 Ga0495582_0002194 3300046473 Bacteria 10926
149 Ga0495582_0033801 3300046473 Bacteria 2812
150 Ga0495605_0000293 3300046474 Bacteria 55067
151 Ga0495605_0004396 3300046474 Bacteria 8294
152 Ga0495605_0004494 3300046474 Bacteria 8172
153 Ga0495605_0011250 3300046474 Bacteria 4996
154 Ga0495605_0012549 3300046474 Bacteria 4695
155 Ga0495605_0094338 3300046474 Bacteria 1382
156 Ga0495639_0201731 3300046475 Bacteria 974
157 Ga0495584_0001632 3300046491 Bacteria 13184
158 Ga0495584_0002152 3300046491 Bacteria 11248
159 Ga0495584_0005819 3300046491 Bacteria 6497
160 Ga0495584_0006531 3300046491 Bacteria 6095
161 Ga0495584_0011040 3300046491 Bacteria 4631
162 Ga0495584_0013803 3300046491 Bacteria 4118
163 Ga0495584_0016821 3300046491 Bacteria 3728
164 Ga0495584_0017335 3300046491 Bacteria 3667
165 Ga0495584_0039629 3300046491 Bacteria 2380
166 Ga0495585_0000060 3300046492 Bacteria 110761
167 Ga0495585_0001538 3300046492 Bacteria 17918
168 Ga0495585_0009014 3300046492 Bacteria 6013
169 Ga0495585_0009266 3300046492 Bacteria 5915
170 Ga0495585_0029165 3300046492 Bacteria 3142
171 Ga0495585_0029211 3300046492 Bacteria 3139
172 Ga0495585_0041145 3300046492 Bacteria 2592
173 Ga0495585_0089359 3300046492 Bacteria 1660
174 Ga0495585_0152996 3300046492 Bacteria 1202
175 Ga0495585_0157423 3300046492 Bacteria 1180
176 Ga0495585_0173169 3300046492 Bacteria 1113
177 Ga0495594_0012200 3300046499 Bacteria 4474
178 Ga0495594_0018877 3300046499 Bacteria 3658
179 Ga0495594_0045882 3300046499 Bacteria 2399
180 Ga0495596_0001513 3300046500 Bacteria 13278
181 Ga0495596_0002222 3300046500 Bacteria 10576
182 Ga0495596_0002396 3300046500 Bacteria 10136
183 Ga0495596_0006959 3300046500 Bacteria 5147
184 Ga0495596_0009020 3300046500 Bacteria 4409
185 Ga0495596_0010389 3300046500 Bacteria 4055
186 Ga0495596_0024951 3300046500 Bacteria 2418
187 Ga0495596_0027404 3300046500 Bacteria 2291
188 Ga0495596_0041440 3300046500 Bacteria 1815
189 Ga0495607_0002697 3300046501 Bacteria 14167
190 Ga0495607_0003269 3300046501 Bacteria 12466
191 Ga0495607_0007843 3300046501 Bacteria 7347
192 Ga0495607_0007885 3300046501 Bacteria 7324
193 Ga0495607_0032114 3300046501 Bacteria 3208
194 Ga0495607_0047630 3300046501 Bacteria 2510
195 Ga0495583_0000372 3300046506 Bacteria 69750
196 Ga0495583_0011561 3300046506 Bacteria 5061
197 Ga0495583_0012943 3300046506 Bacteria 4687
198 Ga0495583_0025477 3300046506 Bacteria 2954
199 Ga0495583_0032191 3300046506 Bacteria 2532
200 Ga0495606_0025258 3300046507 Bacteria 4258
201 Ga0495606_0044723 3300046507 Bacteria 2942
202 Ga0495606_0076091 3300046507 Bacteria 2099
203 Ga0495606_0105016 3300046507 Bacteria 1713
204 Ga0495606_0259642 3300046507 Bacteria 959
205 Ga0495610_0147691 3300046512 Bacteria 1006
206 Ga0495616_0000207 3300046513 Bacteria 48768
207 Ga0495616_0003852 3300046513 Bacteria 9560
208 Ga0495616_0005637 3300046513 Bacteria 7664
209 Ga0495616_0005696 3300046513 Bacteria 7632
210 Ga0495616_0008377 3300046513 Bacteria 6131
211 Ga0495616_0009720 3300046513 Bacteria 5606
212 Ga0495616_0019146 3300046513 Bacteria 3740
213 Ga0495616_0022457 3300046513 Bacteria 3407
214 Ga0495616_0069619 3300046513 Bacteria 1705
215 Ga0495616_0094902 3300046513 Bacteria 1406
216 Ga0495620_0063031 3300046515 Bacteria 1538
217 Ga0495630_0008344 3300046517 Bacteria 7437
218 Ga0495631_0000951 3300046518 Bacteria 18026
219 Ga0495631_0003812 3300046518 Bacteria 8185
220 Ga0495631_0004785 3300046518 Bacteria 7139
221 Ga0495631_0004884 3300046518 Bacteria 7057
222 Ga0495631_0005985 3300046518 Bacteria 6328
223 Ga0495631_0006303 3300046518 Bacteria 6138
224 Ga0495631_0009757 3300046518 Bacteria 4781
225 Ga0495631_0033631 3300046518 Bacteria 2301
226 Ga0495631_0034697 3300046518 Bacteria 2260
227 Ga0495631_0078972 3300046518 Bacteria 1420
228 Ga0495632_0000077 3300046519 Bacteria 100834
229 Ga0495632_0000129 3300046519 Bacteria 77134
230 Ga0495632_0000296 3300046519 Bacteria 48157
231 Ga0495632_0003812 3300046519 Bacteria 10501
232 Ga0495632_0009110 3300046519 Bacteria 6005
233 Ga0495632_0011355 3300046519 Bacteria 5200
234 Ga0495632_0259765 3300046519 Bacteria 777
235 Ga0495637_0061688 3300046520 Bacteria 1536
236 Ga0495643_0002628 3300046522 Bacteria 13941
237 Ga0495643_0003068 3300046522 Bacteria 12557
238 Ga0495643_0040128 3300046522 Bacteria 2557
239 Ga0495643_0041293 3300046522 Bacteria 2515
240 Ga0495644_0014515 3300046523 Bacteria 3017
241 Ga0495644_0042698 3300046523 Bacteria 1707
242 Ga0495644_0064497 3300046523 Bacteria 1376
243 Ga0495644_0095264 3300046523 Bacteria 1124
244 Ga0495644_0171740 3300046523 Bacteria 832
245 Ga0495648_0001105 3300046524 Bacteria 27423
246 Ga0495648_0003935 3300046524 Bacteria 12861
247 Ga0495648_0008300 3300046524 Bacteria 8189
248 Ga0495648_0033459 3300046524 Bacteria 3355
249 Ga0495648_0034610 3300046524 Bacteria 3285
250 Ga0495663_0002406 3300046525 Bacteria 5626
251 Ga0495666_0007927 3300046526 Bacteria 5320
252 Ga0495666_0019121 3300046526 Bacteria 3402
253 Ga0495642_0000085 3300046528 Bacteria 54372
254 Ga0495642_0000285 3300046528 Bacteria 28471
255 Ga0495642_0000313 3300046528 Bacteria 26929
256 Ga0495642_0007287 3300046528 Bacteria 4246
257 Ga0495642_0015858 3300046528 Bacteria 2933
258 Ga0495642_0022739 3300046528 Bacteria 2471
259 Ga0495642_0029469 3300046528 Bacteria 2191
260 Ga0495642_0034918 3300046528 Bacteria 2027
261 Ga0495642_0047518 3300046528 Bacteria 1758
262 Ga0495642_0076694 3300046528 Bacteria 1403
263 Ga0495654_0005307 3300046530 Bacteria 7512
264 Ga0495654_0016451 3300046530 Bacteria 3910
265 Ga0495654_0075175 3300046530 Bacteria 1594
266 Ga0495665_0003034 3300046531 Bacteria 9073
267 Ga0495665_0007366 3300046531 Bacteria 5949
268 Ga0495665_0016646 3300046531 Bacteria 3961
269 Ga0495640_0030579 3300046533 Bacteria 3854
270 Ga0495586_0001694 3300046535 Bacteria 12072
271 Ga0495586_0021248 3300046535 Bacteria 3457
272 Ga0495587_0026119 3300046536 Bacteria 3562
273 Ga0495609_0000002 3300046538 Bacteria 739816
274 Ga0495609_0000298 3300046538 Bacteria 45867
275 Ga0495609_0000886 3300046538 Bacteria 21874
276 Ga0495609_0010916 3300046538 Bacteria 4340
277 Ga0495609_0012909 3300046538 Bacteria 3954
278 Ga0495609_0017434 3300046538 Bacteria 3334
279 Ga0495609_0021406 3300046538 Bacteria 2983
280 Ga0495609_0023815 3300046538 Bacteria 2811
281 Ga0495609_0034920 3300046538 Bacteria 2277
282 Ga0495597_0000226 3300046542 Bacteria 51108
283 Ga0495597_0000812 3300046542 Bacteria 24678
284 Ga0495597_0000995 3300046542 Bacteria 21765
285 Ga0495597_0003907 3300046542 Bacteria 8415
286 Ga0495597_0010562 3300046542 Bacteria 4505
287 Ga0495597_0012539 3300046542 Bacteria 4088
288 Ga0495597_0030728 3300046542 Bacteria 2446
289 Ga0495597_0100323 3300046542 Bacteria 1221
290 Ga0495645_0035511 3300046543 Bacteria 3634
291 Ga0495645_0247677 3300046543 Bacteria 1186
292 Ga0495622_0006961 3300046557 Bacteria 5248
293 Ga0495622_0060554 3300046557 Bacteria 1753
294 Ga0495633_0001851 3300046558 Bacteria 15535
295 Ga0495633_0015416 3300046558 Bacteria 3965
296 Ga0495633_0018337 3300046558 Bacteria 3556
297 Ga0495633_0039291 3300046558 Bacteria 2258
298 Ga0495633_0131256 3300046558 Bacteria 1159
299 Ga0495656_0012532 3300046615 Bacteria 3131
300 Ga0495656_0016119 3300046615 Bacteria 2832
301 Ga0495656_0144397 3300046615 Bacteria 1144
302 Ga0495656_0199668 3300046615 Bacteria 992
303 Ga0495668_0000274 3300046616 Bacteria 72330
304 Ga0495668_0000941 3300046616 Bacteria 32463
305 Ga0495668_0001920 3300046616 Bacteria 18482
306 Ga0495668_0002973 3300046616 Bacteria 13285
307 Ga0495668_0006948 3300046616 Bacteria 7325
308 Ga0495668_0010024 3300046616 Bacteria 5768
309 Ga0495668_0011866 3300046616 Bacteria 5193
310 Ga0495668_0012332 3300046616 Bacteria 5070
311 Ga0495668_0025787 3300046616 Bacteria 3338
312 Ga0495668_0038328 3300046616 Bacteria 2678
313 Ga0495668_0042272 3300046616 Bacteria 2537
314 Ga0495668_0079078 3300046616 Bacteria 1805
315 Ga0495634_0007884 3300046642 Bacteria 7949
316 Ga0495611_0000773 3300046648 Bacteria 17861
317 Ga0495611_0005097 3300046648 Bacteria 5631
318 Ga0495611_0024293 3300046648 Bacteria 2636
319 Ga0495611_0029099 3300046648 Bacteria 2421
320 Ga0495611_0118072 3300046648 Bacteria 1236
321 Ga0495611_0163411 3300046648 Bacteria 1040
322 Ga0495611_0201734 3300046648 Bacteria 927
323 Ga0495625_0012809 3300046660 Bacteria 6780
324 Ga0495625_0020366 3300046660 Bacteria 5122
325 Ga0495625_0086872 3300046660 Bacteria 2169
326 Ga0495635_0006164 3300046663 Bacteria 8359
327 Ga0495635_0086722 3300046663 Bacteria 2142
328 Ga0495659_0110303 3300046664 Bacteria 1074
329 Ga0495661_0001749 3300046665 Bacteria 17475
330 Ga0495661_0003878 3300046665 Bacteria 10932
331 Ga0495661_0004982 3300046665 Bacteria 9483
332 Ga0495661_0005057 3300046665 Bacteria 9413
333 Ga0495661_0005993 3300046665 Bacteria 8581
334 Ga0495661_0020928 3300046665 Bacteria 4266
335 Ga0495661_0025026 3300046665 Bacteria 3861
336 Ga0495661_0045361 3300046665 Bacteria 2689
337 Ga0495661_0052283 3300046665 Bacteria 2462
338 Ga0495661_0089564 3300046665 Bacteria 1753
339 Ga0495661_0097418 3300046665 Bacteria 1661
340 Ga0495661_0098738 3300046665 Bacteria 1647
341 Ga0495588_0000177 3300046674 Bacteria 78598
342 Ga0495588_0015555 3300046674 Bacteria 3664
343 Ga0495588_0034967 3300046674 Bacteria 2544
344 Ga0495588_0037318 3300046674 Bacteria 2468
345 Ga0495588_0126376 3300046674 Bacteria 1348
346 Ga0495623_0007137 3300046679 Bacteria 7253
347 Ga0495623_0008273 3300046679 Bacteria 6766
348 Ga0495646_0167944 3300046680 Bacteria 1211
349 Ga0495669_0000092 3300046684 Bacteria 59765
350 Ga0495669_0001619 3300046684 Bacteria 9246
351 Ga0495669_0004755 3300046684 Bacteria 5630
352 Ga0495669_0032550 3300046684 Bacteria 2292
353 Ga0495669_0194166 3300046684 Bacteria 969
354 Ga0495670_0000623 3300046691 Bacteria 16953
355 Ga0495670_0012324 3300046691 Bacteria 4203
356 Ga0495670_0012951 3300046691 Bacteria 4100
357 Ga0495670_0020078 3300046691 Bacteria 3293
358 Ga0495670_0031241 3300046691 Bacteria 2646
359 Ga0495671_0000965 3300046692 Bacteria 20129
360 Ga0495671_0015306 3300046692 Bacteria 4113
361 Ga0495671_0020859 3300046692 Bacteria 3449
362 Ga0495671_0128194 3300046692 Bacteria 1237
363 Ga0495649_0000277 3300046694 Bacteria 45216
364 Ga0495649_0001292 3300046694 Bacteria 19128
365 Ga0495649_0009432 3300046694 Bacteria 5803
366 Ga0495649_0014753 3300046694 Bacteria 4467
367 Ga0495649_0114376 3300046694 Bacteria 1429
368 Ga0495589_0000535 3300046794 Bacteria 26576
369 Ga0495589_0000972 3300046794 Bacteria 17487
370 Ga0495589_0004770 3300046794 Bacteria 7205
371 Ga0495589_0014376 3300046794 Bacteria 4077
372 Ga0495589_0027168 3300046794 Bacteria 2894
373 Ga0495589_0059785 3300046794 Bacteria 1872
374 Ga0495589_0088804 3300046794 Bacteria 1501
375 Ga0495589_0152693 3300046794 Bacteria 1102
376 Ga0495600_0248601 3300046809 Bacteria 1132
377 Ga0495660_0002353 3300046810 Bacteria 12081
378 Ga0495660_0006875 3300046810 Bacteria 6700
379 Ga0495660_0010411 3300046810 Bacteria 5410
380 Ga0495660_0024709 3300046810 Bacteria 3421
381 Ga0495660_0066190 3300046810 Bacteria 1927
382 Ga0495660_0071706 3300046810 Bacteria 1836
383 Ga0495660_0181716 3300046810 Bacteria 1017
384 Ga0495581_0026115 3300047315 Bacteria 3388
385 Ga0495604_0033921 3300047317 Bacteria 4038
386 Ga0495604_0098875 3300047317 Bacteria 2148
387 Ga0495636_0000616 3300047318 Bacteria 13093
388 Ga0495636_0094186 3300047318 Bacteria 1303
389 Ga0495636_0124490 3300047318 Bacteria 1143
390 Ga0495674_0023732 3300047319 Bacteria 5647
391 Ga0495672_0000188 3300047320 Bacteria 89538
392 Ga0495672_0004356 3300047320 Bacteria 11634
393 Ga0495676_0000309 3300047321 Bacteria 39532
394 Ga0495676_0052363 3300047321 Bacteria 3259
395 Ga0495680_0009206 3300047322 Bacteria 8903
396 Ga0495680_0051846 3300047322 Bacteria 3201
397 Ga0495680_0327951 3300047322 Bacteria 1070
398 Ga0495683_0015724 3300047323 Bacteria 3929
399 Ga0495683_0019638 3300047323 Bacteria 3487
400 Ga0495683_0040809 3300047323 Bacteria 2343
401 Ga0495683_0202090 3300047323 Bacteria 895
402 Ga0495687_001953 3300047443 Bacteria 17622
403 Ga0495687_002700 3300047443 Bacteria 13761
404 Ga0495687_002725 3300047443 Bacteria 13707
405 Ga0495675_0002301 3300047444 Bacteria 11408
406 Ga0495675_0024758 3300047444 Bacteria 3828
407 Ga0495675_0104474 3300047444 Bacteria 1770
408 Ga0495677_0000041 3300047445 Bacteria 75366
409 Ga0495677_0001222 3300047445 Bacteria 10290
410 Ga0495677_0001520 3300047445 Bacteria 9339
411 Ga0495677_0006703 3300047445 Bacteria 4335
412 Ga0495677_0007142 3300047445 Bacteria 4183
413 Ga0495677_0010372 3300047445 Bacteria 3423
414 Ga0495677_0011980 3300047445 Bacteria 3164
415 Ga0495677_0012199 3300047445 Bacteria 3136
416 Ga0495677_0025683 3300047445 Bacteria 2137
417 Ga0495677_0027398 3300047445 Bacteria 2068
418 Ga0495677_0058729 3300047445 Bacteria 1423
419 Ga0495679_003572 3300047446 Bacteria 7426
420 Ga0495679_014399 3300047446 Bacteria 2932
421 Ga0495679_031502 3300047446 Bacteria 1710
422 Ga0495685_002161 3300047447 Bacteria 6103
423 Ga0495685_015961 3300047447 Bacteria 2565
424 Ga0495673_0067653 3300047469 Bacteria 1511
425 Ga0495681_0000667 3300047470 Bacteria 26095
426 Ga0495681_0001579 3300047470 Bacteria 16952
427 Ga0495681_0009196 3300047470 Bacteria 6110
428 Ga0495681_0017517 3300047470 Bacteria 3974
429 Ga0495681_0037570 3300047470 Bacteria 2383
430 Ga0495681_0055112 3300047470 Bacteria 1855
431 Ga0495681_0122540 3300047470 Bacteria 1114
432 Ga0495681_0154811 3300047470 Bacteria 959
433 Ga0495686_0001109 3300047472 Bacteria 31944
434 Ga0495686_0140023 3300047472 Bacteria 1428
435 Ga0495686_0141535 3300047472 Bacteria 1419
436 Ga0495593_0003783 3300047673 Bacteria 9038
437 Ga0495593_0021037 3300047673 Bacteria 3647
438 Ga0495602_0005903 3300048088 Bacteria 12859
439 Ga0495614_0015329 3300048089 Bacteria 3340
440 Ga0495614_0023416 3300048089 Bacteria 2664
441 Ga0495614_0053457 3300048089 Bacteria 1732
442 Ga0495615_0007072 3300048090 Bacteria 2113
443 Ga0495626_0002537 3300048091 Bacteria 12549
444 Ga0495626_0012338 3300048091 Bacteria 4483
445 Ga0495626_0018995 3300048091 Bacteria 3440
446 Ga0495626_0030566 3300048091 Bacteria 2597
447 Ga0495626_0040948 3300048091 Bacteria 2185
448 Ga0495626_0050847 3300048091 Bacteria 1913
449 Ga0495626_0059189 3300048091 Bacteria 1748
450 Ga0495626_0064349 3300048091 Bacteria 1661
451 Ga0496100_0492967 3300048903 Bacteria 943
452 Ga0496101_0017410 3300048904 Bacteria 4874
453 Ga0496102_0041771 3300048905 Bacteria 4154
454 Ga0496103_0015003 3300048906 Bacteria 4606
455 Ga0496103_0084291 3300048906 Bacteria 2002
456 Ga0496104_0474381 3300048907 Bacteria 1163
457 Ga0496106_0001933 3300048909 Bacteria 15541
458 Ga0496107_0046574 3300048910 Bacteria 3121
459 Ga0496107_0292772 3300048910 Bacteria 1212
460 Ga0496109_0005892 3300048912 Bacteria 10280
461 Ga0496109_0236207 3300048912 Bacteria 1720
462 Ga0496110_0000068 3300048913 Bacteria 51803
463 Ga0496110_0029998 3300048913 Bacteria 4685
464 Ga0496110_0042754 3300048913 Bacteria 3955
465 Ga0496111_0015127 3300048914 Bacteria 5288
466 Ga0496112_0224017 3300048915 Bacteria 1836
467 Ga0496112_0813507 3300048915 Bacteria 859
468 Ga0496113_0045202 3300048916 Bacteria 3265
469 Ga0496113_0322018 3300048916 Bacteria 1239
470 Ga0496114_0328530 3300048917 Bacteria 1352
471 Ga0496114_0557236 3300048917 Bacteria 1012
472 Ga0496115_0117024 3300048918 Bacteria 2192
473 Ga0496121_0113973 3300048924 Bacteria 2056
474 Ga0496121_0159828 3300048924 Bacteria 1649
475 Ga0496122_0000445 3300048925 Bacteria 86566
476 Ga0496122_0129632 3300048925 Bacteria 1606
477 Ga0496123_0001531 3300048926 Bacteria 31933
478 Ga0496124_0008983 3300048927 Bacteria 10343
479 Ga0496124_0040017 3300048927 Bacteria 4058
480 Ga0496125_0002437 3300048928 Bacteria 24169
481 Ga0496125_0137861 3300048928 Bacteria 1702
482 Ga0496125_0272628 3300048928 Bacteria 1053
483 Ga0495678_000316 3300049459 Bacteria 51625
484 Ga0495678_002167 3300049459 Bacteria 13851
485 Ga0495678_002239 3300049459 Bacteria 13483
486 Ga0495678_003962 3300049459 Bacteria 8857
487 Ga0495678_103811 3300049459 Bacteria 981
488 Ga0495682_0000107 3300049460 Bacteria 73486
489 Ga0495682_0028359 3300049460 Bacteria 2075
490 Ga0495682_0030285 3300049460 Bacteria 2002
491 Ga0501071_0253810 3300049587 Bacteria 1328
492 nmdc:mga00v17_714_c1 3300050491 Bacteria 18152
493 nmdc:mga05p37_8611_c1 3300050507 Bacteria 12061
494 nmdc:mga05p37_910431_c1 3300050507 Bacteria 947
495 nmdc:mga06r32_12501_c1 3300050510 Bacteria 7662
496 nmdc:mga06r32_512524_c1 3300050510 Bacteria 1176
497 nmdc:mga06r32_58824_c1 3300050510 Bacteria 3694
498 nmdc:mga08y16_49573_c1 3300050511 Bacteria 4395
499 nmdc:mga0a205_238223_c1 3300050515 Bacteria 1701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100469656 Ga0070706_1004696561 225
2 3300005536 Ga0070697_100031861 Ga0070697_1000318613 225
3 3300005333 Ga0070677_10033936 Ga0070677_100339361 226
4 3300005356 Ga0070674_100748231 Ga0070674_1007482311 226
5 3300005364 Ga0070673_100175901 Ga0070673_1001759012 226
6 3300005455 Ga0070663_100391772 Ga0070663_1003917722 226
7 3300005718 Ga0068866_10079670 Ga0068866_100796701 226
8 3300005719 Ga0068861_100119557 Ga0068861_1001195573 226
9 3300005841 Ga0068863_100235608 Ga0068863_1002356083 226
10 3300005841 Ga0068863_101042387 Ga0068863_1010423871 226
11 3300006237 Ga0097621_100026285 Ga0097621_1000262853 226
12 3300006358 Ga0068871_100154506 Ga0068871_1001545062 226
13 3300009177 Ga0105248_10106109 Ga0105248_101061092 226
14 3300013308 Ga0157375_10074423 Ga0157375_100744234 226
15 3300014326 Ga0157380_10098690 Ga0157380_100986902 226
16 3300017792 Ga0163161_10021320 Ga0163161_100213204 226
17 3300025893 Ga0207682_10015104 Ga0207682_100151043 226
18 3300025899 Ga0207642_10035120 Ga0207642_100351203 226
19 3300025907 Ga0207645_10020891 Ga0207645_100208912 226
20 3300025926 Ga0207659_10583418 Ga0207659_105834181 226
21 3300025938 Ga0207704_10051330 Ga0207704_100513301 226
22 3300025938 Ga0207704_10450803 Ga0207704_104508032 226
23 3300025940 Ga0207691_10038318 Ga0207691_100383183 226
24 3300026067 Ga0207678_10332397 Ga0207678_103323971 226
25 3300046515 Ga0495620_0063031 Ga0495620_0063031_70_756 226
26 3300046474 Ga0495605_0004396 Ga0495605_0004396_2807_3553 227
27 3300046491 Ga0495584_0011040 Ga0495584_0011040_3484_4230 227
28 3300046492 Ga0495585_0000060 Ga0495585_0000060_108921_109670 227
29 3300046526 Ga0495666_0007927 Ga0495666_0007927_4413_5159 227
30 3300046530 Ga0495654_0016451 Ga0495654_0016451_908_1654 227
31 3300046531 Ga0495665_0003034 Ga0495665_0003034_53_799 227
32 3300046533 Ga0495640_0030579 Ga0495640_0030579_1590_2336 227
33 3300046538 Ga0495609_0023815 Ga0495609_0023815_1374_2120 227
34 3300046542 Ga0495597_0003907 Ga0495597_0003907_1552_2298 227
35 3300046616 Ga0495668_0002973 Ga0495668_0002973_9882_10628 227
36 3300046648 Ga0495611_0118072 Ga0495611_0118072_106_855 227
37 3300046691 Ga0495670_0012324 Ga0495670_0012324_2903_3652 227
38 3300047317 Ga0495604_0098875 Ga0495604_0098875_1376_2122 227
39 3300047320 Ga0495672_0004356 Ga0495672_0004356_5205_5951 227
40 3300025942 Ga0207689_10023854 Ga0207689_100238541 228
41 3300035172 Ga0373955_0119200 Ga0373955_0119200_146_838 228
42 3300046491 Ga0495584_0013803 Ga0495584_0013803_1943_2707 228
43 3300046492 Ga0495585_0001538 Ga0495585_0001538_3760_4524 228
44 3300046512 Ga0495610_0147691 Ga0495610_0147691_101_865 228
45 3300046518 Ga0495631_0003812 Ga0495631_0003812_5226_5990 228
46 3300046616 Ga0495668_0079078 Ga0495668_0079078_345_1109 228
47 3300046648 Ga0495611_0201734 Ga0495611_0201734_92_856 228
48 3300046691 Ga0495670_0000623 Ga0495670_0000623_13968_14732 228
49 3300047470 Ga0495681_0001579 Ga0495681_0001579_2214_2978 228
50 3300046558 Ga0495633_0001851 Ga0495633_0001851_13319_14083 229
51 3300046665 Ga0495661_0020928 Ga0495661_0020928_1274_2038 229
52 3300005530 Ga0070679_100047579 Ga0070679_1000475792 230
53 3300005578 Ga0068854_100354663 Ga0068854_1003546632 230
54 3300025921 Ga0207652_10028076 Ga0207652_100280764 230
55 3300038443 Ga0395901_0006677 Ga0395901_0006677_91_837 230
56 3300042157 Ga0439458_0020705 Ga0439458_0020705_253_999 230
57 3300048915 Ga0496112_0813507 Ga0496112_0813507_32_778 230
58 3300048917 Ga0496114_0328530 Ga0496114_0328530_149_895 230
59 3300006844 Ga0075428_100299315 Ga0075428_1002993152 232
60 3300006847 Ga0075431_100084430 Ga0075431_1000844305 232
61 3300006852 Ga0075433_10270088 Ga0075433_102700882 232
62 3300037068 Ga0373925_0600506 Ga0373925_0600506_67_771 232
63 3300046500 Ga0495596_0009020 Ga0495596_0009020_226_1047 232
64 3300046513 Ga0495616_0094902 Ga0495616_0094902_35_856 232
65 3300046519 Ga0495632_0009110 Ga0495632_0009110_3476_4297 232
66 3300046538 Ga0495609_0010916 Ga0495609_0010916_3278_4024 232
67 3300046665 Ga0495661_0005057 Ga0495661_0005057_4282_5067 232
68 3300047470 Ga0495681_0122540 Ga0495681_0122540_227_1048 232
69 3300048091 Ga0495626_0018995 Ga0495626_0018995_1782_2603 232
70 3300048904 Ga0496101_0017410 Ga0496101_0017410_3045_3830 232
71 3300048912 Ga0496109_0005892 Ga0496109_0005892_5057_5842 232
72 3300048915 Ga0496112_0224017 Ga0496112_0224017_142_927 232
73 3300048916 Ga0496113_0045202 Ga0496113_0045202_2466_3251 232
74 3300048925 Ga0496122_0000445 Ga0496122_0000445_79057_79842 232
75 3300048926 Ga0496123_0001531 Ga0496123_0001531_24422_25207 232
76 3300048928 Ga0496125_0002437 Ga0496125_0002437_16702_17487 232
77 3300050507 nmdc:mga05p37_8611_c1 nmdc:mga05p37_8611_c1_23_760 232
78 3300050507 nmdc:mga05p37_910431_c1 nmdc:mga05p37_910431_c1_86_823 232
79 3300050510 nmdc:mga06r32_12501_c1 nmdc:mga06r32_12501_c1_4388_5125 232
80 3300050515 nmdc:mga0a205_238223_c1 nmdc:mga0a205_238223_c1_143_880 232
81 3300042139 Ga0450904_000055 Ga0450904_000055_2835_3599 233
82 3300039447 Ga0436361_0934543 Ga0436361_0934543_117_923 234
83 3300006051 Ga0075364_10002305 Ga0075364_100023058 235
84 3300027512 Ga0209179_1038266 Ga0209179_10382662 235
85 3300050491 nmdc:mga00v17_714_c1 nmdc:mga00v17_714_c1_5371_6078 235
86 3300005366 Ga0070659_100192136 Ga0070659_1001921361 236
87 3300005577 Ga0068857_100123883 Ga0068857_1001238831 236
88 3300013296 Ga0157374_10018708 Ga0157374_100187083 236
89 3300025932 Ga0207690_10649783 Ga0207690_106497831 236
90 3300031824 Ga0307413_10133851 Ga0307413_101338512 236
91 3300031852 Ga0307410_10298508 Ga0307410_102985082 236
92 3300031995 Ga0307409_100062428 Ga0307409_1000624282 236
93 3300042008 Ga0439450_066884 Ga0439450_066884_49_795 236
94 3300042012 Ga0439455_0045419 Ga0439455_0045419_194_940 236
95 3300044684 Ga0466966_0001914 Ga0466966_0001914_2938_3705 236
96 3300046519 Ga0495632_0011355 Ga0495632_0011355_1280_2026 236
97 3300046522 Ga0495643_0002628 Ga0495643_0002628_10903_11649 236
98 3300048091 Ga0495626_0059189 Ga0495626_0059189_706_1452 236
99 3300049459 Ga0495678_103811 Ga0495678_103811_19_765 236
100 3300049587 Ga0501071_0253810 Ga0501071_0253810_83_799 236
101 3300050511 nmdc:mga08y16_49573_c1 nmdc:mga08y16_49573_c1_3601_4332 236
102 3300007788 Ga0099795_10052670 Ga0099795_100526701 237
103 3300031238 Ga0265332_10005514 Ga0265332_100055144 237
104 3300031249 Ga0265339_10000280 Ga0265339_1000028010 237
105 3300031250 Ga0265331_10010454 Ga0265331_100104544 237
106 3300031711 Ga0265314_10005871 Ga0265314_100058713 237
107 3300031712 Ga0265342_10034426 Ga0265342_100344263 237
108 3300037068 Ga0373925_0061109 Ga0373925_0061109_815_1579 237
109 3300046500 Ga0495596_0041440 Ga0495596_0041440_590_1336 237
110 3300046507 Ga0495606_0076091 Ga0495606_0076091_1051_1794 237
111 3300046522 Ga0495643_0041293 Ga0495643_0041293_1044_1793 237
112 3300046542 Ga0495597_0000812 Ga0495597_0000812_5206_5949 237
113 3300046794 Ga0495589_0000535 Ga0495589_0000535_17413_18156 237
114 3300048091 Ga0495626_0002537 Ga0495626_0002537_7968_8714 237
115 3300005548 Ga0070665_100000038 Ga0070665_10000003842 238
116 3300005577 Ga0068857_100381484 Ga0068857_1003814842 238
117 3300006847 Ga0075431_100181001 Ga0075431_1001810012 238
118 3300026035 Ga0207703_10153670 Ga0207703_101536702 238
119 3300028379 Ga0268266_10000634 Ga0268266_1000063420 238
120 3300046519 Ga0495632_0000129 Ga0495632_0000129_19052_19798 238
121 3300046810 Ga0495660_0010411 Ga0495660_0010411_2884_3630 238
122 3300046810 Ga0495660_0066190 Ga0495660_0066190_558_1304 238
123 3300050510 nmdc:mga06r32_512524_c1 nmdc:mga06r32_512524_c1_14_736 238
124 iso_pu_bacteria 2643221556 2643798072 238
125 iso_pu_bacteria 2643221684 2644473250 238
126 iso_pu_bacteria 8047673197 8047678078 238
127 3300005336 Ga0070680_100043549 Ga0070680_1000435494 239
128 3300005338 Ga0068868_100317360 Ga0068868_1003173601 239
129 3300005458 Ga0070681_10020138 Ga0070681_100201383 239
130 3300005518 Ga0070699_100203558 Ga0070699_1002035582 239
131 3300005530 Ga0070679_100075091 Ga0070679_1000750912 239
132 3300005563 Ga0068855_100028919 Ga0068855_1000289193 239
133 3300005616 Ga0068852_100206876 Ga0068852_1002068762 239
134 3300006880 Ga0075429_100100808 Ga0075429_1001008083 239
135 3300009093 Ga0105240_10008454 Ga0105240_100084549 239
136 3300009551 Ga0105238_10423071 Ga0105238_104230712 239
137 3300025912 Ga0207707_10114736 Ga0207707_101147361 239
138 3300025921 Ga0207652_10507773 Ga0207652_105077731 239
139 3300025924 Ga0207694_10311010 Ga0207694_103110102 239
140 3300025949 Ga0207667_10048358 Ga0207667_100483582 239
141 3300026078 Ga0207702_10253110 Ga0207702_102531103 239
142 3300050510 nmdc:mga06r32_58824_c1 nmdc:mga06r32_58824_c1_1460_2185 239
143 3300046506 Ga0495583_0025477 Ga0495583_0025477_1155_1901 240
144 3300046507 Ga0495606_0105016 Ga0495606_0105016_508_1254 240
145 3300046543 Ga0495645_0035511 Ga0495645_0035511_2669_3391 240
146 3300046694 Ga0495649_0009432 Ga0495649_0009432_900_1646 240
147 3300048090 Ga0495615_0007072 Ga0495615_0007072_65_787 240
148 3300048906 Ga0496103_0084291 Ga0496103_0084291_1169_1891 240
149 3300048907 Ga0496104_0474381 Ga0496104_0474381_83_805 240
150 3300048910 Ga0496107_0292772 Ga0496107_0292772_345_1067 240
151 3300048913 Ga0496110_0042754 Ga0496110_0042754_3013_3735 240
152 3300048917 Ga0496114_0557236 Ga0496114_0557236_96_818 240
153 3300005843 Ga0068860_100712557 Ga0068860_1007125572 241
154 3300031250 Ga0265331_10183669 Ga0265331_101836691 241
155 3300037418 Ga0395900_0245724 Ga0395900_0245724_484_1221 241
156 3300037466 Ga0395898_0271522 Ga0395898_0271522_345_1082 241
157 3300037471 Ga0395905_0133259 Ga0395905_0133259_1209_1946 241
158 3300005563 Ga0068855_100386484 Ga0068855_1003864842 242
159 3300009036 Ga0105244_10056104 Ga0105244_100561041 242
160 3300025254 Ga0209148_1000930 Ga0209148_10009304 242
161 3300037312 Ga0395899_0006007 Ga0395899_0006007_4463_5191 242
162 3300037312 Ga0395899_0094023 Ga0395899_0094023_1243_1971 242
163 3300037312 Ga0395899_0410334 Ga0395899_0410334_25_753 242
164 3300037471 Ga0395905_0041359 Ga0395905_0041359_268_1008 242
165 3300038443 Ga0395901_0147479 Ga0395901_0147479_1389_2117 242
166 3300044656 Ga0466969_0027876 Ga0466969_0027876_819_1604 242
167 3300045049 Ga0466959_0223099 Ga0466959_0223099_47_832 242
168 3300046491 Ga0495584_0002152 Ga0495584_0002152_2123_2851 242
169 3300046513 Ga0495616_0009720 Ga0495616_0009720_2963_3691 242
170 3300046528 Ga0495642_0000313 Ga0495642_0000313_6565_7293 242
171 3300046674 Ga0495588_0000177 Ga0495588_0000177_21216_21944 242
172 3300047445 Ga0495677_0007142 Ga0495677_0007142_1833_2561 242
173 3300047472 Ga0495686_0001109 Ga0495686_0001109_17968_18711 242
174 3300048903 Ga0496100_0492967 Ga0496100_0492967_142_870 242
175 3300048909 Ga0496106_0001933 Ga0496106_0001933_5668_6396 242
176 3300048910 Ga0496107_0046574 Ga0496107_0046574_1932_2660 242
177 3300048916 Ga0496113_0322018 Ga0496113_0322018_493_1221 242
178 3300048924 Ga0496121_0159828 Ga0496121_0159828_136_864 242
179 3300048927 Ga0496124_0040017 Ga0496124_0040017_2186_2914 242
180 3300048928 Ga0496125_0137861 Ga0496125_0137861_366_1094 242
181 iso_pu_bacteria 2808606418 2809143827 242
182 3300037471 Ga0395905_0088159 Ga0395905_0088159_1390_2175 243
183 3300046674 Ga0495588_0034967 Ga0495588_0034967_1343_2089 244
184 3300005344 Ga0070661_100024527 Ga0070661_1000245272 245
185 3300005366 Ga0070659_100012614 Ga0070659_1000126143 245
186 3300005457 Ga0070662_100115640 Ga0070662_1001156402 245
187 3300005564 Ga0070664_100019536 Ga0070664_1000195363 245
188 3300021361 Ga0213872_10072570 Ga0213872_100725703 245
189 3300025919 Ga0207657_10013265 Ga0207657_100132652 245
190 3300025932 Ga0207690_10014014 Ga0207690_100140144 245
191 3300025933 Ga0207706_10125937 Ga0207706_101259372 245
192 3300025945 Ga0207679_10022040 Ga0207679_100220402 245
193 3300046455 Ga0495603_0109716 Ga0495603_0109716_249_995 245
194 3300046491 Ga0495584_0001632 Ga0495584_0001632_2956_3702 245
195 3300046492 Ga0495585_0152996 Ga0495585_0152996_300_1049 245
196 3300046499 Ga0495594_0045882 Ga0495594_0045882_1407_2156 245
197 3300046500 Ga0495596_0001513 Ga0495596_0001513_7690_8439 245
198 3300046518 Ga0495631_0004884 Ga0495631_0004884_1514_2263 245
199 3300046522 Ga0495643_0040128 Ga0495643_0040128_20_769 245
200 3300046531 Ga0495665_0016646 Ga0495665_0016646_386_1135 245
201 3300046538 Ga0495609_0017434 Ga0495609_0017434_1449_2198 245
202 3300046557 Ga0495622_0060554 Ga0495622_0060554_279_1028 245
203 3300046558 Ga0495633_0018337 Ga0495633_0018337_2271_3017 245
204 3300046616 Ga0495668_0006948 Ga0495668_0006948_304_1053 245
205 3300046648 Ga0495611_0005097 Ga0495611_0005097_3429_4175 245
206 3300046663 Ga0495635_0086722 Ga0495635_0086722_1350_2099 245
207 3300046664 Ga0495659_0110303 Ga0495659_0110303_257_1003 245
208 3300046665 Ga0495661_0005993 Ga0495661_0005993_7718_8536 245
209 3300046691 Ga0495670_0012951 Ga0495670_0012951_269_1015 245
210 3300046794 Ga0495589_0088804 Ga0495589_0088804_412_1161 245
211 3300046794 Ga0495589_0152693 Ga0495589_0152693_78_824 245
212 3300047315 Ga0495581_0026115 Ga0495581_0026115_1344_2159 245
213 3300047318 Ga0495636_0000616 Ga0495636_0000616_1016_1762 245
214 3300047319 Ga0495674_0023732 Ga0495674_0023732_2035_2850 245
215 3300047321 Ga0495676_0052363 Ga0495676_0052363_937_1686 245
216 3300047322 Ga0495680_0327951 Ga0495680_0327951_95_910 245
217 3300047445 Ga0495677_0010372 Ga0495677_0010372_1860_2609 245
218 3300047445 Ga0495677_0058729 Ga0495677_0058729_468_1214 245
219 3300047469 Ga0495673_0067653 Ga0495673_0067653_21_770 245
220 3300047470 Ga0495681_0154811 Ga0495681_0154811_181_927 245
221 3300047673 Ga0495593_0003783 Ga0495593_0003783_477_1292 245
222 3300048089 Ga0495614_0053457 Ga0495614_0053457_768_1583 245
223 3300048091 Ga0495626_0064349 Ga0495626_0064349_185_934 245
224 3300046457 Ga0495590_0004449 Ga0495590_0004449_1095_1835 246
225 3300046507 Ga0495606_0259642 Ga0495606_0259642_57_797 246
226 3300047444 Ga0495675_0104474 Ga0495675_0104474_350_1090 246
227 3300048088 Ga0495602_0005903 Ga0495602_0005903_2968_3708 246
228 3300037471 Ga0395905_0677471 Ga0395905_0677471_77_820 247
229 3300038443 Ga0395901_0111283 Ga0395901_0111283_763_1506 247
230 3300046457 Ga0495590_0032988 Ga0495590_0032988_696_1541 247
231 3300046460 Ga0495638_0151767 Ga0495638_0151767_162_905 247
232 3300046463 Ga0495653_0102968 Ga0495653_0102968_681_1424 247
233 3300046472 Ga0495580_0042615 Ga0495580_0042615_868_1611 247
234 3300046473 Ga0495582_0002194 Ga0495582_0002194_5143_5886 247
235 3300046475 Ga0495639_0201731 Ga0495639_0201731_77_820 247
236 3300046499 Ga0495594_0012200 Ga0495594_0012200_1221_1964 247
237 3300046506 Ga0495583_0012943 Ga0495583_0012943_2841_3584 247
238 3300046513 Ga0495616_0008377 Ga0495616_0008377_190_933 247
239 3300046517 Ga0495630_0008344 Ga0495630_0008344_587_1330 247
240 3300046518 Ga0495631_0000951 Ga0495631_0000951_10564_11307 247
241 3300046519 Ga0495632_0259765 Ga0495632_0259765_14_757 247
242 3300046520 Ga0495637_0061688 Ga0495637_0061688_506_1249 247
243 3300046524 Ga0495648_0003935 Ga0495648_0003935_10217_10960 247
244 3300046524 Ga0495648_0033459 Ga0495648_0033459_1917_2660 247
245 3300046526 Ga0495666_0019121 Ga0495666_0019121_1260_2003 247
246 3300046528 Ga0495642_0034918 Ga0495642_0034918_453_1211 247
247 3300046530 Ga0495654_0005307 Ga0495654_0005307_6034_6777 247
248 3300046531 Ga0495665_0007366 Ga0495665_0007366_2174_2917 247
249 3300046535 Ga0495586_0021248 Ga0495586_0021248_277_1020 247
250 3300046536 Ga0495587_0026119 Ga0495587_0026119_136_879 247
251 3300046538 Ga0495609_0021406 Ga0495609_0021406_773_1516 247
252 3300046542 Ga0495597_0010562 Ga0495597_0010562_2053_2796 247
253 3300046543 Ga0495645_0247677 Ga0495645_0247677_214_957 247
254 3300046616 Ga0495668_0010024 Ga0495668_0010024_1785_2528 247
255 3300046642 Ga0495634_0007884 Ga0495634_0007884_5968_6711 247
256 3300046660 Ga0495625_0012809 Ga0495625_0012809_2985_3728 247
257 3300046679 Ga0495623_0007137 Ga0495623_0007137_3087_3830 247
258 3300046679 Ga0495623_0008273 Ga0495623_0008273_4330_5073 247
259 3300046680 Ga0495646_0167944 Ga0495646_0167944_339_1082 247
260 3300046692 Ga0495671_0020859 Ga0495671_0020859_1181_1924 247
261 3300047317 Ga0495604_0033921 Ga0495604_0033921_2479_3222 247
262 3300047318 Ga0495636_0094186 Ga0495636_0094186_53_796 247
263 3300047322 Ga0495680_0051846 Ga0495680_0051846_1590_2333 247
264 3300047443 Ga0495687_002700 Ga0495687_002700_863_1606 247
265 3300047444 Ga0495675_0024758 Ga0495675_0024758_997_1740 247
266 3300047446 Ga0495679_014399 Ga0495679_014399_563_1306 247
267 3300047447 Ga0495685_002161 Ga0495685_002161_5153_5896 247
268 3300047470 Ga0495681_0037570 Ga0495681_0037570_715_1458 247
269 3300048091 Ga0495626_0050847 Ga0495626_0050847_335_1078 247
270 3300048913 Ga0496110_0000068 Ga0496110_0000068_33980_34723 247
271 3300048913 Ga0496110_0029998 Ga0496110_0029998_999_1745 247
272 3300048914 Ga0496111_0015127 Ga0496111_0015127_2631_3377 247
273 3300048928 Ga0496125_0272628 Ga0496125_0272628_200_946 247
274 3300049459 Ga0495678_000316 Ga0495678_000316_37047_37892 247
275 3300049459 Ga0495678_003962 Ga0495678_003962_2725_3468 247
276 3300049460 Ga0495682_0030285 Ga0495682_0030285_125_868 247
277 3300003575 Ga0007409J51694_1014877 Ga0007409J51694_10148771 248
278 3300005262 Ga0065165_1000286 Ga0065165_10002867 248
279 3300005339 Ga0070660_100085399 Ga0070660_1000853992 248
280 3300005339 Ga0070660_100321901 Ga0070660_1003219012 248
281 3300005344 Ga0070661_100008038 Ga0070661_1000080381 248
282 3300005366 Ga0070659_100054667 Ga0070659_1000546672 248
283 3300005563 Ga0068855_100070433 Ga0068855_1000704332 248
284 3300005616 Ga0068852_100195664 Ga0068852_1001956642 248
285 3300009545 Ga0105237_10102204 Ga0105237_101022042 248
286 3300025909 Ga0207705_10039654 Ga0207705_100396542 248
287 3300026142 Ga0207698_10373745 Ga0207698_103737452 248
288 3300037312 Ga0395899_0000139 Ga0395899_0000139_9414_10160 248
289 3300037466 Ga0395898_0027743 Ga0395898_0027743_4024_4800 248
290 3300038443 Ga0395901_0273200 Ga0395901_0273200_198_974 248
291 3300044656 Ga0466969_0055398 Ga0466969_0055398_773_1519 248
292 3300044656 Ga0466969_0163510 Ga0466969_0163510_175_921 248
293 3300044658 Ga0466972_0100014 Ga0466972_0100014_102_848 248
294 3300044672 Ga0466982_0061820 Ga0466982_0061820_141_890 248
295 3300044683 Ga0466965_0025382 Ga0466965_0025382_1569_2315 248
296 3300044684 Ga0466966_0014154 Ga0466966_0014154_800_1546 248
297 3300044684 Ga0466966_0025583 Ga0466966_0025583_2273_3019 248
298 3300044693 Ga0466961_0096897 Ga0466961_0096897_809_1555 248
299 3300044694 Ga0466963_0050448 Ga0466963_0050448_1043_1789 248
300 3300044765 Ga0466970_0107852 Ga0466970_0107852_726_1472 248
301 3300044842 Ga0466957_0030026 Ga0466957_0030026_1022_1768 248
302 3300044842 Ga0466957_0140474 Ga0466957_0140474_799_1545 248
303 3300044842 Ga0466957_0309107 Ga0466957_0309107_172_918 248
304 3300045049 Ga0466959_0178288 Ga0466959_0178288_116_862 248
305 3300045976 Ga0466967_0279494 Ga0466967_0279494_633_1379 248
306 3300045976 Ga0466967_1148746 Ga0466967_1148746_14_760 248
307 3300046452 Ga0495617_000002 Ga0495617_000002_602868_603614 248
308 3300046453 Ga0495627_000207 Ga0495627_000207_51330_52076 248
309 3300046453 Ga0495627_023575 Ga0495627_023575_1213_1959 248
310 3300046453 Ga0495627_030970 Ga0495627_030970_332_1081 248
311 3300046463 Ga0495653_0008877 Ga0495653_0008877_1635_2381 248
312 3300046471 Ga0495650_0000085 Ga0495650_0000085_47744_48493 248
313 3300046471 Ga0495650_0032523 Ga0495650_0032523_971_1717 248
314 3300046471 Ga0495650_0034818 Ga0495650_0034818_1248_1994 248
315 3300046473 Ga0495582_0033801 Ga0495582_0033801_1432_2181 248
316 3300046474 Ga0495605_0000293 Ga0495605_0000293_31536_32282 248
317 3300046474 Ga0495605_0004494 Ga0495605_0004494_4362_5111 248
318 3300046474 Ga0495605_0011250 Ga0495605_0011250_2234_2980 248
319 3300046474 Ga0495605_0012549 Ga0495605_0012549_1927_2679 248
320 3300046474 Ga0495605_0094338 Ga0495605_0094338_530_1276 248
321 3300046491 Ga0495584_0005819 Ga0495584_0005819_3257_4003 248
322 3300046491 Ga0495584_0006531 Ga0495584_0006531_4783_5529 248
323 3300046491 Ga0495584_0016821 Ga0495584_0016821_2593_3339 248
324 3300046491 Ga0495584_0017335 Ga0495584_0017335_1568_2314 248
325 3300046491 Ga0495584_0039629 Ga0495584_0039629_1210_2004 248
326 3300046492 Ga0495585_0009014 Ga0495585_0009014_473_1219 248
327 3300046492 Ga0495585_0009266 Ga0495585_0009266_4643_5392 248
328 3300046492 Ga0495585_0029165 Ga0495585_0029165_1306_2052 248
329 3300046492 Ga0495585_0029211 Ga0495585_0029211_939_1688 248
330 3300046492 Ga0495585_0041145 Ga0495585_0041145_1502_2248 248
331 3300046492 Ga0495585_0089359 Ga0495585_0089359_443_1192 248
332 3300046492 Ga0495585_0157423 Ga0495585_0157423_423_1169 248
333 3300046492 Ga0495585_0173169 Ga0495585_0173169_158_904 248
334 3300046499 Ga0495594_0018877 Ga0495594_0018877_284_1030 248
335 3300046500 Ga0495596_0002222 Ga0495596_0002222_4876_5625 248
336 3300046500 Ga0495596_0002396 Ga0495596_0002396_3701_4450 248
337 3300046500 Ga0495596_0006959 Ga0495596_0006959_3041_3787 248
338 3300046500 Ga0495596_0010389 Ga0495596_0010389_400_1146 248
339 3300046500 Ga0495596_0024951 Ga0495596_0024951_985_1734 248
340 3300046500 Ga0495596_0027404 Ga0495596_0027404_178_924 248
341 3300046501 Ga0495607_0002697 Ga0495607_0002697_558_1352 248
342 3300046501 Ga0495607_0003269 Ga0495607_0003269_9645_10391 248
343 3300046501 Ga0495607_0007843 Ga0495607_0007843_2137_2889 248
344 3300046501 Ga0495607_0007885 Ga0495607_0007885_3176_3922 248
345 3300046501 Ga0495607_0032114 Ga0495607_0032114_1386_2132 248
346 3300046501 Ga0495607_0047630 Ga0495607_0047630_1525_2271 248
347 3300046506 Ga0495583_0000372 Ga0495583_0000372_6452_7198 248
348 3300046506 Ga0495583_0011561 Ga0495583_0011561_3479_4225 248
349 3300046506 Ga0495583_0032191 Ga0495583_0032191_693_1442 248
350 3300046507 Ga0495606_0025258 Ga0495606_0025258_477_1226 248
351 3300046507 Ga0495606_0044723 Ga0495606_0044723_1297_2043 248
352 3300046513 Ga0495616_0000207 Ga0495616_0000207_6990_7736 248
353 3300046513 Ga0495616_0003852 Ga0495616_0003852_2275_3024 248
354 3300046513 Ga0495616_0005637 Ga0495616_0005637_1208_1954 248
355 3300046513 Ga0495616_0005696 Ga0495616_0005696_3509_4255 248
356 3300046513 Ga0495616_0019146 Ga0495616_0019146_2461_3255 248
357 3300046513 Ga0495616_0022457 Ga0495616_0022457_388_1137 248
358 3300046513 Ga0495616_0069619 Ga0495616_0069619_921_1667 248
359 3300046518 Ga0495631_0004785 Ga0495631_0004785_11_757 248
360 3300046518 Ga0495631_0005985 Ga0495631_0005985_2227_2976 248
361 3300046518 Ga0495631_0006303 Ga0495631_0006303_3418_4164 248
362 3300046518 Ga0495631_0009757 Ga0495631_0009757_1316_2062 248
363 3300046518 Ga0495631_0033631 Ga0495631_0033631_101_853 248
364 3300046518 Ga0495631_0034697 Ga0495631_0034697_1131_1877 248
365 3300046518 Ga0495631_0078972 Ga0495631_0078972_427_1173 248
366 3300046519 Ga0495632_0000077 Ga0495632_0000077_89882_90628 248
367 3300046519 Ga0495632_0000296 Ga0495632_0000296_41738_42484 248
368 3300046519 Ga0495632_0003812 Ga0495632_0003812_615_1361 248
369 3300046522 Ga0495643_0003068 Ga0495643_0003068_11244_11990 248
370 3300046523 Ga0495644_0014515 Ga0495644_0014515_1159_1905 248
371 3300046523 Ga0495644_0042698 Ga0495644_0042698_177_926 248
372 3300046523 Ga0495644_0064497 Ga0495644_0064497_231_977 248
373 3300046523 Ga0495644_0095264 Ga0495644_0095264_118_864 248
374 3300046523 Ga0495644_0171740 Ga0495644_0171740_12_758 248
375 3300046524 Ga0495648_0001105 Ga0495648_0001105_6768_7514 248
376 3300046524 Ga0495648_0008300 Ga0495648_0008300_6188_6937 248
377 3300046524 Ga0495648_0034610 Ga0495648_0034610_1010_1756 248
378 3300046525 Ga0495663_0002406 Ga0495663_0002406_2680_3426 248
379 3300046528 Ga0495642_0000085 Ga0495642_0000085_41261_42007 248
380 3300046528 Ga0495642_0000285 Ga0495642_0000285_6070_6816 248
381 3300046528 Ga0495642_0007287 Ga0495642_0007287_614_1360 248
382 3300046528 Ga0495642_0015858 Ga0495642_0015858_1798_2544 248
383 3300046528 Ga0495642_0022739 Ga0495642_0022739_1314_2066 248
384 3300046528 Ga0495642_0029469 Ga0495642_0029469_915_1709 248
385 3300046528 Ga0495642_0047518 Ga0495642_0047518_829_1578 248
386 3300046528 Ga0495642_0076694 Ga0495642_0076694_477_1223 248
387 3300046530 Ga0495654_0075175 Ga0495654_0075175_13_759 248
388 3300046535 Ga0495586_0001694 Ga0495586_0001694_1965_2711 248
389 3300046538 Ga0495609_0000002 Ga0495609_0000002_363800_364594 248
390 3300046538 Ga0495609_0000298 Ga0495609_0000298_26853_27602 248
391 3300046538 Ga0495609_0000886 Ga0495609_0000886_18471_19217 248
392 3300046538 Ga0495609_0012909 Ga0495609_0012909_588_1334 248
393 3300046538 Ga0495609_0034920 Ga0495609_0034920_474_1220 248
394 3300046542 Ga0495597_0000226 Ga0495597_0000226_33234_33980 248
395 3300046542 Ga0495597_0000995 Ga0495597_0000995_2203_2949 248
396 3300046542 Ga0495597_0012539 Ga0495597_0012539_2175_2921 248
397 3300046542 Ga0495597_0030728 Ga0495597_0030728_171_917 248
398 3300046542 Ga0495597_0100323 Ga0495597_0100323_233_988 248
399 3300046557 Ga0495622_0006961 Ga0495622_0006961_3497_4243 248
400 3300046558 Ga0495633_0015416 Ga0495633_0015416_834_1580 248
401 3300046558 Ga0495633_0039291 Ga0495633_0039291_1300_2049 248
402 3300046558 Ga0495633_0131256 Ga0495633_0131256_350_1096 248
403 3300046615 Ga0495656_0012532 Ga0495656_0012532_2330_3076 248
404 3300046615 Ga0495656_0016119 Ga0495656_0016119_998_1744 248
405 3300046615 Ga0495656_0144397 Ga0495656_0144397_45_791 248
406 3300046615 Ga0495656_0199668 Ga0495656_0199668_43_789 248
407 3300046616 Ga0495668_0000274 Ga0495668_0000274_45057_45803 248
408 3300046616 Ga0495668_0000941 Ga0495668_0000941_25729_26475 248
409 3300046616 Ga0495668_0001920 Ga0495668_0001920_7985_8731 248
410 3300046616 Ga0495668_0011866 Ga0495668_0011866_3378_4124 248
411 3300046616 Ga0495668_0012332 Ga0495668_0012332_3039_3791 248
412 3300046616 Ga0495668_0025787 Ga0495668_0025787_1447_2193 248
413 3300046616 Ga0495668_0038328 Ga0495668_0038328_321_1070 248
414 3300046616 Ga0495668_0042272 Ga0495668_0042272_1334_2083 248
415 3300046648 Ga0495611_0000773 Ga0495611_0000773_6846_7592 248
416 3300046648 Ga0495611_0024293 Ga0495611_0024293_644_1390 248
417 3300046648 Ga0495611_0029099 Ga0495611_0029099_196_942 248
418 3300046648 Ga0495611_0163411 Ga0495611_0163411_217_963 248
419 3300046660 Ga0495625_0020366 Ga0495625_0020366_3184_3933 248
420 3300046660 Ga0495625_0086872 Ga0495625_0086872_281_1030 248
421 3300046663 Ga0495635_0006164 Ga0495635_0006164_1193_1939 248
422 3300046665 Ga0495661_0001749 Ga0495661_0001749_565_1359 248
423 3300046665 Ga0495661_0003878 Ga0495661_0003878_8044_8790 248
424 3300046665 Ga0495661_0004982 Ga0495661_0004982_1851_2597 248
425 3300046665 Ga0495661_0025026 Ga0495661_0025026_2248_2994 248
426 3300046665 Ga0495661_0045361 Ga0495661_0045361_1103_1849 248
427 3300046665 Ga0495661_0052283 Ga0495661_0052283_1502_2248 248
428 3300046665 Ga0495661_0089564 Ga0495661_0089564_390_1136 248
429 3300046665 Ga0495661_0097418 Ga0495661_0097418_834_1586 248
430 3300046665 Ga0495661_0098738 Ga0495661_0098738_320_1066 248
431 3300046674 Ga0495588_0015555 Ga0495588_0015555_927_1673 248
432 3300046674 Ga0495588_0037318 Ga0495588_0037318_1439_2188 248
433 3300046674 Ga0495588_0126376 Ga0495588_0126376_139_885 248
434 3300046684 Ga0495669_0000092 Ga0495669_0000092_51097_51846 248
435 3300046684 Ga0495669_0001619 Ga0495669_0001619_6668_7414 248
436 3300046684 Ga0495669_0004755 Ga0495669_0004755_1710_2456 248
437 3300046684 Ga0495669_0032550 Ga0495669_0032550_617_1363 248
438 3300046684 Ga0495669_0194166 Ga0495669_0194166_53_799 248
439 3300046691 Ga0495670_0020078 Ga0495670_0020078_1967_2713 248
440 3300046691 Ga0495670_0031241 Ga0495670_0031241_1094_1840 248
441 3300046692 Ga0495671_0000965 Ga0495671_0000965_12798_13544 248
442 3300046692 Ga0495671_0015306 Ga0495671_0015306_1974_2720 248
443 3300046692 Ga0495671_0128194 Ga0495671_0128194_28_774 248
444 3300046694 Ga0495649_0000277 Ga0495649_0000277_5500_6246 248
445 3300046694 Ga0495649_0001292 Ga0495649_0001292_8297_9043 248
446 3300046694 Ga0495649_0014753 Ga0495649_0014753_2937_3689 248
447 3300046694 Ga0495649_0114376 Ga0495649_0114376_412_1161 248
448 3300046794 Ga0495589_0000972 Ga0495589_0000972_16192_16986 248
449 3300046794 Ga0495589_0004770 Ga0495589_0004770_3298_4044 248
450 3300046794 Ga0495589_0014376 Ga0495589_0014376_1823_2569 248
451 3300046794 Ga0495589_0027168 Ga0495589_0027168_1739_2491 248
452 3300046794 Ga0495589_0059785 Ga0495589_0059785_1115_1861 248
453 3300046809 Ga0495600_0248601 Ga0495600_0248601_60_806 248
454 3300046810 Ga0495660_0002353 Ga0495660_0002353_6355_7101 248
455 3300046810 Ga0495660_0006875 Ga0495660_0006875_5618_6364 248
456 3300046810 Ga0495660_0024709 Ga0495660_0024709_2050_2796 248
457 3300046810 Ga0495660_0071706 Ga0495660_0071706_405_1151 248
458 3300046810 Ga0495660_0181716 Ga0495660_0181716_121_870 248
459 3300047318 Ga0495636_0124490 Ga0495636_0124490_338_1090 248
460 3300047320 Ga0495672_0000188 Ga0495672_0000188_47218_47967 248
461 3300047321 Ga0495676_0000309 Ga0495676_0000309_30025_30771 248
462 3300047322 Ga0495680_0009206 Ga0495680_0009206_7534_8280 248
463 3300047323 Ga0495683_0015724 Ga0495683_0015724_1613_2362 248
464 3300047323 Ga0495683_0019638 Ga0495683_0019638_1205_1954 248
465 3300047323 Ga0495683_0040809 Ga0495683_0040809_1204_1956 248
466 3300047323 Ga0495683_0202090 Ga0495683_0202090_12_758 248
467 3300047443 Ga0495687_001953 Ga0495687_001953_703_1497 248
468 3300047443 Ga0495687_002725 Ga0495687_002725_2304_3053 248
469 3300047444 Ga0495675_0002301 Ga0495675_0002301_982_1728 248
470 3300047445 Ga0495677_0000041 Ga0495677_0000041_59070_59864 248
471 3300047445 Ga0495677_0001222 Ga0495677_0001222_7826_8572 248
472 3300047445 Ga0495677_0001520 Ga0495677_0001520_6352_7098 248
473 3300047445 Ga0495677_0006703 Ga0495677_0006703_889_1635 248
474 3300047445 Ga0495677_0011980 Ga0495677_0011980_139_885 248
475 3300047445 Ga0495677_0012199 Ga0495677_0012199_2314_3060 248
476 3300047445 Ga0495677_0025683 Ga0495677_0025683_577_1323 248
477 3300047445 Ga0495677_0027398 Ga0495677_0027398_481_1230 248
478 3300047446 Ga0495679_003572 Ga0495679_003572_6614_7360 248
479 3300047446 Ga0495679_031502 Ga0495679_031502_862_1608 248
480 3300047447 Ga0495685_015961 Ga0495685_015961_321_1067 248
481 3300047470 Ga0495681_0000667 Ga0495681_0000667_18813_19559 248
482 3300047470 Ga0495681_0009196 Ga0495681_0009196_1070_1816 248
483 3300047470 Ga0495681_0017517 Ga0495681_0017517_2184_2933 248
484 3300047470 Ga0495681_0055112 Ga0495681_0055112_507_1253 248
485 3300047472 Ga0495686_0140023 Ga0495686_0140023_377_1126 248
486 3300047472 Ga0495686_0141535 Ga0495686_0141535_413_1159 248
487 3300047673 Ga0495593_0021037 Ga0495593_0021037_515_1261 248
488 3300048089 Ga0495614_0015329 Ga0495614_0015329_213_962 248
489 3300048089 Ga0495614_0023416 Ga0495614_0023416_72_818 248
490 3300048091 Ga0495626_0012338 Ga0495626_0012338_2530_3276 248
491 3300048091 Ga0495626_0030566 Ga0495626_0030566_422_1171 248
492 3300048091 Ga0495626_0040948 Ga0495626_0040948_648_1394 248
493 3300048905 Ga0496102_0041771 Ga0496102_0041771_2581_3327 248
494 3300048906 Ga0496103_0015003 Ga0496103_0015003_1051_1797 248
495 3300048912 Ga0496109_0236207 Ga0496109_0236207_530_1276 248
496 3300048918 Ga0496115_0117024 Ga0496115_0117024_1096_1842 248
497 3300048924 Ga0496121_0113973 Ga0496121_0113973_668_1441 248
498 3300048925 Ga0496122_0129632 Ga0496122_0129632_64_846 248
499 3300048927 Ga0496124_0008983 Ga0496124_0008983_8457_9203 248
500 3300049459 Ga0495678_002167 Ga0495678_002167_7141_7887 248
501 3300049459 Ga0495678_002239 Ga0495678_002239_7558_8307 248
502 3300049460 Ga0495682_0000107 Ga0495682_0000107_20554_21303 248
503 3300049460 Ga0495682_0028359 Ga0495682_0028359_976_1722 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00230

MIP

Major intrinsic protein

1

211

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o9e-assembly1.cif.gz_A crystal structure of aqpz mutant t183c complexed with mercury 0.9841 1 228
2o9g-assembly1.cif.gz_A crystal structure of aqpz mutant l170c complexed with mercury. 0.9837 1 228
2o9d-assembly2.cif.gz_B crystal structure of aqpz mutant t183c. 0.9835 1 228
3nk5-assembly2.cif.gz_B crystal structure of aqpz mutant f43w 0.9829 1 228
3nka-assembly2.cif.gz_B crystal structure of aqpz h174g,t183f 0.9827 1 228
ID Description Score Start End Superfamily
3llqB00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9795 1 228 1.20.1080.10
3llqB00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9506 1 228 1.20.1080.10
af_I1NH56_66_171_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9418 2 99 1.20.1080.10
2b5fB00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9238 1 225 1.20.1080.10
af_A0A1D6PLK2_10_163_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9203 2 105 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A2J4YQS4-F1-model_v4 Aquaporin Z 0.9876 47 229 GO:0005886
GO:0015250
AF-A0A2T3J1Q4-F1-model_v4 Aquaporin Z 0.9873 1 223 GO:0005886
GO:0015250
AF-A0A2S5MA84-F1-model_v4 Aquaporin Z 0.9869 41 229 GO:0005886
GO:0015250
AF-A0A0C5WTB5-F1-model_v4 Aquaporin Z 0.9867 1 229 GO:0005886
GO:0015250
AF-A0A0D1LSR2-F1-model_v4 deleted 0.9866 1 228

Feature Viewer

pLDDT pTM Quality
87.73 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map