F456019

General Info

Members Datasets Scaffolds Average Seq Length
503 229 503 386

Family's Representative Sequence

Representative Sequence 3300025315|Ga0207697_10028833|Ga0207697_100288332
Length 434
Sequence MALILGSDRLLASKRLDGRRVGVVCNPASVDAGLRHIADRLAALPNTRLAAIFGPQHGFRSDVQDNMIETAHGHDEVRRVPVYSLYSETREPTPDMLRDLDVLVIDLQDVGVRIYTYIYTMANCLKAARKQGLEVIVCDRPNPIGGVDVEGMVLEPGFESFVGMYPIPMRHGMTIGEIARLFNEEFGIGAKLDVVQMEGWQREMYFDETGLTWIISSPNIPTFDTTTVYPGAVLFEGTNVSEGRGTTRPFELLGAPWVIAETFAEGMNRRELPGVFFRPALFEPTFHKHAGKGCAGCQVHVLDRRTFQAVEAGVALIEAFRAADPDGVRWKDPPYEYEFDKMPIDCLAGSSQLREQIDAGMEFGRTVAGRAVAKNRRGEMKQDEFIWKALREKIKRGRRRERRDHHDFELCVVSLGAALGGLCFFNGDLCEDRS

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
132 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
133 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
134 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
144 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
154 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
155 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
156 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.19
Nodule 0
Rhizoplane 2.39
Rhizosphere 95.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10105614 3300005293 Bacteria 2881
2 Ga0065715_10111154 3300005293 Bacteria 2586
3 Ga0065707_10000940 3300005295 Bacteria 19288
4 Ga0065707_10102905 3300005295 Bacteria 2778
5 Ga0065707_10139908 3300005295 Unclassified 1787
6 Ga0070676_10023318 3300005328 Bacteria 3478
7 Ga0070676_10061447 3300005328 Bacteria 2233
8 Ga0070676_10116194 3300005328 Bacteria 1673
9 Ga0070690_100208304 3300005330 Bacteria 1364
10 Ga0070670_100010119 3300005331 Bacteria 8047
11 Ga0070670_100066555 3300005331 Bacteria 3092
12 Ga0070670_100132935 3300005331 Bacteria 2149
13 Ga0070670_100252422 3300005331 Bacteria 1537
14 Ga0070677_10001586 3300005333 Bacteria 7188
15 Ga0070677_10048460 3300005333 Bacteria 1707
16 Ga0070666_10008495 3300005335 Bacteria 6379
17 Ga0070666_10064521 3300005335 Unclassified 2484
18 Ga0070689_100107827 3300005340 Bacteria 2212
19 Ga0070689_100177702 3300005340 Bacteria 1727
20 Ga0070691_10012290 3300005341 Bacteria 3919
21 Ga0070692_10065194 3300005345 Bacteria 1928
22 Ga0070692_10072408 3300005345 Bacteria 1839
23 Ga0070668_100005585 3300005347 Bacteria 9329
24 Ga0070668_100109579 3300005347 Bacteria 2197
25 Ga0070669_100007749 3300005353 Bacteria 7677
26 Ga0070669_100011782 3300005353 Bacteria 6203
27 Ga0070669_100040904 3300005353 Bacteria 3370
28 Ga0070669_100041108 3300005353 Bacteria 3362
29 Ga0070669_100065108 3300005353 Bacteria 2685
30 Ga0070675_100011700 3300005354 Bacteria 6878
31 Ga0070675_100046981 3300005354 Bacteria 3537
32 Ga0070675_100060240 3300005354 Unclassified 3134
33 Ga0070675_100106181 3300005354 Bacteria 2370
34 Ga0070675_100266695 3300005354 Bacteria 1502
35 Ga0070675_100277916 3300005354 Bacteria 1471
36 Ga0070674_100000794 3300005356 Bacteria 16226
37 Ga0070674_100044638 3300005356 Bacteria 3023
38 Ga0070674_100145669 3300005356 Bacteria 1782
39 Ga0070673_100118261 3300005364 Bacteria 2206
40 Ga0070673_100176434 3300005364 Bacteria 1827
41 Ga0070673_100244586 3300005364 Bacteria 1561
42 Ga0070688_100077711 3300005365 Bacteria 2139
43 Ga0070659_100075393 3300005366 Bacteria 2688
44 Ga0070659_100222208 3300005366 Bacteria 1559
45 Ga0070709_10003094 3300005434 Bacteria 8939
46 Ga0070713_100009479 3300005436 Bacteria 6975
47 Ga0070710_10202509 3300005437 Bacteria 1254
48 Ga0070701_10072207 3300005438 Bacteria 1848
49 Ga0070701_10084218 3300005438 Bacteria 1729
50 Ga0070701_10084553 3300005438 Bacteria 1726
51 Ga0070705_100008580 3300005440 Bacteria 5063
52 Ga0070705_100024343 3300005440 Bacteria 3266
53 Ga0070700_100015456 3300005441 Bacteria 4328
54 Ga0070700_100042898 3300005441 Bacteria 2780
55 Ga0070700_100079812 3300005441 Bacteria 2110
56 Ga0070694_100007521 3300005444 Bacteria 6648
57 Ga0070694_100041096 3300005444 Bacteria 3083
58 Ga0070678_100062209 3300005456 Bacteria 2755
59 Ga0070678_100273346 3300005456 Bacteria 1426
60 Ga0070662_100035122 3300005457 Bacteria 3538
61 Ga0070662_100124349 3300005457 Bacteria 1980
62 Ga0070662_100265603 3300005457 Bacteria 1384
63 Ga0070681_10045654 3300005458 Bacteria 4383
64 Ga0068867_100102005 3300005459 Bacteria 2193
65 Ga0068867_100106501 3300005459 Bacteria 2148
66 Ga0068867_100107910 3300005459 Bacteria 2134
67 Ga0068867_100121223 3300005459 Bacteria 2021
68 Ga0070685_10055057 3300005466 Bacteria 2310
69 Ga0070698_100078161 3300005471 Bacteria 3307
70 Ga0070698_100227465 3300005471 Bacteria 1799
71 Ga0070698_100245804 3300005471 Bacteria 1722
72 Ga0070699_100002083 3300005518 Bacteria 18104
73 Ga0070699_100009224 3300005518 Bacteria 8552
74 Ga0070672_100002470 3300005543 Bacteria 11746
75 Ga0070672_100054878 3300005543 Bacteria 3120
76 Ga0070672_100126723 3300005543 Bacteria 2095
77 Ga0070672_100142238 3300005543 Bacteria 1979
78 Ga0070672_100157579 3300005543 Bacteria 1881
79 Ga0070686_100000485 3300005544 Bacteria 24083
80 Ga0070695_100005004 3300005545 Bacteria 7813
81 Ga0070695_100009117 3300005545 Bacteria 5897
82 Ga0070695_100120935 3300005545 Unclassified 1791
83 Ga0070696_100001063 3300005546 Bacteria 17763
84 Ga0070696_100003538 3300005546 Bacteria 10398
85 Ga0070704_100003499 3300005549 Bacteria 9014
86 Ga0070704_100005169 3300005549 Bacteria 7588
87 Ga0070704_100186946 3300005549 Bacteria 1662
88 Ga0070664_100025325 3300005564 Bacteria 4917
89 Ga0070664_100032556 3300005564 Bacteria 4362
90 Ga0068857_100027496 3300005577 Bacteria 5017
91 Ga0070702_100018066 3300005615 Bacteria 3651
92 Ga0068852_100179750 3300005616 Bacteria 1989
93 Ga0068859_100155569 3300005617 Bacteria 2363
94 Ga0068864_100032067 3300005618 Bacteria 4462
95 Ga0068864_100130547 3300005618 Bacteria 2256
96 Ga0068864_100374182 3300005618 Bacteria 1349
97 Ga0068866_10053865 3300005718 Bacteria 2059
98 Ga0068861_100011238 3300005719 Bacteria 6215
99 Ga0068861_100026065 3300005719 Bacteria 4246
100 Ga0068870_10004599 3300005840 Bacteria 5949
101 Ga0068870_10011464 3300005840 Bacteria 4110
102 Ga0068870_10012755 3300005840 Bacteria 3935
103 Ga0068863_100069367 3300005841 Bacteria 3333
104 Ga0068858_100066707 3300005842 Bacteria 3332
105 Ga0068858_100168676 3300005842 Bacteria 2063
106 Ga0068860_100092090 3300005843 Bacteria 2888
107 Ga0068860_100298257 3300005843 Bacteria 1578
108 Ga0068862_100059657 3300005844 Unclassified 3277
109 Ga0068862_100067405 3300005844 Bacteria 3085
110 Ga0068862_100088601 3300005844 Bacteria 2692
111 Ga0068862_100244003 3300005844 Bacteria 1634
112 Ga0075368_10027585 3300006042 Unclassified 2192
113 Ga0075364_10004703 3300006051 Bacteria 7878
114 Ga0070715_10021164 3300006163 Bacteria 2519
115 Ga0075367_10034360 3300006178 Bacteria 2928
116 Ga0075367_10035000 3300006178 Bacteria 2904
117 Ga0075366_10057120 3300006195 Bacteria 2319
118 Ga0097621_100003586 3300006237 Bacteria 10725
119 Ga0097621_100018204 3300006237 Bacteria 5358
120 Ga0097621_100042035 3300006237 Bacteria 3681
121 Ga0097621_100148086 3300006237 Bacteria 2012
122 Ga0075370_10001417 3300006353 Bacteria 10375
123 Ga0068871_100002245 3300006358 Bacteria 13132
124 Ga0068871_100006871 3300006358 Bacteria 8102
125 Ga0068871_100021927 3300006358 Bacteria 4919
126 Ga0068871_100028426 3300006358 Bacteria 4383
127 Ga0075428_100000076 3300006844 Bacteria 81732
128 Ga0075428_100001245 3300006844 Bacteria 27216
129 Ga0075428_100014752 3300006844 Bacteria 8681
130 Ga0075428_100034824 3300006844 Bacteria 5552
131 Ga0075430_100003723 3300006846 Bacteria 12814
132 Ga0075430_100009469 3300006846 Bacteria 8232
133 Ga0075430_100050224 3300006846 Bacteria 3518
134 Ga0075430_100056910 3300006846 Bacteria 3288
135 Ga0075431_100000835 3300006847 Bacteria 26939
136 Ga0075431_100004143 3300006847 Bacteria 14156
137 Ga0075431_100043337 3300006847 Bacteria 4643
138 Ga0075433_10000646 3300006852 Bacteria 23432
139 Ga0075433_10001990 3300006852 Bacteria 15383
140 Ga0075433_10017074 3300006852 Bacteria 6001
141 Ga0075433_10023238 3300006852 Bacteria 5215
142 Ga0075433_10039086 3300006852 Bacteria 4101
143 Ga0075433_10073551 3300006852 Bacteria 3006
144 Ga0075433_10185334 3300006852 Unclassified 1852
145 Ga0075433_10236587 3300006852 Bacteria 1622
146 Ga0075434_100001211 3300006871 Bacteria 21442
147 Ga0075434_100005345 3300006871 Bacteria 11683
148 Ga0075434_100017157 3300006871 Bacteria 6968
149 Ga0075434_100042891 3300006871 Bacteria 4486
150 Ga0075434_100065316 3300006871 Bacteria 3624
151 Ga0075434_100112754 3300006871 Bacteria 2731
152 Ga0075429_100021537 3300006880 Bacteria 5587
153 Ga0075429_100027990 3300006880 Bacteria 4892
154 Ga0068865_100024864 3300006881 Bacteria 3933
155 Ga0068865_100178528 3300006881 Bacteria 1633
156 Ga0075436_100000182 3300006914 Bacteria 39329
157 Ga0075436_100013462 3300006914 Bacteria 5600
158 Ga0075436_100021404 3300006914 Bacteria 4440
159 Ga0075436_100049594 3300006914 Bacteria 2897
160 Ga0097620_100155561 3300006931 Bacteria 2363
161 Ga0097620_100205905 3300006931 Bacteria 2052
162 Ga0075435_100000027 3300007076 Bacteria 84051
163 Ga0075435_100002436 3300007076 Bacteria 12352
164 Ga0075435_100036734 3300007076 Bacteria 3895
165 Ga0075435_100040424 3300007076 Bacteria 3723
166 Ga0075435_100072687 3300007076 Bacteria 2810
167 Ga0075435_100092534 3300007076 Bacteria 2497
168 Ga0075435_100158150 3300007076 Bacteria 1908
169 Ga0075435_100174019 3300007076 Bacteria 1817
170 Ga0105240_10128093 3300009093 Unclassified 3048
171 Ga0111539_10000010 3300009094 Bacteria 366246
172 Ga0111539_10000112 3300009094 Bacteria 89047
173 Ga0111539_10004375 3300009094 Bacteria 18483
174 Ga0111539_10028232 3300009094 Bacteria 6848
175 Ga0111539_10034682 3300009094 Bacteria 6114
176 Ga0111539_10050352 3300009094 Bacteria 4962
177 Ga0111539_10086094 3300009094 Bacteria 3693
178 Ga0111539_10273970 3300009094 Bacteria 1964
179 Ga0111539_10362305 3300009094 Bacteria 1687
180 Ga0105245_10034466 3300009098 Bacteria 4490
181 Ga0105245_10050364 3300009098 Bacteria 3733
182 Ga0114129_10005683 3300009147 Bacteria 17657
183 Ga0114129_10006755 3300009147 Bacteria 16287
184 Ga0114129_10007379 3300009147 Bacteria 15653
185 Ga0114129_10011275 3300009147 Bacteria 12740
186 Ga0114129_10016432 3300009147 Bacteria 10532
187 Ga0114129_10057692 3300009147 Bacteria 5431
188 Ga0114129_10073957 3300009147 Bacteria 4747
189 Ga0114129_10130592 3300009147 Bacteria 3450
190 Ga0114129_10143125 3300009147 Bacteria 3276
191 Ga0114129_10183047 3300009147 Bacteria 2849
192 Ga0114129_10251250 3300009147 Bacteria 2373
193 Ga0114129_10257736 3300009147 Bacteria 2339
194 Ga0114129_10641564 3300009147 Bacteria 1372
195 Ga0105243_10041101 3300009148 Bacteria 3616
196 Ga0105243_10052628 3300009148 Bacteria 3226
197 Ga0105243_10098001 3300009148 Bacteria 2428
198 Ga0105243_10147048 3300009148 Bacteria 2017
199 Ga0105241_10082917 3300009174 Bacteria 2514
200 Ga0105242_10256404 3300009176 Bacteria 1578
201 Ga0105248_10004554 3300009177 Bacteria 15343
202 Ga0105248_10101870 3300009177 Bacteria 3236
203 Ga0105248_10229086 3300009177 Bacteria 2092
204 Ga0105249_10000263 3300009553 Bacteria 56064
205 Ga0105249_10007708 3300009553 Bacteria 9380
206 Ga0105249_10024991 3300009553 Bacteria 5375
207 Ga0105249_10064325 3300009553 Bacteria 3372
208 Ga0105246_10144730 3300011119 Bacteria 1792
209 Ga0105246_10274343 3300011119 Unclassified 1350
210 Ga0157374_10069207 3300013296 Bacteria 3323
211 Ga0163162_10050128 3300013306 Bacteria 4187
212 Ga0163162_10056073 3300013306 Bacteria 3969
213 Ga0163162_10150303 3300013306 Bacteria 2446
214 Ga0157375_10085134 3300013308 Bacteria 3211
215 Ga0157375_10223032 3300013308 Bacteria 2044
216 Ga0157375_10230982 3300013308 Bacteria 2009
217 Ga0157375_10245319 3300013308 Bacteria 1951
218 Ga0163163_10180598 3300014325 Bacteria 2157
219 Ga0163163_10200620 3300014325 Bacteria 2043
220 Ga0157380_10007713 3300014326 Bacteria 7657
221 Ga0157380_10021759 3300014326 Bacteria 4816
222 Ga0157380_10036205 3300014326 Bacteria 3817
223 Ga0157380_10047815 3300014326 Bacteria 3366
224 Ga0157380_10066103 3300014326 Bacteria 2908
225 Ga0157380_10204354 3300014326 Bacteria 1755
226 Ga0157377_10021616 3300014745 Bacteria 3386
227 Ga0157379_10008023 3300014968 Bacteria 9163
228 Ga0157379_10104399 3300014968 Bacteria 2543
229 Ga0157376_10016826 3300014969 Bacteria 5562
230 Ga0157376_10069214 3300014969 Bacteria 2991
231 Ga0163161_10009615 3300017792 Bacteria 6687
232 Ga0163161_10201801 3300017792 Bacteria 1533
233 Ga0207697_10028833 3300025315 Bacteria 2270
234 Ga0207682_10001143 3300025893 Bacteria 12289
235 Ga0207682_10012439 3300025893 Bacteria 3322
236 Ga0207692_10129576 3300025898 Bacteria 1423
237 Ga0207642_10020074 3300025899 Bacteria 2601
238 Ga0207688_10043861 3300025901 Bacteria 2492
239 Ga0207645_10004842 3300025907 Bacteria 9885
240 Ga0207645_10083002 3300025907 Bacteria 2054
241 Ga0207645_10106119 3300025907 Unclassified 1816
242 Ga0207645_10120237 3300025907 Bacteria 1705
243 Ga0207643_10003970 3300025908 Bacteria 7964
244 Ga0207654_10071024 3300025911 Bacteria 2068
245 Ga0207693_10010342 3300025915 Bacteria 7575
246 Ga0207660_10249079 3300025917 Bacteria 1402
247 Ga0207662_10045891 3300025918 Bacteria 2584
248 Ga0207662_10046336 3300025918 Unclassified 2572
249 Ga0207646_10070677 3300025922 Bacteria 3118
250 Ga0207646_10084772 3300025922 Bacteria 2835
251 Ga0207681_10006186 3300025923 Bacteria 7344
252 Ga0207681_10024874 3300025923 Bacteria 3846
253 Ga0207681_10069859 3300025923 Bacteria 2444
254 Ga0207681_10071741 3300025923 Bacteria 2416
255 Ga0207681_10144452 3300025923 Bacteria 1776
256 Ga0207650_10033641 3300025925 Bacteria 3714
257 Ga0207650_10232484 3300025925 Unclassified 1487
258 Ga0207659_10018297 3300025926 Bacteria 4591
259 Ga0207659_10091910 3300025926 Bacteria 2268
260 Ga0207659_10313296 3300025926 Bacteria 1293
261 Ga0207687_10020572 3300025927 Bacteria 4379
262 Ga0207706_10069532 3300025933 Bacteria 3097
263 Ga0207706_10098423 3300025933 Bacteria 2573
264 Ga0207706_10106809 3300025933 Bacteria 2463
265 Ga0207706_10127129 3300025933 Bacteria 2241
266 Ga0207706_10222920 3300025933 Bacteria 1651
267 Ga0207686_10017943 3300025934 Bacteria 3998
268 Ga0207686_10079066 3300025934 Bacteria 2140
269 Ga0207709_10050540 3300025935 Bacteria 2543
270 Ga0207709_10081117 3300025935 Bacteria 2091
271 Ga0207670_10067878 3300025936 Bacteria 2455
272 Ga0207669_10003660 3300025937 Bacteria 6675
273 Ga0207669_10126010 3300025937 Bacteria 1749
274 Ga0207669_10149025 3300025937 Bacteria 1636
275 Ga0207691_10001989 3300025940 Bacteria 19992
276 Ga0207691_10073977 3300025940 Bacteria 3073
277 Ga0207691_10087487 3300025940 Bacteria 2795
278 Ga0207691_10116592 3300025940 Bacteria 2370
279 Ga0207691_10117069 3300025940 Bacteria 2364
280 Ga0207691_10169471 3300025940 Bacteria 1912
281 Ga0207711_10069075 3300025941 Bacteria 3062
282 Ga0207711_10080416 3300025941 Bacteria 2846
283 Ga0207711_10199811 3300025941 Bacteria 1824
284 Ga0207689_10202023 3300025942 Bacteria 1641
285 Ga0207679_10039206 3300025945 Bacteria 3381
286 Ga0207651_10039603 3300025960 Bacteria 3109
287 Ga0207651_10166578 3300025960 Bacteria 1733
288 Ga0207712_10039928 3300025961 Bacteria 3218
289 Ga0207712_10209542 3300025961 Bacteria 1551
290 Ga0207668_10087022 3300025972 Bacteria 2284
291 Ga0207640_10095994 3300025981 Bacteria 2066
292 Ga0207640_10129773 3300025981 Unclassified 1820
293 Ga0207658_10009779 3300025986 Bacteria 6512
294 Ga0207703_10167518 3300026035 Bacteria 1929
295 Ga0207678_10176437 3300026067 Bacteria 1824
296 Ga0207708_10024277 3300026075 Bacteria 4585
297 Ga0207641_10012265 3300026088 Bacteria 7031
298 Ga0207641_10027269 3300026088 Bacteria 4718
299 Ga0207648_10050298 3300026089 Bacteria 3645
300 Ga0207648_10083861 3300026089 Bacteria 2779
301 Ga0207648_10121130 3300026089 Bacteria 2300
302 Ga0207648_10129061 3300026089 Bacteria 2225
303 Ga0207676_10262061 3300026095 Bacteria 1561
304 Ga0207674_10114349 3300026116 Bacteria 2671
305 Ga0207675_100006507 3300026118 Bacteria 11054
306 Ga0207675_100016861 3300026118 Bacteria 6823
307 Ga0207675_100061744 3300026118 Bacteria 3498
308 Ga0207683_10015791 3300026121 Bacteria 6427
309 Ga0207683_10148321 3300026121 Bacteria 2116
310 Ga0207698_10109295 3300026142 Bacteria 2313
311 Ga0209974_10024511 3300027876 Bacteria 1997
312 Ga0207428_10000097 3300027907 Bacteria 122738
313 Ga0207428_10000875 3300027907 Bacteria 33839
314 Ga0207428_10005438 3300027907 Bacteria 11878
315 Ga0207428_10009561 3300027907 Bacteria 8685
316 Ga0207428_10034419 3300027907 Bacteria 4151
317 Ga0207428_10063333 3300027907 Bacteria 2922
318 Ga0207428_10069258 3300027907 Bacteria 2774
319 Ga0207428_10095509 3300027907 Bacteria 2303
320 Ga0268265_10001821 3300028380 Bacteria 17037
321 Ga0268265_10012315 3300028380 Bacteria 5795
322 Ga0268265_10233825 3300028380 Bacteria 1617
323 Ga0268265_10251413 3300028380 Bacteria 1566
324 Ga0307408_100009085 3300031548 Bacteria 6558
325 Ga0316575_10015729 3300031665 Bacteria 2854
326 Ga0316579_10001252 3300031691 Bacteria 9129
327 Ga0316579_10051681 3300031691 Bacteria 1924
328 Ga0316576_10033347 3300031727 Bacteria 3665
329 Ga0316578_10032189 3300031728 Bacteria 2993
330 Ga0307413_10010037 3300031824 Bacteria 4566
331 Ga0307413_10026806 3300031824 Bacteria 3182
332 Ga0307410_10007724 3300031852 Bacteria 5905
333 Ga0307410_10011659 3300031852 Bacteria 5039
334 Ga0307410_10044084 3300031852 Bacteria 2960
335 Ga0307406_10006604 3300031901 Bacteria 6411
336 Ga0307406_10108867 3300031901 Bacteria 1903
337 Ga0307407_10002792 3300031903 Bacteria 6963
338 Ga0307407_10009270 3300031903 Bacteria 4574
339 Ga0307412_10018539 3300031911 Bacteria 4191
340 Ga0307416_100025849 3300032002 Bacteria 4314
341 Ga0307416_100210795 3300032002 Bacteria 1853
342 Ga0307411_10000942 3300032005 Bacteria 11112
343 Ga0307411_10015235 3300032005 Bacteria 4312
344 Ga0307411_10105554 3300032005 Bacteria 2003
345 Ga0307415_100010716 3300032126 Bacteria 5206
346 Ga0316583_10021189 3300032133 Bacteria 2330
347 Ga0316585_10001762 3300032137 Bacteria 5771
348 Ga0373939_0020376 3300035114 Bacteria 1801
349 Ga0373941_0023541 3300035115 Bacteria 1759
350 Ga0373945_0067816 3300035116 Bacteria 1344
351 Ga0373943_0020373 3300035170 Bacteria 3056
352 Ga0373924_0053418 3300035410 Bacteria 1678
353 Ga0373935_0018073 3300035692 Bacteria 4286
354 Ga0373947_0004675 3300035725 Bacteria 8024
355 Ga0373947_0053799 3300035725 Bacteria 2428
356 Ga0373937_0130147 3300036401 Unclassified 2350
357 Ga0316582_0036333 3300036647 Bacteria 3048
358 Ga0316584_0003893 3300036712 Bacteria 9798
359 Ga0316581_0008357 3300037588 Bacteria 2814
360 Ga0439446_0000937 3300042156 Bacteria 6300
361 Ga0439460_0006001 3300042461 Bacteria 2997
362 Ga0451577_0003216 3300042876 Bacteria 18350
363 Ga0451576_0069300 3300045051 Bacteria 3670
364 Ga0495603_0004665 3300046455 Bacteria 8192
365 Ga0495603_0069935 3300046455 Bacteria 2064
366 Ga0495629_0015733 3300046459 Bacteria 5431
367 Ga0495629_0175090 3300046459 Bacteria 1488
368 Ga0495582_0121583 3300046473 Bacteria 1471
369 Ga0495594_0017750 3300046499 Bacteria 3763
370 Ga0495594_0038523 3300046499 Bacteria 2611
371 Ga0495608_0018395 3300046511 Bacteria 4820
372 Ga0495628_0025274 3300046516 Bacteria 4852
373 Ga0495586_0123034 3300046535 Bacteria 1450
374 Ga0495621_0019729 3300046539 Bacteria 2204
375 Ga0495645_0011900 3300046543 Bacteria 6129
376 Ga0495667_0037720 3300046559 Bacteria 3220
377 Ga0495634_0079702 3300046642 Bacteria 2144
378 Ga0495659_0008259 3300046664 Bacteria 3312
379 Ga0495588_0001065 3300046674 Bacteria 11902
380 Ga0495599_0157454 3300046678 Bacteria 1405
381 Ga0495669_0046036 3300046684 Bacteria 1946
382 Ga0495613_0000507 3300046689 Bacteria 32852
383 Ga0495670_0016529 3300046691 Bacteria 3628
384 Ga0495676_0088119 3300047321 Bacteria 2329
385 Ga0495684_0000188 3300047471 Bacteria 47553
386 Ga0496101_0002514 3300048904 Bacteria 11257
387 Ga0496101_0042185 3300048904 Bacteria 3257
388 Ga0496102_0148613 3300048905 Bacteria 2200
389 Ga0496104_0050545 3300048907 Bacteria 3922
390 Ga0496105_0010592 3300048908 Bacteria 7254
391 Ga0496106_0005072 3300048909 Bacteria 9752
392 Ga0496107_0017189 3300048910 Bacteria 5088
393 Ga0496114_0000462 3300048917 Bacteria 29857
394 Ga0496114_0084051 3300048917 Bacteria 2694
395 Ga0496114_0089212 3300048917 Bacteria 2616
396 Ga0496114_0097564 3300048917 Bacteria 2504
397 Ga0496115_0012918 3300048918 Bacteria 6297
398 Ga0501036_0054268 3300049572 Bacteria 3394
399 Ga0501038_0212472 3300049574 Bacteria 1547
400 Ga0501040_0045262 3300049576 Bacteria 3001
401 Ga0501040_0112156 3300049576 Bacteria 1907
402 Ga0501041_0017174 3300049577 Bacteria 4305
403 Ga0501041_0078355 3300049577 Bacteria 2034
404 Ga0501042_0002543 3300049578 Bacteria 11218
405 Ga0501042_0048289 3300049578 Bacteria 3035
406 Ga0501046_0026443 3300049580 Bacteria 4740
407 Ga0501046_0143884 3300049580 Bacteria 1802
408 Ga0501048_0230475 3300049582 Bacteria 1314
409 Ga0501067_0046085 3300049583 Bacteria 2420
410 Ga0501071_0026618 3300049587 Bacteria 4061
411 Ga0501071_0122504 3300049587 Bacteria 1928
412 Ga0501072_0066879 3300049588 Bacteria 2835
413 Ga0501072_0143775 3300049588 Bacteria 1902
414 Ga0501073_0025396 3300049589 Bacteria 4249
415 Ga0501074_0061366 3300049590 Bacteria 2708
416 Ga0501075_0010573 3300049591 Bacteria 6489
417 Ga0501075_0034715 3300049591 Bacteria 3757
418 Ga0501075_0136469 3300049591 Bacteria 1869
419 Ga0501076_0002161 3300049592 Bacteria 13479
420 Ga0501076_0034974 3300049592 Bacteria 3930
421 Ga0501076_0115916 3300049592 Bacteria 2168
422 Ga0501077_0006581 3300049593 Bacteria 7133
423 Ga0501079_0051504 3300049741 Bacteria 3179
424 Ga0501080_0075815 3300049742 Bacteria 3128
425 Ga0501080_0370561 3300049742 Bacteria 1291
426 Ga0501081_0006435 3300049743 Bacteria 7621
427 Ga0501081_0111798 3300049743 Bacteria 1939
428 Ga0501083_0112654 3300049744 Bacteria 1788
429 Ga0501045_0121347 3300049824 Bacteria 1941
430 nmdc:mga03n38_65086_c1 3300050490 Unclassified 1670
431 nmdc:mga00v17_8834_c1 3300050491 Bacteria 5432
432 nmdc:mga0k408_2937_c1 3300050493 Bacteria 9036
433 nmdc:mga06z11_32207_c1 3300050494 Bacteria 2555
434 nmdc:mga07m45_2323_c1 3300050496 Bacteria 8910
435 nmdc:mga05p37_114738_c1 3300050507 Bacteria 3311
436 nmdc:mga05p37_11640_c1 3300050507 Bacteria 10484
437 nmdc:mga05p37_120454_c1 3300050507 Bacteria 3224
438 nmdc:mga05p37_15951_c1 3300050507 Bacteria 9036
439 nmdc:mga05p37_207459_c1 3300050507 Bacteria 2370
440 nmdc:mga05p37_22582_c1 3300050507 Bacteria 7629
441 nmdc:mga05p37_25835_c1 3300050507 Bacteria 7140
442 nmdc:mga05p37_259924_c1 3300050507 Bacteria 2078
443 nmdc:mga05p37_32632_c1 3300050507 Bacteria 6369
444 nmdc:mga05p37_48133_c1 3300050507 Bacteria 5244
445 nmdc:mga05p37_645557_c1 3300050507 Bacteria 1186
446 nmdc:mga05p37_66443_c1 3300050507 Bacteria 4436
447 nmdc:mga05p37_69460_c1 3300050507 Bacteria 4333
448 nmdc:mga09592_2024_c1 3300050508 Bacteria 16348
449 nmdc:mga09592_260606_c1 3300050508 Unclassified 1503
450 nmdc:mga09592_37096_c1 3300050508 Bacteria 4087
451 nmdc:mga09592_52269_c1 3300050508 Bacteria 3449
452 nmdc:mga0qj67_45220_c1 3300050509 Bacteria 3474
453 nmdc:mga0qj67_7074_c1 3300050509 Bacteria 8276
454 nmdc:mga0qj67_7534_c1 3300050509 Bacteria 8042
455 nmdc:mga06r32_136646_c1 3300050510 Bacteria 2426
456 nmdc:mga06r32_137323_c1 3300050510 Bacteria 2420
457 nmdc:mga06r32_200620_c1 3300050510 Bacteria 1983
458 nmdc:mga06r32_346427_c1 3300050510 Bacteria 1470
459 nmdc:mga06r32_35683_c1 3300050510 Bacteria 4692
460 nmdc:mga06r32_44524_c1 3300050510 Bacteria 4226
461 nmdc:mga06r32_75208_c1 3300050510 Bacteria 3277
462 nmdc:mga06r32_787_c1 3300050510 Bacteria 28062
463 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
464 nmdc:mga08y16_17955_c1 3300050511 Bacteria 7453
465 nmdc:mga08y16_1884_c1 3300050511 Bacteria 21345
466 nmdc:mga08y16_43599_c1 3300050511 Bacteria 4702
467 nmdc:mga08y16_49148_c1 3300050511 Bacteria 4414
468 nmdc:mga0n895_169382_c1 3300050512 Bacteria 2216
469 nmdc:mga0n895_190_c1 3300050512 Bacteria 38063
470 nmdc:mga0n895_3737_c1 3300050512 Bacteria 12317
471 nmdc:mga0n895_380855_c1 3300050512 Bacteria 1428
472 nmdc:mga0n895_3_c1 3300050512 Bacteria 134167
473 nmdc:mga0n895_425275_c1 3300050512 Bacteria 1342
474 nmdc:mga0n895_71956_c1 3300050512 Bacteria 3429
475 nmdc:mga0n895_99494_c1 3300050512 Bacteria 2916
476 nmdc:mga0rr50_31708_c1 3300050513 Bacteria 3758
477 nmdc:mga0rr50_32041_c1 3300050513 Bacteria 3740
478 nmdc:mga0rr50_39_c1 3300050513 Bacteria 84395
479 nmdc:mga0rr50_86276_c1 3300050513 Bacteria 2435
480 nmdc:mga0rr50_98986_c1 3300050513 Bacteria 2287
481 nmdc:mga08x19_24715_c1 3300050514 Bacteria 3738
482 nmdc:mga08x19_259_c1 3300050514 Bacteria 40273
483 nmdc:mga08x19_40067_c1 3300050514 Bacteria 2981
484 nmdc:mga0a205_12241_c1 3300050515 Bacteria 7933
485 nmdc:mga0a205_123666_c1 3300050515 Unclassified 2487
486 nmdc:mga0a205_574_c1 3300050515 Bacteria 29140
487 nmdc:mga0a205_7422_c1 3300050515 Bacteria 9929
488 nmdc:mga0a205_92539_c1 3300050515 Bacteria 2922
489 Ga0495595_0025603 3300053084 Bacteria 2616
490 Ga0495595_0026664 3300053084 Bacteria 2569
491 Ga0495595_0073131 3300053084 Unclassified 1623
492 Ga0495619_0026975 3300053085 Bacteria 3699
493 Ga0501084_0012978 3300054114 Bacteria 6896
494 Ga0501084_0262648 3300054114 Bacteria 1458
495 Ga0590071_002764 3300059421 Bacteria 4398
496 Ga0590074_007339 3300059423 Bacteria 1832
497 Ga0590075_000589 3300059424 Bacteria 9783
498 Ga0590077_000230 3300059426 Bacteria 16099
499 Ga0590077_000651 3300059426 Bacteria 9255
500 Ga0590077_004444 3300059426 Bacteria 2880
501 Ga0501082_0006041 3300060353 Bacteria 10506
502 Ga0501082_0035115 3300060353 Bacteria 4321
503 Ga0530510_0044874 3300061734 Bacteria 3195

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0015733 Ga0495629_0015733_23_1048 329
2 3300025923 Ga0207681_10024874 Ga0207681_100248742 353
3 3300035116 Ga0373945_0067816 Ga0373945_0067816_35_1132 353
4 3300005471 Ga0070698_100245804 Ga0070698_1002458042 360
5 3300049582 Ga0501048_0230475 Ga0501048_0230475_122_1240 360
6 3300006178 Ga0075367_10035000 Ga0075367_100350002 365
7 3300005618 Ga0068864_100374182 Ga0068864_1003741822 367
8 3300026089 Ga0207648_10129061 Ga0207648_101290612 367
9 3300046678 Ga0495599_0157454 Ga0495599_0157454_49_1152 367
10 3300059426 Ga0590077_000651 Ga0590077_000651_412_1554 367
11 3300009147 Ga0114129_10073957 Ga0114129_100739572 368
12 3300050507 nmdc:mga05p37_11640_c1 nmdc:mga05p37_11640_c1_5487_6644 368
13 3300050512 nmdc:mga0n895_71956_c1 nmdc:mga0n895_71956_c1_1919_3076 368
14 3300009147 Ga0114129_10143125 Ga0114129_101431252 369
15 3300006914 Ga0075436_100049594 Ga0075436_1000495942 372
16 3300050507 nmdc:mga05p37_48133_c1 nmdc:mga05p37_48133_c1_1882_3003 372
17 3300005331 Ga0070670_100010119 Ga0070670_1000101198 373
18 3300005356 Ga0070674_100145669 Ga0070674_1001456692 373
19 3300005456 Ga0070678_100062209 Ga0070678_1000622093 373
20 3300005457 Ga0070662_100265603 Ga0070662_1002656032 373
21 3300005616 Ga0068852_100179750 Ga0068852_1001797502 373
22 3300005841 Ga0068863_100069367 Ga0068863_1000693672 373
23 3300006237 Ga0097621_100018204 Ga0097621_1000182045 373
24 3300006358 Ga0068871_100021927 Ga0068871_1000219274 373
25 3300006881 Ga0068865_100178528 Ga0068865_1001785282 373
26 3300009098 Ga0105245_10050364 Ga0105245_100503643 373
27 3300009174 Ga0105241_10082917 Ga0105241_100829172 373
28 3300009177 Ga0105248_10229086 Ga0105248_102290862 373
29 3300013296 Ga0157374_10069207 Ga0157374_100692073 373
30 3300013308 Ga0157375_10085134 Ga0157375_100851343 373
31 3300014325 Ga0163163_10200620 Ga0163163_102006202 373
32 3300025911 Ga0207654_10071024 Ga0207654_100710242 373
33 3300025915 Ga0207693_10010342 Ga0207693_100103423 373
34 3300025926 Ga0207659_10313296 Ga0207659_103132962 373
35 3300025933 Ga0207706_10098423 Ga0207706_100984232 373
36 3300025934 Ga0207686_10079066 Ga0207686_100790661 373
37 3300025941 Ga0207711_10199811 Ga0207711_101998112 373
38 3300026142 Ga0207698_10109295 Ga0207698_101092951 373
39 3300048908 Ga0496105_0010592 Ga0496105_0010592_5500_6657 373
40 3300048917 Ga0496114_0084051 Ga0496114_0084051_760_1917 373
41 3300048917 Ga0496114_0089212 Ga0496114_0089212_102_1259 373
42 3300048918 Ga0496115_0012918 Ga0496115_0012918_4798_5955 373
43 3300049572 Ga0501036_0054268 Ga0501036_0054268_1220_2395 373
44 3300049580 Ga0501046_0143884 Ga0501046_0143884_182_1408 373
45 3300049591 Ga0501075_0136469 Ga0501075_0136469_86_1306 373
46 3300049824 Ga0501045_0121347 Ga0501045_0121347_477_1703 373
47 3300060353 Ga0501082_0006041 Ga0501082_0006041_1057_2232 373
48 3300005295 Ga0065707_10102905 Ga0065707_101029052 374
49 3300005331 Ga0070670_100252422 Ga0070670_1002524221 374
50 3300005353 Ga0070669_100065108 Ga0070669_1000651085 374
51 3300005354 Ga0070675_100046981 Ga0070675_1000469811 374
52 3300005366 Ga0070659_100222208 Ga0070659_1002222081 374
53 3300005458 Ga0070681_10045654 Ga0070681_100456544 374
54 3300005518 Ga0070699_100002083 Ga0070699_10000208315 374
55 3300005543 Ga0070672_100157579 Ga0070672_1001575793 374
56 3300006042 Ga0075368_10027585 Ga0075368_100275852 374
57 3300006051 Ga0075364_10004703 Ga0075364_100047038 374
58 3300006178 Ga0075367_10034360 Ga0075367_100343603 374
59 3300006195 Ga0075366_10057120 Ga0075366_100571203 374
60 3300006353 Ga0075370_10001417 Ga0075370_100014173 374
61 3300006844 Ga0075428_100034824 Ga0075428_1000348243 374
62 3300006846 Ga0075430_100003723 Ga0075430_1000037233 374
63 3300006847 Ga0075431_100004143 Ga0075431_1000041438 374
64 3300006852 Ga0075433_10039086 Ga0075433_100390864 374
65 3300006914 Ga0075436_100013462 Ga0075436_1000134624 374
66 3300007076 Ga0075435_100174019 Ga0075435_1001740192 374
67 3300009147 Ga0114129_10006755 Ga0114129_100067557 374
68 3300011119 Ga0105246_10274343 Ga0105246_102743431 374
69 3300025940 Ga0207691_10116592 Ga0207691_101165924 374
70 3300026067 Ga0207678_10176437 Ga0207678_101764372 374
71 3300031548 Ga0307408_100009085 Ga0307408_1000090854 374
72 3300031824 Ga0307413_10010037 Ga0307413_100100373 374
73 3300031824 Ga0307413_10026806 Ga0307413_100268064 374
74 3300031852 Ga0307410_10007724 Ga0307410_100077244 374
75 3300031852 Ga0307410_10011659 Ga0307410_100116595 374
76 3300031852 Ga0307410_10044084 Ga0307410_100440842 374
77 3300031901 Ga0307406_10006604 Ga0307406_100066046 374
78 3300031901 Ga0307406_10108867 Ga0307406_101088673 374
79 3300031903 Ga0307407_10002792 Ga0307407_100027925 374
80 3300031903 Ga0307407_10009270 Ga0307407_100092702 374
81 3300031911 Ga0307412_10018539 Ga0307412_100185393 374
82 3300032002 Ga0307416_100025849 Ga0307416_1000258492 374
83 3300032002 Ga0307416_100210795 Ga0307416_1002107952 374
84 3300032005 Ga0307411_10000942 Ga0307411_100009429 374
85 3300032005 Ga0307411_10015235 Ga0307411_100152354 374
86 3300032005 Ga0307411_10105554 Ga0307411_101055541 374
87 3300032126 Ga0307415_100010716 Ga0307415_1000107164 374
88 3300035114 Ga0373939_0020376 Ga0373939_0020376_345_1508 374
89 3300035725 Ga0373947_0004675 Ga0373947_0004675_2532_3704 374
90 3300046455 Ga0495603_0004665 Ga0495603_0004665_550_1719 374
91 3300046499 Ga0495594_0038523 Ga0495594_0038523_213_1382 374
92 3300047321 Ga0495676_0088119 Ga0495676_0088119_662_1831 374
93 3300049576 Ga0501040_0045262 Ga0501040_0045262_1164_2372 374
94 3300049587 Ga0501071_0122504 Ga0501071_0122504_683_1891 374
95 3300049588 Ga0501072_0143775 Ga0501072_0143775_268_1476 374
96 3300049590 Ga0501074_0061366 Ga0501074_0061366_1318_2526 374
97 3300049593 Ga0501077_0006581 Ga0501077_0006581_5222_6430 374
98 3300049741 Ga0501079_0051504 Ga0501079_0051504_101_1309 374
99 3300049742 Ga0501080_0075815 Ga0501080_0075815_74_1282 374
100 3300049743 Ga0501081_0111798 Ga0501081_0111798_11_1219 374
101 3300049744 Ga0501083_0112654 Ga0501083_0112654_343_1551 374
102 3300050490 nmdc:mga03n38_65086_c1 nmdc:mga03n38_65086_c1_264_1439 374
103 3300050491 nmdc:mga00v17_8834_c1 nmdc:mga00v17_8834_c1_215_1390 374
104 3300050493 nmdc:mga0k408_2937_c1 nmdc:mga0k408_2937_c1_3960_5132 374
105 3300050494 nmdc:mga06z11_32207_c1 nmdc:mga06z11_32207_c1_952_2127 374
106 3300050496 nmdc:mga07m45_2323_c1 nmdc:mga07m45_2323_c1_3856_5031 374
107 3300050507 nmdc:mga05p37_66443_c1 nmdc:mga05p37_66443_c1_2680_3879 374
108 3300050509 nmdc:mga0qj67_45220_c1 nmdc:mga0qj67_45220_c1_2087_3286 374
109 3300050510 nmdc:mga06r32_200620_c1 nmdc:mga06r32_200620_c1_656_1855 374
110 3300050514 nmdc:mga08x19_24715_c1 nmdc:mga08x19_24715_c1_1509_2684 374
111 3300050514 nmdc:mga08x19_40067_c1 nmdc:mga08x19_40067_c1_420_1580 374
112 3300050515 nmdc:mga0a205_123666_c1 nmdc:mga0a205_123666_c1_1081_2277 374
113 3300054114 Ga0501084_0012978 Ga0501084_0012978_1612_2820 374
114 3300059421 Ga0590071_002764 Ga0590071_002764_1317_2555 374
115 3300059423 Ga0590074_007339 Ga0590074_007339_316_1554 374
116 3300059424 Ga0590075_000589 Ga0590075_000589_8184_9380 374
117 3300059426 Ga0590077_000230 Ga0590077_000230_1951_3147 374
118 3300059426 Ga0590077_004444 Ga0590077_004444_1471_2652 374
119 3300061734 Ga0530510_0044874 Ga0530510_0044874_265_1473 374
120 3300009148 Ga0105243_10052628 Ga0105243_100526283 375
121 3300009553 Ga0105249_10007708 Ga0105249_100077088 375
122 3300017792 Ga0163161_10009615 Ga0163161_100096156 375
123 3300025942 Ga0207689_10202023 Ga0207689_102020231 375
124 3300048904 Ga0496101_0042185 Ga0496101_0042185_128_1285 375
125 3300048910 Ga0496107_0017189 Ga0496107_0017189_3181_4338 375
126 3300049583 Ga0501067_0046085 Ga0501067_0046085_1161_2318 375
127 3300005295 Ga0065707_10000940 Ga0065707_1000094010 376
128 3300005354 Ga0070675_100266695 Ga0070675_1002666951 376
129 3300005440 Ga0070705_100024343 Ga0070705_1000243432 376
130 3300005518 Ga0070699_100009224 Ga0070699_1000092244 376
131 3300005546 Ga0070696_100001063 Ga0070696_10000106312 376
132 3300005844 Ga0068862_100088601 Ga0068862_1000886014 376
133 3300014326 Ga0157380_10021759 Ga0157380_100217596 376
134 3300025926 Ga0207659_10091910 Ga0207659_100919103 376
135 3300028380 Ga0268265_10233825 Ga0268265_102338252 376
136 3300031665 Ga0316575_10015729 Ga0316575_100157291 376
137 3300031691 Ga0316579_10001252 Ga0316579_100012523 376
138 3300031691 Ga0316579_10051681 Ga0316579_100516812 376
139 3300031728 Ga0316578_10032189 Ga0316578_100321893 376
140 3300032133 Ga0316583_10021189 Ga0316583_100211893 376
141 3300032137 Ga0316585_10001762 Ga0316585_100017627 376
142 3300036401 Ga0373937_0130147 Ga0373937_0130147_303_1460 376
143 3300036647 Ga0316582_0036333 Ga0316582_0036333_477_1634 376
144 3300036712 Ga0316584_0003893 Ga0316584_0003893_3835_4992 376
145 3300037588 Ga0316581_0008357 Ga0316581_0008357_283_1440 376
146 3300046642 Ga0495634_0079702 Ga0495634_0079702_873_2036 376
147 3300046664 Ga0495659_0008259 Ga0495659_0008259_418_1590 376
148 3300046691 Ga0495670_0016529 Ga0495670_0016529_658_1830 376
149 3300049577 Ga0501041_0078355 Ga0501041_0078355_355_1512 376
150 3300053084 Ga0495595_0025603 Ga0495595_0025603_384_1541 376
151 3300026088 Ga0207641_10027269 Ga0207641_100272693 377
152 3300045051 Ga0451576_0069300 Ga0451576_0069300_387_1559 377
153 3300046455 Ga0495603_0069935 Ga0495603_0069935_579_1751 377
154 3300046473 Ga0495582_0121583 Ga0495582_0121583_140_1312 377
155 3300046499 Ga0495594_0017750 Ga0495594_0017750_2128_3300 377
156 3300046674 Ga0495588_0001065 Ga0495588_0001065_9360_10532 377
157 3300050512 nmdc:mga0n895_99494_c1 nmdc:mga0n895_99494_c1_1264_2400 377
158 3300013306 Ga0163162_10150303 Ga0163162_101503032 378
159 3300005444 Ga0070694_100007521 Ga0070694_1000075214 379
160 3300005545 Ga0070695_100005004 Ga0070695_1000050047 379
161 3300005549 Ga0070704_100003499 Ga0070704_1000034994 379
162 3300006852 Ga0075433_10073551 Ga0075433_100735512 379
163 3300006852 Ga0075433_10185334 Ga0075433_101853341 379
164 3300007076 Ga0075435_100002436 Ga0075435_1000024366 379
165 3300009094 Ga0111539_10273970 Ga0111539_102739702 379
166 3300009147 Ga0114129_10057692 Ga0114129_100576922 379
167 3300025922 Ga0207646_10070677 Ga0207646_100706772 379
168 3300050507 nmdc:mga05p37_207459_c1 nmdc:mga05p37_207459_c1_29_1186 379
169 3300050513 nmdc:mga0rr50_86276_c1 nmdc:mga0rr50_86276_c1_714_1922 379
170 3300050515 nmdc:mga0a205_92539_c1 nmdc:mga0a205_92539_c1_1323_2486 379
171 3300009094 Ga0111539_10086094 Ga0111539_100860941 380
172 3300027907 Ga0207428_10069258 Ga0207428_100692583 380
173 3300050511 nmdc:mga08y16_49148_c1 nmdc:mga08y16_49148_c1_2905_4065 380
174 3300005328 Ga0070676_10023318 Ga0070676_100233182 384
175 3300005341 Ga0070691_10012290 Ga0070691_100122904 384
176 3300005345 Ga0070692_10072408 Ga0070692_100724082 384
177 3300005353 Ga0070669_100041108 Ga0070669_1000411084 384
178 3300005364 Ga0070673_100176434 Ga0070673_1001764341 384
179 3300005438 Ga0070701_10072207 Ga0070701_100722072 384
180 3300005440 Ga0070705_100008580 Ga0070705_1000085804 384
181 3300005441 Ga0070700_100015456 Ga0070700_1000154564 384
182 3300005444 Ga0070694_100041096 Ga0070694_1000410964 384
183 3300005459 Ga0068867_100106501 Ga0068867_1001065013 384
184 3300005545 Ga0070695_100009117 Ga0070695_1000091174 384
185 3300005546 Ga0070696_100003538 Ga0070696_1000035384 384
186 3300005549 Ga0070704_100005169 Ga0070704_1000051691 384
187 3300005615 Ga0070702_100018066 Ga0070702_1000180664 384
188 3300005719 Ga0068861_100026065 Ga0068861_1000260654 384
189 3300025907 Ga0207645_10004842 Ga0207645_100048428 384
190 3300025935 Ga0207709_10050540 Ga0207709_100505402 384
191 3300025960 Ga0207651_10166578 Ga0207651_101665782 384
192 3300026075 Ga0207708_10024277 Ga0207708_100242774 384
193 3300026118 Ga0207675_100006507 Ga0207675_10000650712 384
194 3300031727 Ga0316576_10033347 Ga0316576_100333472 384
195 3300005340 Ga0070689_100107827 Ga0070689_1001078271 385
196 3300005364 Ga0070673_100118261 Ga0070673_1001182611 385
197 3300005543 Ga0070672_100002470 Ga0070672_1000024708 385
198 3300005842 Ga0068858_100168676 Ga0068858_1001686762 385
199 3300005843 Ga0068860_100092090 Ga0068860_1000920902 385
200 3300006237 Ga0097621_100003586 Ga0097621_1000035866 385
201 3300006237 Ga0097621_100148086 Ga0097621_1001480862 385
202 3300006358 Ga0068871_100002245 Ga0068871_1000022456 385
203 3300006846 Ga0075430_100050224 Ga0075430_1000502244 385
204 3300006846 Ga0075430_100056910 Ga0075430_1000569102 385
205 3300006852 Ga0075433_10023238 Ga0075433_100232385 385
206 3300006871 Ga0075434_100065316 Ga0075434_1000653161 385
207 3300006931 Ga0097620_100205905 Ga0097620_1002059051 385
208 3300009094 Ga0111539_10034682 Ga0111539_100346821 385
209 3300009147 Ga0114129_10007379 Ga0114129_100073794 385
210 3300009177 Ga0105248_10004554 Ga0105248_100045542 385
211 3300013308 Ga0157375_10223032 Ga0157375_102230321 385
212 3300014968 Ga0157379_10008023 Ga0157379_100080237 385
213 3300014969 Ga0157376_10069214 Ga0157376_100692142 385
214 3300025923 Ga0207681_10069859 Ga0207681_100698593 385
215 3300025936 Ga0207670_10067878 Ga0207670_100678781 385
216 3300025940 Ga0207691_10001989 Ga0207691_1000198916 385
217 3300025941 Ga0207711_10069075 Ga0207711_100690755 385
218 3300025960 Ga0207651_10039603 Ga0207651_100396031 385
219 3300025986 Ga0207658_10009779 Ga0207658_100097797 385
220 3300026035 Ga0207703_10167518 Ga0207703_101675182 385
221 3300026088 Ga0207641_10012265 Ga0207641_100122655 385
222 3300027907 Ga0207428_10095509 Ga0207428_100955092 385
223 3300028380 Ga0268265_10001821 Ga0268265_100018217 385
224 3300042156 Ga0439446_0000937 Ga0439446_0000937_5041_6228 385
225 3300048917 Ga0496114_0097564 Ga0496114_0097564_1336_2493 385
226 3300049577 Ga0501041_0017174 Ga0501041_0017174_379_1629 385
227 3300049578 Ga0501042_0002543 Ga0501042_0002543_8875_10125 385
228 3300049580 Ga0501046_0026443 Ga0501046_0026443_3346_4596 385
229 3300049591 Ga0501075_0010573 Ga0501075_0010573_2408_3658 385
230 3300049592 Ga0501076_0002161 Ga0501076_0002161_3921_5171 385
231 3300049592 Ga0501076_0115916 Ga0501076_0115916_988_2148 385
232 3300049743 Ga0501081_0006435 Ga0501081_0006435_1076_2326 385
233 3300050507 nmdc:mga05p37_120454_c1 nmdc:mga05p37_120454_c1_27_1190 385
234 3300050507 nmdc:mga05p37_15951_c1 nmdc:mga05p37_15951_c1_169_1329 385
235 3300050507 nmdc:mga05p37_69460_c1 nmdc:mga05p37_69460_c1_1342_2505 385
236 3300050509 nmdc:mga0qj67_7534_c1 nmdc:mga0qj67_7534_c1_176_1342 385
237 3300050510 nmdc:mga06r32_136646_c1 nmdc:mga06r32_136646_c1_851_2017 385
238 3300050510 nmdc:mga06r32_137323_c1 nmdc:mga06r32_137323_c1_176_1342 385
239 3300050510 nmdc:mga06r32_75208_c1 nmdc:mga06r32_75208_c1_1873_3039 385
240 3300050512 nmdc:mga0n895_169382_c1 nmdc:mga0n895_169382_c1_778_1935 385
241 3300050513 nmdc:mga0rr50_98986_c1 nmdc:mga0rr50_98986_c1_810_1967 385
242 3300054114 Ga0501084_0262648 Ga0501084_0262648_63_1313 385
243 3300060353 Ga0501082_0035115 Ga0501082_0035115_130_1380 385
244 3300005293 Ga0065715_10105614 Ga0065715_101056142 386
245 3300005293 Ga0065715_10111154 Ga0065715_101111542 386
246 3300005295 Ga0065707_10139908 Ga0065707_101399082 386
247 3300005328 Ga0070676_10061447 Ga0070676_100614473 386
248 3300005328 Ga0070676_10116194 Ga0070676_101161942 386
249 3300005330 Ga0070690_100208304 Ga0070690_1002083041 386
250 3300005331 Ga0070670_100066555 Ga0070670_1000665552 386
251 3300005331 Ga0070670_100132935 Ga0070670_1001329352 386
252 3300005333 Ga0070677_10001586 Ga0070677_100015868 386
253 3300005333 Ga0070677_10048460 Ga0070677_100484602 386
254 3300005335 Ga0070666_10008495 Ga0070666_100084954 386
255 3300005335 Ga0070666_10064521 Ga0070666_100645212 386
256 3300005340 Ga0070689_100177702 Ga0070689_1001777022 386
257 3300005345 Ga0070692_10065194 Ga0070692_100651942 386
258 3300005347 Ga0070668_100005585 Ga0070668_1000055857 386
259 3300005347 Ga0070668_100109579 Ga0070668_1001095792 386
260 3300005353 Ga0070669_100007749 Ga0070669_1000077498 386
261 3300005353 Ga0070669_100011782 Ga0070669_1000117825 386
262 3300005353 Ga0070669_100040904 Ga0070669_1000409044 386
263 3300005354 Ga0070675_100011700 Ga0070675_1000117006 386
264 3300005354 Ga0070675_100060240 Ga0070675_1000602402 386
265 3300005354 Ga0070675_100106181 Ga0070675_1001061813 386
266 3300005354 Ga0070675_100277916 Ga0070675_1002779161 386
267 3300005356 Ga0070674_100000794 Ga0070674_10000079410 386
268 3300005356 Ga0070674_100044638 Ga0070674_1000446381 386
269 3300005364 Ga0070673_100244586 Ga0070673_1002445861 386
270 3300005365 Ga0070688_100077711 Ga0070688_1000777112 386
271 3300005366 Ga0070659_100075393 Ga0070659_1000753933 386
272 3300005434 Ga0070709_10003094 Ga0070709_100030947 386
273 3300005436 Ga0070713_100009479 Ga0070713_1000094794 386
274 3300005437 Ga0070710_10202509 Ga0070710_102025091 386
275 3300005438 Ga0070701_10084218 Ga0070701_100842181 386
276 3300005438 Ga0070701_10084553 Ga0070701_100845531 386
277 3300005441 Ga0070700_100042898 Ga0070700_1000428983 386
278 3300005441 Ga0070700_100079812 Ga0070700_1000798121 386
279 3300005456 Ga0070678_100273346 Ga0070678_1002733461 386
280 3300005457 Ga0070662_100035122 Ga0070662_1000351223 386
281 3300005457 Ga0070662_100124349 Ga0070662_1001243492 386
282 3300005459 Ga0068867_100102005 Ga0068867_1001020052 386
283 3300005459 Ga0068867_100107910 Ga0068867_1001079102 386
284 3300005459 Ga0068867_100121223 Ga0068867_1001212232 386
285 3300005466 Ga0070685_10055057 Ga0070685_100550573 386
286 3300005471 Ga0070698_100078161 Ga0070698_1000781612 386
287 3300005471 Ga0070698_100227465 Ga0070698_1002274652 386
288 3300005543 Ga0070672_100054878 Ga0070672_1000548782 386
289 3300005543 Ga0070672_100126723 Ga0070672_1001267232 386
290 3300005543 Ga0070672_100142238 Ga0070672_1001422381 386
291 3300005544 Ga0070686_100000485 Ga0070686_10000048518 386
292 3300005545 Ga0070695_100120935 Ga0070695_1001209352 386
293 3300005549 Ga0070704_100186946 Ga0070704_1001869461 386
294 3300005564 Ga0070664_100025325 Ga0070664_1000253253 386
295 3300005564 Ga0070664_100032556 Ga0070664_1000325565 386
296 3300005577 Ga0068857_100027496 Ga0068857_1000274966 386
297 3300005617 Ga0068859_100155569 Ga0068859_1001555692 386
298 3300005618 Ga0068864_100032067 Ga0068864_1000320675 386
299 3300005618 Ga0068864_100130547 Ga0068864_1001305472 386
300 3300005718 Ga0068866_10053865 Ga0068866_100538651 386
301 3300005719 Ga0068861_100011238 Ga0068861_1000112383 386
302 3300005840 Ga0068870_10004599 Ga0068870_100045996 386
303 3300005840 Ga0068870_10011464 Ga0068870_100114643 386
304 3300005840 Ga0068870_10012755 Ga0068870_100127554 386
305 3300005842 Ga0068858_100066707 Ga0068858_1000667072 386
306 3300005843 Ga0068860_100298257 Ga0068860_1002982572 386
307 3300005844 Ga0068862_100059657 Ga0068862_1000596573 386
308 3300005844 Ga0068862_100067405 Ga0068862_1000674054 386
309 3300005844 Ga0068862_100244003 Ga0068862_1002440032 386
310 3300006163 Ga0070715_10021164 Ga0070715_100211643 386
311 3300006237 Ga0097621_100042035 Ga0097621_1000420354 386
312 3300006358 Ga0068871_100006871 Ga0068871_1000068716 386
313 3300006358 Ga0068871_100028426 Ga0068871_1000284262 386
314 3300006844 Ga0075428_100000076 Ga0075428_1000000765 386
315 3300006844 Ga0075428_100001245 Ga0075428_10000124510 386
316 3300006844 Ga0075428_100014752 Ga0075428_1000147522 386
317 3300006846 Ga0075430_100009469 Ga0075430_1000094692 386
318 3300006847 Ga0075431_100000835 Ga0075431_1000008352 386
319 3300006847 Ga0075431_100043337 Ga0075431_1000433375 386
320 3300006852 Ga0075433_10000646 Ga0075433_100006463 386
321 3300006852 Ga0075433_10001990 Ga0075433_1000199011 386
322 3300006852 Ga0075433_10017074 Ga0075433_100170745 386
323 3300006852 Ga0075433_10236587 Ga0075433_102365871 386
324 3300006871 Ga0075434_100001211 Ga0075434_1000012118 386
325 3300006871 Ga0075434_100005345 Ga0075434_10000534510 386
326 3300006871 Ga0075434_100017157 Ga0075434_1000171572 386
327 3300006871 Ga0075434_100042891 Ga0075434_1000428913 386
328 3300006871 Ga0075434_100112754 Ga0075434_1001127542 386
329 3300006880 Ga0075429_100021537 Ga0075429_1000215373 386
330 3300006880 Ga0075429_100027990 Ga0075429_1000279905 386
331 3300006881 Ga0068865_100024864 Ga0068865_1000248642 386
332 3300006914 Ga0075436_100000182 Ga0075436_10000018224 386
333 3300006914 Ga0075436_100021404 Ga0075436_1000214043 386
334 3300006931 Ga0097620_100155561 Ga0097620_1001555612 386
335 3300007076 Ga0075435_100000027 Ga0075435_10000002751 386
336 3300007076 Ga0075435_100036734 Ga0075435_1000367343 386
337 3300007076 Ga0075435_100040424 Ga0075435_1000404244 386
338 3300007076 Ga0075435_100072687 Ga0075435_1000726873 386
339 3300007076 Ga0075435_100092534 Ga0075435_1000925343 386
340 3300007076 Ga0075435_100158150 Ga0075435_1001581502 386
341 3300009093 Ga0105240_10128093 Ga0105240_101280933 386
342 3300009094 Ga0111539_10000010 Ga0111539_10000010270 386
343 3300009094 Ga0111539_10000112 Ga0111539_1000011239 386
344 3300009094 Ga0111539_10004375 Ga0111539_1000437518 386
345 3300009094 Ga0111539_10028232 Ga0111539_100282326 386
346 3300009094 Ga0111539_10050352 Ga0111539_100503522 386
347 3300009094 Ga0111539_10362305 Ga0111539_103623052 386
348 3300009098 Ga0105245_10034466 Ga0105245_100344665 386
349 3300009147 Ga0114129_10005683 Ga0114129_100056832 386
350 3300009147 Ga0114129_10011275 Ga0114129_1001127516 386
351 3300009147 Ga0114129_10016432 Ga0114129_100164326 386
352 3300009147 Ga0114129_10130592 Ga0114129_101305923 386
353 3300009147 Ga0114129_10183047 Ga0114129_101830472 386
354 3300009147 Ga0114129_10251250 Ga0114129_102512502 386
355 3300009147 Ga0114129_10257736 Ga0114129_102577362 386
356 3300009147 Ga0114129_10641564 Ga0114129_106415641 386
357 3300009148 Ga0105243_10041101 Ga0105243_100411013 386
358 3300009148 Ga0105243_10098001 Ga0105243_100980013 386
359 3300009148 Ga0105243_10147048 Ga0105243_101470482 386
360 3300009176 Ga0105242_10256404 Ga0105242_102564042 386
361 3300009177 Ga0105248_10101870 Ga0105248_101018703 386
362 3300009553 Ga0105249_10000263 Ga0105249_1000026345 386
363 3300009553 Ga0105249_10024991 Ga0105249_100249914 386
364 3300009553 Ga0105249_10064325 Ga0105249_100643252 386
365 3300011119 Ga0105246_10144730 Ga0105246_101447302 386
366 3300013306 Ga0163162_10050128 Ga0163162_100501283 386
367 3300013306 Ga0163162_10056073 Ga0163162_100560734 386
368 3300013308 Ga0157375_10230982 Ga0157375_102309822 386
369 3300013308 Ga0157375_10245319 Ga0157375_102453192 386
370 3300014325 Ga0163163_10180598 Ga0163163_101805982 386
371 3300014326 Ga0157380_10007713 Ga0157380_100077133 386
372 3300014326 Ga0157380_10036205 Ga0157380_100362052 386
373 3300014326 Ga0157380_10047815 Ga0157380_100478154 386
374 3300014326 Ga0157380_10066103 Ga0157380_100661033 386
375 3300014326 Ga0157380_10204354 Ga0157380_102043542 386
376 3300014745 Ga0157377_10021616 Ga0157377_100216163 386
377 3300014968 Ga0157379_10104399 Ga0157379_101043991 386
378 3300014969 Ga0157376_10016826 Ga0157376_100168264 386
379 3300017792 Ga0163161_10201801 Ga0163161_102018012 386
380 3300025315 Ga0207697_10028833 Ga0207697_100288332 386
381 3300025893 Ga0207682_10001143 Ga0207682_100011434 386
382 3300025893 Ga0207682_10012439 Ga0207682_100124392 386
383 3300025898 Ga0207692_10129576 Ga0207692_101295762 386
384 3300025899 Ga0207642_10020074 Ga0207642_100200743 386
385 3300025901 Ga0207688_10043861 Ga0207688_100438612 386
386 3300025907 Ga0207645_10083002 Ga0207645_100830023 386
387 3300025907 Ga0207645_10106119 Ga0207645_101061192 386
388 3300025907 Ga0207645_10120237 Ga0207645_101202371 386
389 3300025908 Ga0207643_10003970 Ga0207643_100039705 386
390 3300025917 Ga0207660_10249079 Ga0207660_102490791 386
391 3300025918 Ga0207662_10045891 Ga0207662_100458912 386
392 3300025918 Ga0207662_10046336 Ga0207662_100463364 386
393 3300025922 Ga0207646_10084772 Ga0207646_100847723 386
394 3300025923 Ga0207681_10006186 Ga0207681_100061863 386
395 3300025923 Ga0207681_10071741 Ga0207681_100717412 386
396 3300025923 Ga0207681_10144452 Ga0207681_101444522 386
397 3300025925 Ga0207650_10033641 Ga0207650_100336412 386
398 3300025925 Ga0207650_10232484 Ga0207650_102324842 386
399 3300025926 Ga0207659_10018297 Ga0207659_100182975 386
400 3300025927 Ga0207687_10020572 Ga0207687_100205722 386
401 3300025933 Ga0207706_10069532 Ga0207706_100695322 386
402 3300025933 Ga0207706_10106809 Ga0207706_101068092 386
403 3300025933 Ga0207706_10127129 Ga0207706_101271293 386
404 3300025933 Ga0207706_10222920 Ga0207706_102229201 386
405 3300025934 Ga0207686_10017943 Ga0207686_100179435 386
406 3300025935 Ga0207709_10081117 Ga0207709_100811172 386
407 3300025937 Ga0207669_10003660 Ga0207669_100036604 386
408 3300025937 Ga0207669_10126010 Ga0207669_101260102 386
409 3300025937 Ga0207669_10149025 Ga0207669_101490251 386
410 3300025940 Ga0207691_10073977 Ga0207691_100739772 386
411 3300025940 Ga0207691_10087487 Ga0207691_100874873 386
412 3300025940 Ga0207691_10117069 Ga0207691_101170692 386
413 3300025940 Ga0207691_10169471 Ga0207691_101694712 386
414 3300025941 Ga0207711_10080416 Ga0207711_100804161 386
415 3300025945 Ga0207679_10039206 Ga0207679_100392065 386
416 3300025961 Ga0207712_10039928 Ga0207712_100399284 386
417 3300025961 Ga0207712_10209542 Ga0207712_102095421 386
418 3300025972 Ga0207668_10087022 Ga0207668_100870222 386
419 3300025981 Ga0207640_10095994 Ga0207640_100959942 386
420 3300025981 Ga0207640_10129773 Ga0207640_101297732 386
421 3300026089 Ga0207648_10050298 Ga0207648_100502985 386
422 3300026089 Ga0207648_10083861 Ga0207648_100838613 386
423 3300026089 Ga0207648_10121130 Ga0207648_101211302 386
424 3300026095 Ga0207676_10262061 Ga0207676_102620611 386
425 3300026116 Ga0207674_10114349 Ga0207674_101143493 386
426 3300026118 Ga0207675_100016861 Ga0207675_1000168617 386
427 3300026118 Ga0207675_100061744 Ga0207675_1000617444 386
428 3300026121 Ga0207683_10015791 Ga0207683_100157913 386
429 3300026121 Ga0207683_10148321 Ga0207683_101483212 386
430 3300027876 Ga0209974_10024511 Ga0209974_100245112 386
431 3300027907 Ga0207428_10000097 Ga0207428_1000009777 386
432 3300027907 Ga0207428_10000875 Ga0207428_100008753 386
433 3300027907 Ga0207428_10005438 Ga0207428_1000543810 386
434 3300027907 Ga0207428_10009561 Ga0207428_100095616 386
435 3300027907 Ga0207428_10034419 Ga0207428_100344194 386
436 3300027907 Ga0207428_10063333 Ga0207428_100633334 386
437 3300028380 Ga0268265_10012315 Ga0268265_100123157 386
438 3300028380 Ga0268265_10251413 Ga0268265_102514131 386
439 3300035115 Ga0373941_0023541 Ga0373941_0023541_13_1176 386
440 3300035170 Ga0373943_0020373 Ga0373943_0020373_727_1890 386
441 3300035410 Ga0373924_0053418 Ga0373924_0053418_75_1238 386
442 3300035692 Ga0373935_0018073 Ga0373935_0018073_2192_3355 386
443 3300035725 Ga0373947_0053799 Ga0373947_0053799_1151_2314 386
444 3300042461 Ga0439460_0006001 Ga0439460_0006001_1454_2620 386
445 3300042876 Ga0451577_0003216 Ga0451577_0003216_8364_9527 386
446 3300046459 Ga0495629_0175090 Ga0495629_0175090_287_1450 386
447 3300046511 Ga0495608_0018395 Ga0495608_0018395_2683_3846 386
448 3300046516 Ga0495628_0025274 Ga0495628_0025274_3044_4306 386
449 3300046535 Ga0495586_0123034 Ga0495586_0123034_125_1288 386
450 3300046539 Ga0495621_0019729 Ga0495621_0019729_684_1847 386
451 3300046543 Ga0495645_0011900 Ga0495645_0011900_2056_3219 386
452 3300046559 Ga0495667_0037720 Ga0495667_0037720_2036_3199 386
453 3300046684 Ga0495669_0046036 Ga0495669_0046036_716_1879 386
454 3300046689 Ga0495613_0000507 Ga0495613_0000507_12992_14155 386
455 3300047471 Ga0495684_0000188 Ga0495684_0000188_18816_19979 386
456 3300048904 Ga0496101_0002514 Ga0496101_0002514_1303_2466 386
457 3300048905 Ga0496102_0148613 Ga0496102_0148613_292_1455 386
458 3300048907 Ga0496104_0050545 Ga0496104_0050545_70_1233 386
459 3300048909 Ga0496106_0005072 Ga0496106_0005072_4003_5166 386
460 3300048917 Ga0496114_0000462 Ga0496114_0000462_25621_26784 386
461 3300049574 Ga0501038_0212472 Ga0501038_0212472_302_1501 386
462 3300049576 Ga0501040_0112156 Ga0501040_0112156_414_1613 386
463 3300049578 Ga0501042_0048289 Ga0501042_0048289_1734_2897 386
464 3300049587 Ga0501071_0026618 Ga0501071_0026618_1805_3004 386
465 3300049588 Ga0501072_0066879 Ga0501072_0066879_1029_2228 386
466 3300049589 Ga0501073_0025396 Ga0501073_0025396_1034_2206 386
467 3300049591 Ga0501075_0034715 Ga0501075_0034715_1817_3016 386
468 3300049592 Ga0501076_0034974 Ga0501076_0034974_1023_2222 386
469 3300049742 Ga0501080_0370561 Ga0501080_0370561_62_1261 386
470 3300050507 nmdc:mga05p37_114738_c1 nmdc:mga05p37_114738_c1_1718_2905 386
471 3300050507 nmdc:mga05p37_22582_c1 nmdc:mga05p37_22582_c1_890_2056 386
472 3300050507 nmdc:mga05p37_25835_c1 nmdc:mga05p37_25835_c1_4974_6137 386
473 3300050507 nmdc:mga05p37_259924_c1 nmdc:mga05p37_259924_c1_624_1784 386
474 3300050507 nmdc:mga05p37_32632_c1 nmdc:mga05p37_32632_c1_3649_4830 386
475 3300050507 nmdc:mga05p37_645557_c1 nmdc:mga05p37_645557_c1_15_1175 386
476 3300050508 nmdc:mga09592_2024_c1 nmdc:mga09592_2024_c1_11069_12250 386
477 3300050508 nmdc:mga09592_260606_c1 nmdc:mga09592_260606_c1_129_1316 386
478 3300050508 nmdc:mga09592_37096_c1 nmdc:mga09592_37096_c1_316_1500 386
479 3300050508 nmdc:mga09592_52269_c1 nmdc:mga09592_52269_c1_435_1595 386
480 3300050509 nmdc:mga0qj67_7074_c1 nmdc:mga0qj67_7074_c1_436_1596 386
481 3300050510 nmdc:mga06r32_346427_c1 nmdc:mga06r32_346427_c1_129_1313 386
482 3300050510 nmdc:mga06r32_35683_c1 nmdc:mga06r32_35683_c1_890_2053 386
483 3300050510 nmdc:mga06r32_44524_c1 nmdc:mga06r32_44524_c1_57_1217 386
484 3300050510 nmdc:mga06r32_787_c1 nmdc:mga06r32_787_c1_1563_2723 386
485 3300050511 nmdc:mga08y16_10_c1 nmdc:mga08y16_10_c1_189181_190353 386
486 3300050511 nmdc:mga08y16_17955_c1 nmdc:mga08y16_17955_c1_1917_3080 386
487 3300050511 nmdc:mga08y16_1884_c1 nmdc:mga08y16_1884_c1_1569_2762 386
488 3300050511 nmdc:mga08y16_43599_c1 nmdc:mga08y16_43599_c1_479_1639 386
489 3300050512 nmdc:mga0n895_190_c1 nmdc:mga0n895_190_c1_12717_13877 386
490 3300050512 nmdc:mga0n895_3737_c1 nmdc:mga0n895_3737_c1_9431_10636 386
491 3300050512 nmdc:mga0n895_380855_c1 nmdc:mga0n895_380855_c1_13_1197 386
492 3300050512 nmdc:mga0n895_3_c1 nmdc:mga0n895_3_c1_46738_47922 386
493 3300050512 nmdc:mga0n895_425275_c1 nmdc:mga0n895_425275_c1_124_1287 386
494 3300050513 nmdc:mga0rr50_31708_c1 nmdc:mga0rr50_31708_c1_1652_2836 386
495 3300050513 nmdc:mga0rr50_32041_c1 nmdc:mga0rr50_32041_c1_1290_2450 386
496 3300050513 nmdc:mga0rr50_39_c1 nmdc:mga0rr50_39_c1_47091_48275 386
497 3300050514 nmdc:mga08x19_259_c1 nmdc:mga08x19_259_c1_11745_12929 386
498 3300050515 nmdc:mga0a205_12241_c1 nmdc:mga0a205_12241_c1_270_1433 386
499 3300050515 nmdc:mga0a205_574_c1 nmdc:mga0a205_574_c1_23923_25083 386
500 3300050515 nmdc:mga0a205_7422_c1 nmdc:mga0a205_7422_c1_6164_7324 386
501 3300053084 Ga0495595_0026664 Ga0495595_0026664_1077_2240 386
502 3300053084 Ga0495595_0073131 Ga0495595_0073131_82_1245 386
503 3300053085 Ga0495619_0026975 Ga0495619_0026975_1126_2289 386

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07075

NamZ_N

Exo-beta-N-acetylmuramidase NamZ, N-terminal

21

224

0.99

PF20732

NamZ_C

Exo-beta-N-acetylmuramidase NamZ, C-terminal

227

374

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k05-assembly1.cif.gz_A crystal structure of a duf1343 family protein (bf0371) from bacteroides fragilis nctc 9343 at 1.65 a resolution 0.9078 2 386
4k05-assembly1.cif.gz_A crystal structure of a duf1343 family protein (bf0371) from bacteroides fragilis nctc 9343 at 1.65 a resolution 0.8941 2 386
4jja-assembly1.cif.gz_A crystal structure of a duf1343 family protein (bf0379) from bacteroides fragilis nctc 9343 at 1.30 a resolution 0.8254 1 386
4jja-assembly1.cif.gz_A crystal structure of a duf1343 family protein (bf0379) from bacteroides fragilis nctc 9343 at 1.30 a resolution 0.8144 1 386
4izg-assembly1.cif.gz_A crystal structure of an enolase (mandelate racemase subgroup) from paracococus denitrificans pd1222 (target nysgrc-012907) with bound cis-4oh-d-proline betaine (product) 0.6928 93 136
ID Description Score Start End Superfamily
4k05B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Uncharacterised protein PF07075, DUF1343 0.9065 2 213 3.40.50.12170
4k05B02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8207 216 370 3.90.1150.140
4k05B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Uncharacterised protein PF07075, DUF1343 0.8179 2 213 3.40.50.12170
4k05B02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8107 216 370 3.90.1150.140
af_A0A1D6MYJ2_339_548_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.6929 93 136 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A838S0N7-F1-model_v4 DUF1343 domain-containing protein 0.9841 254 386 GO:0033922
AF-A0A838S0N7-F1-model_v4 DUF1343 domain-containing protein 0.9769 254 386 GO:0033922
AF-A0A7W1TUB8-F1-model_v4 DUF1343 domain-containing protein 0.9719 197 386 GO:0033922
AF-A0A2V7A8X7-F1-model_v4 DUF1343 domain-containing protein 0.9696 206 386 GO:0033922
AF-A0A848WR91-F1-model_v4 DUF1343 domain-containing protein 0.9693 200 349 GO:0033922

Feature Viewer

pLDDT pTM Quality
88.76 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map