F456019
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 503 | 229 | 503 | 386 |
Family's Representative Sequence
| Representative Sequence | 3300025315|Ga0207697_10028833|Ga0207697_100288332 |
| Length | 434 |
| Sequence | MALILGSDRLLASKRLDGRRVGVVCNPASVDAGLRHIADRLAALPNTRLAAIFGPQHGFRSDVQDNMIETAHGHDEVRRVPVYSLYSETREPTPDMLRDLDVLVIDLQDVGVRIYTYIYTMANCLKAARKQGLEVIVCDRPNPIGGVDVEGMVLEPGFESFVGMYPIPMRHGMTIGEIARLFNEEFGIGAKLDVVQMEGWQREMYFDETGLTWIISSPNIPTFDTTTVYPGAVLFEGTNVSEGRGTTRPFELLGAPWVIAETFAEGMNRRELPGVFFRPALFEPTFHKHAGKGCAGCQVHVLDRRTFQAVEAGVALIEAFRAADPDGVRWKDPPYEYEFDKMPIDCLAGSSQLREQIDAGMEFGRTVAGRAVAKNRRGEMKQDEFIWKALREKIKRGRRRERRDHHDFELCVVSLGAALGGLCFFNGDLCEDRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 131 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 132 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 133 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 134 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 135 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 136 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 137 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 138 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 139 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 140 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 141 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 142 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 143 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 144 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 145 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 146 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 149 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 150 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 152 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 154 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 155 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 156 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 157 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 158 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 159 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 160 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 181 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 182 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 183 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 184 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 185 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 186 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 187 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 208 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 209 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 210 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 211 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 212 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 225 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 226 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 227 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 228 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.19 |
| Nodule | 0 |
| Rhizoplane | 2.39 |
| Rhizosphere | 95.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10105614 | 3300005293 | Bacteria | 2881 |
| 2 | Ga0065715_10111154 | 3300005293 | Bacteria | 2586 |
| 3 | Ga0065707_10000940 | 3300005295 | Bacteria | 19288 |
| 4 | Ga0065707_10102905 | 3300005295 | Bacteria | 2778 |
| 5 | Ga0065707_10139908 | 3300005295 | Unclassified | 1787 |
| 6 | Ga0070676_10023318 | 3300005328 | Bacteria | 3478 |
| 7 | Ga0070676_10061447 | 3300005328 | Bacteria | 2233 |
| 8 | Ga0070676_10116194 | 3300005328 | Bacteria | 1673 |
| 9 | Ga0070690_100208304 | 3300005330 | Bacteria | 1364 |
| 10 | Ga0070670_100010119 | 3300005331 | Bacteria | 8047 |
| 11 | Ga0070670_100066555 | 3300005331 | Bacteria | 3092 |
| 12 | Ga0070670_100132935 | 3300005331 | Bacteria | 2149 |
| 13 | Ga0070670_100252422 | 3300005331 | Bacteria | 1537 |
| 14 | Ga0070677_10001586 | 3300005333 | Bacteria | 7188 |
| 15 | Ga0070677_10048460 | 3300005333 | Bacteria | 1707 |
| 16 | Ga0070666_10008495 | 3300005335 | Bacteria | 6379 |
| 17 | Ga0070666_10064521 | 3300005335 | Unclassified | 2484 |
| 18 | Ga0070689_100107827 | 3300005340 | Bacteria | 2212 |
| 19 | Ga0070689_100177702 | 3300005340 | Bacteria | 1727 |
| 20 | Ga0070691_10012290 | 3300005341 | Bacteria | 3919 |
| 21 | Ga0070692_10065194 | 3300005345 | Bacteria | 1928 |
| 22 | Ga0070692_10072408 | 3300005345 | Bacteria | 1839 |
| 23 | Ga0070668_100005585 | 3300005347 | Bacteria | 9329 |
| 24 | Ga0070668_100109579 | 3300005347 | Bacteria | 2197 |
| 25 | Ga0070669_100007749 | 3300005353 | Bacteria | 7677 |
| 26 | Ga0070669_100011782 | 3300005353 | Bacteria | 6203 |
| 27 | Ga0070669_100040904 | 3300005353 | Bacteria | 3370 |
| 28 | Ga0070669_100041108 | 3300005353 | Bacteria | 3362 |
| 29 | Ga0070669_100065108 | 3300005353 | Bacteria | 2685 |
| 30 | Ga0070675_100011700 | 3300005354 | Bacteria | 6878 |
| 31 | Ga0070675_100046981 | 3300005354 | Bacteria | 3537 |
| 32 | Ga0070675_100060240 | 3300005354 | Unclassified | 3134 |
| 33 | Ga0070675_100106181 | 3300005354 | Bacteria | 2370 |
| 34 | Ga0070675_100266695 | 3300005354 | Bacteria | 1502 |
| 35 | Ga0070675_100277916 | 3300005354 | Bacteria | 1471 |
| 36 | Ga0070674_100000794 | 3300005356 | Bacteria | 16226 |
| 37 | Ga0070674_100044638 | 3300005356 | Bacteria | 3023 |
| 38 | Ga0070674_100145669 | 3300005356 | Bacteria | 1782 |
| 39 | Ga0070673_100118261 | 3300005364 | Bacteria | 2206 |
| 40 | Ga0070673_100176434 | 3300005364 | Bacteria | 1827 |
| 41 | Ga0070673_100244586 | 3300005364 | Bacteria | 1561 |
| 42 | Ga0070688_100077711 | 3300005365 | Bacteria | 2139 |
| 43 | Ga0070659_100075393 | 3300005366 | Bacteria | 2688 |
| 44 | Ga0070659_100222208 | 3300005366 | Bacteria | 1559 |
| 45 | Ga0070709_10003094 | 3300005434 | Bacteria | 8939 |
| 46 | Ga0070713_100009479 | 3300005436 | Bacteria | 6975 |
| 47 | Ga0070710_10202509 | 3300005437 | Bacteria | 1254 |
| 48 | Ga0070701_10072207 | 3300005438 | Bacteria | 1848 |
| 49 | Ga0070701_10084218 | 3300005438 | Bacteria | 1729 |
| 50 | Ga0070701_10084553 | 3300005438 | Bacteria | 1726 |
| 51 | Ga0070705_100008580 | 3300005440 | Bacteria | 5063 |
| 52 | Ga0070705_100024343 | 3300005440 | Bacteria | 3266 |
| 53 | Ga0070700_100015456 | 3300005441 | Bacteria | 4328 |
| 54 | Ga0070700_100042898 | 3300005441 | Bacteria | 2780 |
| 55 | Ga0070700_100079812 | 3300005441 | Bacteria | 2110 |
| 56 | Ga0070694_100007521 | 3300005444 | Bacteria | 6648 |
| 57 | Ga0070694_100041096 | 3300005444 | Bacteria | 3083 |
| 58 | Ga0070678_100062209 | 3300005456 | Bacteria | 2755 |
| 59 | Ga0070678_100273346 | 3300005456 | Bacteria | 1426 |
| 60 | Ga0070662_100035122 | 3300005457 | Bacteria | 3538 |
| 61 | Ga0070662_100124349 | 3300005457 | Bacteria | 1980 |
| 62 | Ga0070662_100265603 | 3300005457 | Bacteria | 1384 |
| 63 | Ga0070681_10045654 | 3300005458 | Bacteria | 4383 |
| 64 | Ga0068867_100102005 | 3300005459 | Bacteria | 2193 |
| 65 | Ga0068867_100106501 | 3300005459 | Bacteria | 2148 |
| 66 | Ga0068867_100107910 | 3300005459 | Bacteria | 2134 |
| 67 | Ga0068867_100121223 | 3300005459 | Bacteria | 2021 |
| 68 | Ga0070685_10055057 | 3300005466 | Bacteria | 2310 |
| 69 | Ga0070698_100078161 | 3300005471 | Bacteria | 3307 |
| 70 | Ga0070698_100227465 | 3300005471 | Bacteria | 1799 |
| 71 | Ga0070698_100245804 | 3300005471 | Bacteria | 1722 |
| 72 | Ga0070699_100002083 | 3300005518 | Bacteria | 18104 |
| 73 | Ga0070699_100009224 | 3300005518 | Bacteria | 8552 |
| 74 | Ga0070672_100002470 | 3300005543 | Bacteria | 11746 |
| 75 | Ga0070672_100054878 | 3300005543 | Bacteria | 3120 |
| 76 | Ga0070672_100126723 | 3300005543 | Bacteria | 2095 |
| 77 | Ga0070672_100142238 | 3300005543 | Bacteria | 1979 |
| 78 | Ga0070672_100157579 | 3300005543 | Bacteria | 1881 |
| 79 | Ga0070686_100000485 | 3300005544 | Bacteria | 24083 |
| 80 | Ga0070695_100005004 | 3300005545 | Bacteria | 7813 |
| 81 | Ga0070695_100009117 | 3300005545 | Bacteria | 5897 |
| 82 | Ga0070695_100120935 | 3300005545 | Unclassified | 1791 |
| 83 | Ga0070696_100001063 | 3300005546 | Bacteria | 17763 |
| 84 | Ga0070696_100003538 | 3300005546 | Bacteria | 10398 |
| 85 | Ga0070704_100003499 | 3300005549 | Bacteria | 9014 |
| 86 | Ga0070704_100005169 | 3300005549 | Bacteria | 7588 |
| 87 | Ga0070704_100186946 | 3300005549 | Bacteria | 1662 |
| 88 | Ga0070664_100025325 | 3300005564 | Bacteria | 4917 |
| 89 | Ga0070664_100032556 | 3300005564 | Bacteria | 4362 |
| 90 | Ga0068857_100027496 | 3300005577 | Bacteria | 5017 |
| 91 | Ga0070702_100018066 | 3300005615 | Bacteria | 3651 |
| 92 | Ga0068852_100179750 | 3300005616 | Bacteria | 1989 |
| 93 | Ga0068859_100155569 | 3300005617 | Bacteria | 2363 |
| 94 | Ga0068864_100032067 | 3300005618 | Bacteria | 4462 |
| 95 | Ga0068864_100130547 | 3300005618 | Bacteria | 2256 |
| 96 | Ga0068864_100374182 | 3300005618 | Bacteria | 1349 |
| 97 | Ga0068866_10053865 | 3300005718 | Bacteria | 2059 |
| 98 | Ga0068861_100011238 | 3300005719 | Bacteria | 6215 |
| 99 | Ga0068861_100026065 | 3300005719 | Bacteria | 4246 |
| 100 | Ga0068870_10004599 | 3300005840 | Bacteria | 5949 |
| 101 | Ga0068870_10011464 | 3300005840 | Bacteria | 4110 |
| 102 | Ga0068870_10012755 | 3300005840 | Bacteria | 3935 |
| 103 | Ga0068863_100069367 | 3300005841 | Bacteria | 3333 |
| 104 | Ga0068858_100066707 | 3300005842 | Bacteria | 3332 |
| 105 | Ga0068858_100168676 | 3300005842 | Bacteria | 2063 |
| 106 | Ga0068860_100092090 | 3300005843 | Bacteria | 2888 |
| 107 | Ga0068860_100298257 | 3300005843 | Bacteria | 1578 |
| 108 | Ga0068862_100059657 | 3300005844 | Unclassified | 3277 |
| 109 | Ga0068862_100067405 | 3300005844 | Bacteria | 3085 |
| 110 | Ga0068862_100088601 | 3300005844 | Bacteria | 2692 |
| 111 | Ga0068862_100244003 | 3300005844 | Bacteria | 1634 |
| 112 | Ga0075368_10027585 | 3300006042 | Unclassified | 2192 |
| 113 | Ga0075364_10004703 | 3300006051 | Bacteria | 7878 |
| 114 | Ga0070715_10021164 | 3300006163 | Bacteria | 2519 |
| 115 | Ga0075367_10034360 | 3300006178 | Bacteria | 2928 |
| 116 | Ga0075367_10035000 | 3300006178 | Bacteria | 2904 |
| 117 | Ga0075366_10057120 | 3300006195 | Bacteria | 2319 |
| 118 | Ga0097621_100003586 | 3300006237 | Bacteria | 10725 |
| 119 | Ga0097621_100018204 | 3300006237 | Bacteria | 5358 |
| 120 | Ga0097621_100042035 | 3300006237 | Bacteria | 3681 |
| 121 | Ga0097621_100148086 | 3300006237 | Bacteria | 2012 |
| 122 | Ga0075370_10001417 | 3300006353 | Bacteria | 10375 |
| 123 | Ga0068871_100002245 | 3300006358 | Bacteria | 13132 |
| 124 | Ga0068871_100006871 | 3300006358 | Bacteria | 8102 |
| 125 | Ga0068871_100021927 | 3300006358 | Bacteria | 4919 |
| 126 | Ga0068871_100028426 | 3300006358 | Bacteria | 4383 |
| 127 | Ga0075428_100000076 | 3300006844 | Bacteria | 81732 |
| 128 | Ga0075428_100001245 | 3300006844 | Bacteria | 27216 |
| 129 | Ga0075428_100014752 | 3300006844 | Bacteria | 8681 |
| 130 | Ga0075428_100034824 | 3300006844 | Bacteria | 5552 |
| 131 | Ga0075430_100003723 | 3300006846 | Bacteria | 12814 |
| 132 | Ga0075430_100009469 | 3300006846 | Bacteria | 8232 |
| 133 | Ga0075430_100050224 | 3300006846 | Bacteria | 3518 |
| 134 | Ga0075430_100056910 | 3300006846 | Bacteria | 3288 |
| 135 | Ga0075431_100000835 | 3300006847 | Bacteria | 26939 |
| 136 | Ga0075431_100004143 | 3300006847 | Bacteria | 14156 |
| 137 | Ga0075431_100043337 | 3300006847 | Bacteria | 4643 |
| 138 | Ga0075433_10000646 | 3300006852 | Bacteria | 23432 |
| 139 | Ga0075433_10001990 | 3300006852 | Bacteria | 15383 |
| 140 | Ga0075433_10017074 | 3300006852 | Bacteria | 6001 |
| 141 | Ga0075433_10023238 | 3300006852 | Bacteria | 5215 |
| 142 | Ga0075433_10039086 | 3300006852 | Bacteria | 4101 |
| 143 | Ga0075433_10073551 | 3300006852 | Bacteria | 3006 |
| 144 | Ga0075433_10185334 | 3300006852 | Unclassified | 1852 |
| 145 | Ga0075433_10236587 | 3300006852 | Bacteria | 1622 |
| 146 | Ga0075434_100001211 | 3300006871 | Bacteria | 21442 |
| 147 | Ga0075434_100005345 | 3300006871 | Bacteria | 11683 |
| 148 | Ga0075434_100017157 | 3300006871 | Bacteria | 6968 |
| 149 | Ga0075434_100042891 | 3300006871 | Bacteria | 4486 |
| 150 | Ga0075434_100065316 | 3300006871 | Bacteria | 3624 |
| 151 | Ga0075434_100112754 | 3300006871 | Bacteria | 2731 |
| 152 | Ga0075429_100021537 | 3300006880 | Bacteria | 5587 |
| 153 | Ga0075429_100027990 | 3300006880 | Bacteria | 4892 |
| 154 | Ga0068865_100024864 | 3300006881 | Bacteria | 3933 |
| 155 | Ga0068865_100178528 | 3300006881 | Bacteria | 1633 |
| 156 | Ga0075436_100000182 | 3300006914 | Bacteria | 39329 |
| 157 | Ga0075436_100013462 | 3300006914 | Bacteria | 5600 |
| 158 | Ga0075436_100021404 | 3300006914 | Bacteria | 4440 |
| 159 | Ga0075436_100049594 | 3300006914 | Bacteria | 2897 |
| 160 | Ga0097620_100155561 | 3300006931 | Bacteria | 2363 |
| 161 | Ga0097620_100205905 | 3300006931 | Bacteria | 2052 |
| 162 | Ga0075435_100000027 | 3300007076 | Bacteria | 84051 |
| 163 | Ga0075435_100002436 | 3300007076 | Bacteria | 12352 |
| 164 | Ga0075435_100036734 | 3300007076 | Bacteria | 3895 |
| 165 | Ga0075435_100040424 | 3300007076 | Bacteria | 3723 |
| 166 | Ga0075435_100072687 | 3300007076 | Bacteria | 2810 |
| 167 | Ga0075435_100092534 | 3300007076 | Bacteria | 2497 |
| 168 | Ga0075435_100158150 | 3300007076 | Bacteria | 1908 |
| 169 | Ga0075435_100174019 | 3300007076 | Bacteria | 1817 |
| 170 | Ga0105240_10128093 | 3300009093 | Unclassified | 3048 |
| 171 | Ga0111539_10000010 | 3300009094 | Bacteria | 366246 |
| 172 | Ga0111539_10000112 | 3300009094 | Bacteria | 89047 |
| 173 | Ga0111539_10004375 | 3300009094 | Bacteria | 18483 |
| 174 | Ga0111539_10028232 | 3300009094 | Bacteria | 6848 |
| 175 | Ga0111539_10034682 | 3300009094 | Bacteria | 6114 |
| 176 | Ga0111539_10050352 | 3300009094 | Bacteria | 4962 |
| 177 | Ga0111539_10086094 | 3300009094 | Bacteria | 3693 |
| 178 | Ga0111539_10273970 | 3300009094 | Bacteria | 1964 |
| 179 | Ga0111539_10362305 | 3300009094 | Bacteria | 1687 |
| 180 | Ga0105245_10034466 | 3300009098 | Bacteria | 4490 |
| 181 | Ga0105245_10050364 | 3300009098 | Bacteria | 3733 |
| 182 | Ga0114129_10005683 | 3300009147 | Bacteria | 17657 |
| 183 | Ga0114129_10006755 | 3300009147 | Bacteria | 16287 |
| 184 | Ga0114129_10007379 | 3300009147 | Bacteria | 15653 |
| 185 | Ga0114129_10011275 | 3300009147 | Bacteria | 12740 |
| 186 | Ga0114129_10016432 | 3300009147 | Bacteria | 10532 |
| 187 | Ga0114129_10057692 | 3300009147 | Bacteria | 5431 |
| 188 | Ga0114129_10073957 | 3300009147 | Bacteria | 4747 |
| 189 | Ga0114129_10130592 | 3300009147 | Bacteria | 3450 |
| 190 | Ga0114129_10143125 | 3300009147 | Bacteria | 3276 |
| 191 | Ga0114129_10183047 | 3300009147 | Bacteria | 2849 |
| 192 | Ga0114129_10251250 | 3300009147 | Bacteria | 2373 |
| 193 | Ga0114129_10257736 | 3300009147 | Bacteria | 2339 |
| 194 | Ga0114129_10641564 | 3300009147 | Bacteria | 1372 |
| 195 | Ga0105243_10041101 | 3300009148 | Bacteria | 3616 |
| 196 | Ga0105243_10052628 | 3300009148 | Bacteria | 3226 |
| 197 | Ga0105243_10098001 | 3300009148 | Bacteria | 2428 |
| 198 | Ga0105243_10147048 | 3300009148 | Bacteria | 2017 |
| 199 | Ga0105241_10082917 | 3300009174 | Bacteria | 2514 |
| 200 | Ga0105242_10256404 | 3300009176 | Bacteria | 1578 |
| 201 | Ga0105248_10004554 | 3300009177 | Bacteria | 15343 |
| 202 | Ga0105248_10101870 | 3300009177 | Bacteria | 3236 |
| 203 | Ga0105248_10229086 | 3300009177 | Bacteria | 2092 |
| 204 | Ga0105249_10000263 | 3300009553 | Bacteria | 56064 |
| 205 | Ga0105249_10007708 | 3300009553 | Bacteria | 9380 |
| 206 | Ga0105249_10024991 | 3300009553 | Bacteria | 5375 |
| 207 | Ga0105249_10064325 | 3300009553 | Bacteria | 3372 |
| 208 | Ga0105246_10144730 | 3300011119 | Bacteria | 1792 |
| 209 | Ga0105246_10274343 | 3300011119 | Unclassified | 1350 |
| 210 | Ga0157374_10069207 | 3300013296 | Bacteria | 3323 |
| 211 | Ga0163162_10050128 | 3300013306 | Bacteria | 4187 |
| 212 | Ga0163162_10056073 | 3300013306 | Bacteria | 3969 |
| 213 | Ga0163162_10150303 | 3300013306 | Bacteria | 2446 |
| 214 | Ga0157375_10085134 | 3300013308 | Bacteria | 3211 |
| 215 | Ga0157375_10223032 | 3300013308 | Bacteria | 2044 |
| 216 | Ga0157375_10230982 | 3300013308 | Bacteria | 2009 |
| 217 | Ga0157375_10245319 | 3300013308 | Bacteria | 1951 |
| 218 | Ga0163163_10180598 | 3300014325 | Bacteria | 2157 |
| 219 | Ga0163163_10200620 | 3300014325 | Bacteria | 2043 |
| 220 | Ga0157380_10007713 | 3300014326 | Bacteria | 7657 |
| 221 | Ga0157380_10021759 | 3300014326 | Bacteria | 4816 |
| 222 | Ga0157380_10036205 | 3300014326 | Bacteria | 3817 |
| 223 | Ga0157380_10047815 | 3300014326 | Bacteria | 3366 |
| 224 | Ga0157380_10066103 | 3300014326 | Bacteria | 2908 |
| 225 | Ga0157380_10204354 | 3300014326 | Bacteria | 1755 |
| 226 | Ga0157377_10021616 | 3300014745 | Bacteria | 3386 |
| 227 | Ga0157379_10008023 | 3300014968 | Bacteria | 9163 |
| 228 | Ga0157379_10104399 | 3300014968 | Bacteria | 2543 |
| 229 | Ga0157376_10016826 | 3300014969 | Bacteria | 5562 |
| 230 | Ga0157376_10069214 | 3300014969 | Bacteria | 2991 |
| 231 | Ga0163161_10009615 | 3300017792 | Bacteria | 6687 |
| 232 | Ga0163161_10201801 | 3300017792 | Bacteria | 1533 |
| 233 | Ga0207697_10028833 | 3300025315 | Bacteria | 2270 |
| 234 | Ga0207682_10001143 | 3300025893 | Bacteria | 12289 |
| 235 | Ga0207682_10012439 | 3300025893 | Bacteria | 3322 |
| 236 | Ga0207692_10129576 | 3300025898 | Bacteria | 1423 |
| 237 | Ga0207642_10020074 | 3300025899 | Bacteria | 2601 |
| 238 | Ga0207688_10043861 | 3300025901 | Bacteria | 2492 |
| 239 | Ga0207645_10004842 | 3300025907 | Bacteria | 9885 |
| 240 | Ga0207645_10083002 | 3300025907 | Bacteria | 2054 |
| 241 | Ga0207645_10106119 | 3300025907 | Unclassified | 1816 |
| 242 | Ga0207645_10120237 | 3300025907 | Bacteria | 1705 |
| 243 | Ga0207643_10003970 | 3300025908 | Bacteria | 7964 |
| 244 | Ga0207654_10071024 | 3300025911 | Bacteria | 2068 |
| 245 | Ga0207693_10010342 | 3300025915 | Bacteria | 7575 |
| 246 | Ga0207660_10249079 | 3300025917 | Bacteria | 1402 |
| 247 | Ga0207662_10045891 | 3300025918 | Bacteria | 2584 |
| 248 | Ga0207662_10046336 | 3300025918 | Unclassified | 2572 |
| 249 | Ga0207646_10070677 | 3300025922 | Bacteria | 3118 |
| 250 | Ga0207646_10084772 | 3300025922 | Bacteria | 2835 |
| 251 | Ga0207681_10006186 | 3300025923 | Bacteria | 7344 |
| 252 | Ga0207681_10024874 | 3300025923 | Bacteria | 3846 |
| 253 | Ga0207681_10069859 | 3300025923 | Bacteria | 2444 |
| 254 | Ga0207681_10071741 | 3300025923 | Bacteria | 2416 |
| 255 | Ga0207681_10144452 | 3300025923 | Bacteria | 1776 |
| 256 | Ga0207650_10033641 | 3300025925 | Bacteria | 3714 |
| 257 | Ga0207650_10232484 | 3300025925 | Unclassified | 1487 |
| 258 | Ga0207659_10018297 | 3300025926 | Bacteria | 4591 |
| 259 | Ga0207659_10091910 | 3300025926 | Bacteria | 2268 |
| 260 | Ga0207659_10313296 | 3300025926 | Bacteria | 1293 |
| 261 | Ga0207687_10020572 | 3300025927 | Bacteria | 4379 |
| 262 | Ga0207706_10069532 | 3300025933 | Bacteria | 3097 |
| 263 | Ga0207706_10098423 | 3300025933 | Bacteria | 2573 |
| 264 | Ga0207706_10106809 | 3300025933 | Bacteria | 2463 |
| 265 | Ga0207706_10127129 | 3300025933 | Bacteria | 2241 |
| 266 | Ga0207706_10222920 | 3300025933 | Bacteria | 1651 |
| 267 | Ga0207686_10017943 | 3300025934 | Bacteria | 3998 |
| 268 | Ga0207686_10079066 | 3300025934 | Bacteria | 2140 |
| 269 | Ga0207709_10050540 | 3300025935 | Bacteria | 2543 |
| 270 | Ga0207709_10081117 | 3300025935 | Bacteria | 2091 |
| 271 | Ga0207670_10067878 | 3300025936 | Bacteria | 2455 |
| 272 | Ga0207669_10003660 | 3300025937 | Bacteria | 6675 |
| 273 | Ga0207669_10126010 | 3300025937 | Bacteria | 1749 |
| 274 | Ga0207669_10149025 | 3300025937 | Bacteria | 1636 |
| 275 | Ga0207691_10001989 | 3300025940 | Bacteria | 19992 |
| 276 | Ga0207691_10073977 | 3300025940 | Bacteria | 3073 |
| 277 | Ga0207691_10087487 | 3300025940 | Bacteria | 2795 |
| 278 | Ga0207691_10116592 | 3300025940 | Bacteria | 2370 |
| 279 | Ga0207691_10117069 | 3300025940 | Bacteria | 2364 |
| 280 | Ga0207691_10169471 | 3300025940 | Bacteria | 1912 |
| 281 | Ga0207711_10069075 | 3300025941 | Bacteria | 3062 |
| 282 | Ga0207711_10080416 | 3300025941 | Bacteria | 2846 |
| 283 | Ga0207711_10199811 | 3300025941 | Bacteria | 1824 |
| 284 | Ga0207689_10202023 | 3300025942 | Bacteria | 1641 |
| 285 | Ga0207679_10039206 | 3300025945 | Bacteria | 3381 |
| 286 | Ga0207651_10039603 | 3300025960 | Bacteria | 3109 |
| 287 | Ga0207651_10166578 | 3300025960 | Bacteria | 1733 |
| 288 | Ga0207712_10039928 | 3300025961 | Bacteria | 3218 |
| 289 | Ga0207712_10209542 | 3300025961 | Bacteria | 1551 |
| 290 | Ga0207668_10087022 | 3300025972 | Bacteria | 2284 |
| 291 | Ga0207640_10095994 | 3300025981 | Bacteria | 2066 |
| 292 | Ga0207640_10129773 | 3300025981 | Unclassified | 1820 |
| 293 | Ga0207658_10009779 | 3300025986 | Bacteria | 6512 |
| 294 | Ga0207703_10167518 | 3300026035 | Bacteria | 1929 |
| 295 | Ga0207678_10176437 | 3300026067 | Bacteria | 1824 |
| 296 | Ga0207708_10024277 | 3300026075 | Bacteria | 4585 |
| 297 | Ga0207641_10012265 | 3300026088 | Bacteria | 7031 |
| 298 | Ga0207641_10027269 | 3300026088 | Bacteria | 4718 |
| 299 | Ga0207648_10050298 | 3300026089 | Bacteria | 3645 |
| 300 | Ga0207648_10083861 | 3300026089 | Bacteria | 2779 |
| 301 | Ga0207648_10121130 | 3300026089 | Bacteria | 2300 |
| 302 | Ga0207648_10129061 | 3300026089 | Bacteria | 2225 |
| 303 | Ga0207676_10262061 | 3300026095 | Bacteria | 1561 |
| 304 | Ga0207674_10114349 | 3300026116 | Bacteria | 2671 |
| 305 | Ga0207675_100006507 | 3300026118 | Bacteria | 11054 |
| 306 | Ga0207675_100016861 | 3300026118 | Bacteria | 6823 |
| 307 | Ga0207675_100061744 | 3300026118 | Bacteria | 3498 |
| 308 | Ga0207683_10015791 | 3300026121 | Bacteria | 6427 |
| 309 | Ga0207683_10148321 | 3300026121 | Bacteria | 2116 |
| 310 | Ga0207698_10109295 | 3300026142 | Bacteria | 2313 |
| 311 | Ga0209974_10024511 | 3300027876 | Bacteria | 1997 |
| 312 | Ga0207428_10000097 | 3300027907 | Bacteria | 122738 |
| 313 | Ga0207428_10000875 | 3300027907 | Bacteria | 33839 |
| 314 | Ga0207428_10005438 | 3300027907 | Bacteria | 11878 |
| 315 | Ga0207428_10009561 | 3300027907 | Bacteria | 8685 |
| 316 | Ga0207428_10034419 | 3300027907 | Bacteria | 4151 |
| 317 | Ga0207428_10063333 | 3300027907 | Bacteria | 2922 |
| 318 | Ga0207428_10069258 | 3300027907 | Bacteria | 2774 |
| 319 | Ga0207428_10095509 | 3300027907 | Bacteria | 2303 |
| 320 | Ga0268265_10001821 | 3300028380 | Bacteria | 17037 |
| 321 | Ga0268265_10012315 | 3300028380 | Bacteria | 5795 |
| 322 | Ga0268265_10233825 | 3300028380 | Bacteria | 1617 |
| 323 | Ga0268265_10251413 | 3300028380 | Bacteria | 1566 |
| 324 | Ga0307408_100009085 | 3300031548 | Bacteria | 6558 |
| 325 | Ga0316575_10015729 | 3300031665 | Bacteria | 2854 |
| 326 | Ga0316579_10001252 | 3300031691 | Bacteria | 9129 |
| 327 | Ga0316579_10051681 | 3300031691 | Bacteria | 1924 |
| 328 | Ga0316576_10033347 | 3300031727 | Bacteria | 3665 |
| 329 | Ga0316578_10032189 | 3300031728 | Bacteria | 2993 |
| 330 | Ga0307413_10010037 | 3300031824 | Bacteria | 4566 |
| 331 | Ga0307413_10026806 | 3300031824 | Bacteria | 3182 |
| 332 | Ga0307410_10007724 | 3300031852 | Bacteria | 5905 |
| 333 | Ga0307410_10011659 | 3300031852 | Bacteria | 5039 |
| 334 | Ga0307410_10044084 | 3300031852 | Bacteria | 2960 |
| 335 | Ga0307406_10006604 | 3300031901 | Bacteria | 6411 |
| 336 | Ga0307406_10108867 | 3300031901 | Bacteria | 1903 |
| 337 | Ga0307407_10002792 | 3300031903 | Bacteria | 6963 |
| 338 | Ga0307407_10009270 | 3300031903 | Bacteria | 4574 |
| 339 | Ga0307412_10018539 | 3300031911 | Bacteria | 4191 |
| 340 | Ga0307416_100025849 | 3300032002 | Bacteria | 4314 |
| 341 | Ga0307416_100210795 | 3300032002 | Bacteria | 1853 |
| 342 | Ga0307411_10000942 | 3300032005 | Bacteria | 11112 |
| 343 | Ga0307411_10015235 | 3300032005 | Bacteria | 4312 |
| 344 | Ga0307411_10105554 | 3300032005 | Bacteria | 2003 |
| 345 | Ga0307415_100010716 | 3300032126 | Bacteria | 5206 |
| 346 | Ga0316583_10021189 | 3300032133 | Bacteria | 2330 |
| 347 | Ga0316585_10001762 | 3300032137 | Bacteria | 5771 |
| 348 | Ga0373939_0020376 | 3300035114 | Bacteria | 1801 |
| 349 | Ga0373941_0023541 | 3300035115 | Bacteria | 1759 |
| 350 | Ga0373945_0067816 | 3300035116 | Bacteria | 1344 |
| 351 | Ga0373943_0020373 | 3300035170 | Bacteria | 3056 |
| 352 | Ga0373924_0053418 | 3300035410 | Bacteria | 1678 |
| 353 | Ga0373935_0018073 | 3300035692 | Bacteria | 4286 |
| 354 | Ga0373947_0004675 | 3300035725 | Bacteria | 8024 |
| 355 | Ga0373947_0053799 | 3300035725 | Bacteria | 2428 |
| 356 | Ga0373937_0130147 | 3300036401 | Unclassified | 2350 |
| 357 | Ga0316582_0036333 | 3300036647 | Bacteria | 3048 |
| 358 | Ga0316584_0003893 | 3300036712 | Bacteria | 9798 |
| 359 | Ga0316581_0008357 | 3300037588 | Bacteria | 2814 |
| 360 | Ga0439446_0000937 | 3300042156 | Bacteria | 6300 |
| 361 | Ga0439460_0006001 | 3300042461 | Bacteria | 2997 |
| 362 | Ga0451577_0003216 | 3300042876 | Bacteria | 18350 |
| 363 | Ga0451576_0069300 | 3300045051 | Bacteria | 3670 |
| 364 | Ga0495603_0004665 | 3300046455 | Bacteria | 8192 |
| 365 | Ga0495603_0069935 | 3300046455 | Bacteria | 2064 |
| 366 | Ga0495629_0015733 | 3300046459 | Bacteria | 5431 |
| 367 | Ga0495629_0175090 | 3300046459 | Bacteria | 1488 |
| 368 | Ga0495582_0121583 | 3300046473 | Bacteria | 1471 |
| 369 | Ga0495594_0017750 | 3300046499 | Bacteria | 3763 |
| 370 | Ga0495594_0038523 | 3300046499 | Bacteria | 2611 |
| 371 | Ga0495608_0018395 | 3300046511 | Bacteria | 4820 |
| 372 | Ga0495628_0025274 | 3300046516 | Bacteria | 4852 |
| 373 | Ga0495586_0123034 | 3300046535 | Bacteria | 1450 |
| 374 | Ga0495621_0019729 | 3300046539 | Bacteria | 2204 |
| 375 | Ga0495645_0011900 | 3300046543 | Bacteria | 6129 |
| 376 | Ga0495667_0037720 | 3300046559 | Bacteria | 3220 |
| 377 | Ga0495634_0079702 | 3300046642 | Bacteria | 2144 |
| 378 | Ga0495659_0008259 | 3300046664 | Bacteria | 3312 |
| 379 | Ga0495588_0001065 | 3300046674 | Bacteria | 11902 |
| 380 | Ga0495599_0157454 | 3300046678 | Bacteria | 1405 |
| 381 | Ga0495669_0046036 | 3300046684 | Bacteria | 1946 |
| 382 | Ga0495613_0000507 | 3300046689 | Bacteria | 32852 |
| 383 | Ga0495670_0016529 | 3300046691 | Bacteria | 3628 |
| 384 | Ga0495676_0088119 | 3300047321 | Bacteria | 2329 |
| 385 | Ga0495684_0000188 | 3300047471 | Bacteria | 47553 |
| 386 | Ga0496101_0002514 | 3300048904 | Bacteria | 11257 |
| 387 | Ga0496101_0042185 | 3300048904 | Bacteria | 3257 |
| 388 | Ga0496102_0148613 | 3300048905 | Bacteria | 2200 |
| 389 | Ga0496104_0050545 | 3300048907 | Bacteria | 3922 |
| 390 | Ga0496105_0010592 | 3300048908 | Bacteria | 7254 |
| 391 | Ga0496106_0005072 | 3300048909 | Bacteria | 9752 |
| 392 | Ga0496107_0017189 | 3300048910 | Bacteria | 5088 |
| 393 | Ga0496114_0000462 | 3300048917 | Bacteria | 29857 |
| 394 | Ga0496114_0084051 | 3300048917 | Bacteria | 2694 |
| 395 | Ga0496114_0089212 | 3300048917 | Bacteria | 2616 |
| 396 | Ga0496114_0097564 | 3300048917 | Bacteria | 2504 |
| 397 | Ga0496115_0012918 | 3300048918 | Bacteria | 6297 |
| 398 | Ga0501036_0054268 | 3300049572 | Bacteria | 3394 |
| 399 | Ga0501038_0212472 | 3300049574 | Bacteria | 1547 |
| 400 | Ga0501040_0045262 | 3300049576 | Bacteria | 3001 |
| 401 | Ga0501040_0112156 | 3300049576 | Bacteria | 1907 |
| 402 | Ga0501041_0017174 | 3300049577 | Bacteria | 4305 |
| 403 | Ga0501041_0078355 | 3300049577 | Bacteria | 2034 |
| 404 | Ga0501042_0002543 | 3300049578 | Bacteria | 11218 |
| 405 | Ga0501042_0048289 | 3300049578 | Bacteria | 3035 |
| 406 | Ga0501046_0026443 | 3300049580 | Bacteria | 4740 |
| 407 | Ga0501046_0143884 | 3300049580 | Bacteria | 1802 |
| 408 | Ga0501048_0230475 | 3300049582 | Bacteria | 1314 |
| 409 | Ga0501067_0046085 | 3300049583 | Bacteria | 2420 |
| 410 | Ga0501071_0026618 | 3300049587 | Bacteria | 4061 |
| 411 | Ga0501071_0122504 | 3300049587 | Bacteria | 1928 |
| 412 | Ga0501072_0066879 | 3300049588 | Bacteria | 2835 |
| 413 | Ga0501072_0143775 | 3300049588 | Bacteria | 1902 |
| 414 | Ga0501073_0025396 | 3300049589 | Bacteria | 4249 |
| 415 | Ga0501074_0061366 | 3300049590 | Bacteria | 2708 |
| 416 | Ga0501075_0010573 | 3300049591 | Bacteria | 6489 |
| 417 | Ga0501075_0034715 | 3300049591 | Bacteria | 3757 |
| 418 | Ga0501075_0136469 | 3300049591 | Bacteria | 1869 |
| 419 | Ga0501076_0002161 | 3300049592 | Bacteria | 13479 |
| 420 | Ga0501076_0034974 | 3300049592 | Bacteria | 3930 |
| 421 | Ga0501076_0115916 | 3300049592 | Bacteria | 2168 |
| 422 | Ga0501077_0006581 | 3300049593 | Bacteria | 7133 |
| 423 | Ga0501079_0051504 | 3300049741 | Bacteria | 3179 |
| 424 | Ga0501080_0075815 | 3300049742 | Bacteria | 3128 |
| 425 | Ga0501080_0370561 | 3300049742 | Bacteria | 1291 |
| 426 | Ga0501081_0006435 | 3300049743 | Bacteria | 7621 |
| 427 | Ga0501081_0111798 | 3300049743 | Bacteria | 1939 |
| 428 | Ga0501083_0112654 | 3300049744 | Bacteria | 1788 |
| 429 | Ga0501045_0121347 | 3300049824 | Bacteria | 1941 |
| 430 | nmdc:mga03n38_65086_c1 | 3300050490 | Unclassified | 1670 |
| 431 | nmdc:mga00v17_8834_c1 | 3300050491 | Bacteria | 5432 |
| 432 | nmdc:mga0k408_2937_c1 | 3300050493 | Bacteria | 9036 |
| 433 | nmdc:mga06z11_32207_c1 | 3300050494 | Bacteria | 2555 |
| 434 | nmdc:mga07m45_2323_c1 | 3300050496 | Bacteria | 8910 |
| 435 | nmdc:mga05p37_114738_c1 | 3300050507 | Bacteria | 3311 |
| 436 | nmdc:mga05p37_11640_c1 | 3300050507 | Bacteria | 10484 |
| 437 | nmdc:mga05p37_120454_c1 | 3300050507 | Bacteria | 3224 |
| 438 | nmdc:mga05p37_15951_c1 | 3300050507 | Bacteria | 9036 |
| 439 | nmdc:mga05p37_207459_c1 | 3300050507 | Bacteria | 2370 |
| 440 | nmdc:mga05p37_22582_c1 | 3300050507 | Bacteria | 7629 |
| 441 | nmdc:mga05p37_25835_c1 | 3300050507 | Bacteria | 7140 |
| 442 | nmdc:mga05p37_259924_c1 | 3300050507 | Bacteria | 2078 |
| 443 | nmdc:mga05p37_32632_c1 | 3300050507 | Bacteria | 6369 |
| 444 | nmdc:mga05p37_48133_c1 | 3300050507 | Bacteria | 5244 |
| 445 | nmdc:mga05p37_645557_c1 | 3300050507 | Bacteria | 1186 |
| 446 | nmdc:mga05p37_66443_c1 | 3300050507 | Bacteria | 4436 |
| 447 | nmdc:mga05p37_69460_c1 | 3300050507 | Bacteria | 4333 |
| 448 | nmdc:mga09592_2024_c1 | 3300050508 | Bacteria | 16348 |
| 449 | nmdc:mga09592_260606_c1 | 3300050508 | Unclassified | 1503 |
| 450 | nmdc:mga09592_37096_c1 | 3300050508 | Bacteria | 4087 |
| 451 | nmdc:mga09592_52269_c1 | 3300050508 | Bacteria | 3449 |
| 452 | nmdc:mga0qj67_45220_c1 | 3300050509 | Bacteria | 3474 |
| 453 | nmdc:mga0qj67_7074_c1 | 3300050509 | Bacteria | 8276 |
| 454 | nmdc:mga0qj67_7534_c1 | 3300050509 | Bacteria | 8042 |
| 455 | nmdc:mga06r32_136646_c1 | 3300050510 | Bacteria | 2426 |
| 456 | nmdc:mga06r32_137323_c1 | 3300050510 | Bacteria | 2420 |
| 457 | nmdc:mga06r32_200620_c1 | 3300050510 | Bacteria | 1983 |
| 458 | nmdc:mga06r32_346427_c1 | 3300050510 | Bacteria | 1470 |
| 459 | nmdc:mga06r32_35683_c1 | 3300050510 | Bacteria | 4692 |
| 460 | nmdc:mga06r32_44524_c1 | 3300050510 | Bacteria | 4226 |
| 461 | nmdc:mga06r32_75208_c1 | 3300050510 | Bacteria | 3277 |
| 462 | nmdc:mga06r32_787_c1 | 3300050510 | Bacteria | 28062 |
| 463 | nmdc:mga08y16_10_c1 | 3300050511 | Bacteria | 470512 |
| 464 | nmdc:mga08y16_17955_c1 | 3300050511 | Bacteria | 7453 |
| 465 | nmdc:mga08y16_1884_c1 | 3300050511 | Bacteria | 21345 |
| 466 | nmdc:mga08y16_43599_c1 | 3300050511 | Bacteria | 4702 |
| 467 | nmdc:mga08y16_49148_c1 | 3300050511 | Bacteria | 4414 |
| 468 | nmdc:mga0n895_169382_c1 | 3300050512 | Bacteria | 2216 |
| 469 | nmdc:mga0n895_190_c1 | 3300050512 | Bacteria | 38063 |
| 470 | nmdc:mga0n895_3737_c1 | 3300050512 | Bacteria | 12317 |
| 471 | nmdc:mga0n895_380855_c1 | 3300050512 | Bacteria | 1428 |
| 472 | nmdc:mga0n895_3_c1 | 3300050512 | Bacteria | 134167 |
| 473 | nmdc:mga0n895_425275_c1 | 3300050512 | Bacteria | 1342 |
| 474 | nmdc:mga0n895_71956_c1 | 3300050512 | Bacteria | 3429 |
| 475 | nmdc:mga0n895_99494_c1 | 3300050512 | Bacteria | 2916 |
| 476 | nmdc:mga0rr50_31708_c1 | 3300050513 | Bacteria | 3758 |
| 477 | nmdc:mga0rr50_32041_c1 | 3300050513 | Bacteria | 3740 |
| 478 | nmdc:mga0rr50_39_c1 | 3300050513 | Bacteria | 84395 |
| 479 | nmdc:mga0rr50_86276_c1 | 3300050513 | Bacteria | 2435 |
| 480 | nmdc:mga0rr50_98986_c1 | 3300050513 | Bacteria | 2287 |
| 481 | nmdc:mga08x19_24715_c1 | 3300050514 | Bacteria | 3738 |
| 482 | nmdc:mga08x19_259_c1 | 3300050514 | Bacteria | 40273 |
| 483 | nmdc:mga08x19_40067_c1 | 3300050514 | Bacteria | 2981 |
| 484 | nmdc:mga0a205_12241_c1 | 3300050515 | Bacteria | 7933 |
| 485 | nmdc:mga0a205_123666_c1 | 3300050515 | Unclassified | 2487 |
| 486 | nmdc:mga0a205_574_c1 | 3300050515 | Bacteria | 29140 |
| 487 | nmdc:mga0a205_7422_c1 | 3300050515 | Bacteria | 9929 |
| 488 | nmdc:mga0a205_92539_c1 | 3300050515 | Bacteria | 2922 |
| 489 | Ga0495595_0025603 | 3300053084 | Bacteria | 2616 |
| 490 | Ga0495595_0026664 | 3300053084 | Bacteria | 2569 |
| 491 | Ga0495595_0073131 | 3300053084 | Unclassified | 1623 |
| 492 | Ga0495619_0026975 | 3300053085 | Bacteria | 3699 |
| 493 | Ga0501084_0012978 | 3300054114 | Bacteria | 6896 |
| 494 | Ga0501084_0262648 | 3300054114 | Bacteria | 1458 |
| 495 | Ga0590071_002764 | 3300059421 | Bacteria | 4398 |
| 496 | Ga0590074_007339 | 3300059423 | Bacteria | 1832 |
| 497 | Ga0590075_000589 | 3300059424 | Bacteria | 9783 |
| 498 | Ga0590077_000230 | 3300059426 | Bacteria | 16099 |
| 499 | Ga0590077_000651 | 3300059426 | Bacteria | 9255 |
| 500 | Ga0590077_004444 | 3300059426 | Bacteria | 2880 |
| 501 | Ga0501082_0006041 | 3300060353 | Bacteria | 10506 |
| 502 | Ga0501082_0035115 | 3300060353 | Bacteria | 4321 |
| 503 | Ga0530510_0044874 | 3300061734 | Bacteria | 3195 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046459 | Ga0495629_0015733 | Ga0495629_0015733_23_1048 | 329 |
| 2 | 3300025923 | Ga0207681_10024874 | Ga0207681_100248742 | 353 |
| 3 | 3300035116 | Ga0373945_0067816 | Ga0373945_0067816_35_1132 | 353 |
| 4 | 3300005471 | Ga0070698_100245804 | Ga0070698_1002458042 | 360 |
| 5 | 3300049582 | Ga0501048_0230475 | Ga0501048_0230475_122_1240 | 360 |
| 6 | 3300006178 | Ga0075367_10035000 | Ga0075367_100350002 | 365 |
| 7 | 3300005618 | Ga0068864_100374182 | Ga0068864_1003741822 | 367 |
| 8 | 3300026089 | Ga0207648_10129061 | Ga0207648_101290612 | 367 |
| 9 | 3300046678 | Ga0495599_0157454 | Ga0495599_0157454_49_1152 | 367 |
| 10 | 3300059426 | Ga0590077_000651 | Ga0590077_000651_412_1554 | 367 |
| 11 | 3300009147 | Ga0114129_10073957 | Ga0114129_100739572 | 368 |
| 12 | 3300050507 | nmdc:mga05p37_11640_c1 | nmdc:mga05p37_11640_c1_5487_6644 | 368 |
| 13 | 3300050512 | nmdc:mga0n895_71956_c1 | nmdc:mga0n895_71956_c1_1919_3076 | 368 |
| 14 | 3300009147 | Ga0114129_10143125 | Ga0114129_101431252 | 369 |
| 15 | 3300006914 | Ga0075436_100049594 | Ga0075436_1000495942 | 372 |
| 16 | 3300050507 | nmdc:mga05p37_48133_c1 | nmdc:mga05p37_48133_c1_1882_3003 | 372 |
| 17 | 3300005331 | Ga0070670_100010119 | Ga0070670_1000101198 | 373 |
| 18 | 3300005356 | Ga0070674_100145669 | Ga0070674_1001456692 | 373 |
| 19 | 3300005456 | Ga0070678_100062209 | Ga0070678_1000622093 | 373 |
| 20 | 3300005457 | Ga0070662_100265603 | Ga0070662_1002656032 | 373 |
| 21 | 3300005616 | Ga0068852_100179750 | Ga0068852_1001797502 | 373 |
| 22 | 3300005841 | Ga0068863_100069367 | Ga0068863_1000693672 | 373 |
| 23 | 3300006237 | Ga0097621_100018204 | Ga0097621_1000182045 | 373 |
| 24 | 3300006358 | Ga0068871_100021927 | Ga0068871_1000219274 | 373 |
| 25 | 3300006881 | Ga0068865_100178528 | Ga0068865_1001785282 | 373 |
| 26 | 3300009098 | Ga0105245_10050364 | Ga0105245_100503643 | 373 |
| 27 | 3300009174 | Ga0105241_10082917 | Ga0105241_100829172 | 373 |
| 28 | 3300009177 | Ga0105248_10229086 | Ga0105248_102290862 | 373 |
| 29 | 3300013296 | Ga0157374_10069207 | Ga0157374_100692073 | 373 |
| 30 | 3300013308 | Ga0157375_10085134 | Ga0157375_100851343 | 373 |
| 31 | 3300014325 | Ga0163163_10200620 | Ga0163163_102006202 | 373 |
| 32 | 3300025911 | Ga0207654_10071024 | Ga0207654_100710242 | 373 |
| 33 | 3300025915 | Ga0207693_10010342 | Ga0207693_100103423 | 373 |
| 34 | 3300025926 | Ga0207659_10313296 | Ga0207659_103132962 | 373 |
| 35 | 3300025933 | Ga0207706_10098423 | Ga0207706_100984232 | 373 |
| 36 | 3300025934 | Ga0207686_10079066 | Ga0207686_100790661 | 373 |
| 37 | 3300025941 | Ga0207711_10199811 | Ga0207711_101998112 | 373 |
| 38 | 3300026142 | Ga0207698_10109295 | Ga0207698_101092951 | 373 |
| 39 | 3300048908 | Ga0496105_0010592 | Ga0496105_0010592_5500_6657 | 373 |
| 40 | 3300048917 | Ga0496114_0084051 | Ga0496114_0084051_760_1917 | 373 |
| 41 | 3300048917 | Ga0496114_0089212 | Ga0496114_0089212_102_1259 | 373 |
| 42 | 3300048918 | Ga0496115_0012918 | Ga0496115_0012918_4798_5955 | 373 |
| 43 | 3300049572 | Ga0501036_0054268 | Ga0501036_0054268_1220_2395 | 373 |
| 44 | 3300049580 | Ga0501046_0143884 | Ga0501046_0143884_182_1408 | 373 |
| 45 | 3300049591 | Ga0501075_0136469 | Ga0501075_0136469_86_1306 | 373 |
| 46 | 3300049824 | Ga0501045_0121347 | Ga0501045_0121347_477_1703 | 373 |
| 47 | 3300060353 | Ga0501082_0006041 | Ga0501082_0006041_1057_2232 | 373 |
| 48 | 3300005295 | Ga0065707_10102905 | Ga0065707_101029052 | 374 |
| 49 | 3300005331 | Ga0070670_100252422 | Ga0070670_1002524221 | 374 |
| 50 | 3300005353 | Ga0070669_100065108 | Ga0070669_1000651085 | 374 |
| 51 | 3300005354 | Ga0070675_100046981 | Ga0070675_1000469811 | 374 |
| 52 | 3300005366 | Ga0070659_100222208 | Ga0070659_1002222081 | 374 |
| 53 | 3300005458 | Ga0070681_10045654 | Ga0070681_100456544 | 374 |
| 54 | 3300005518 | Ga0070699_100002083 | Ga0070699_10000208315 | 374 |
| 55 | 3300005543 | Ga0070672_100157579 | Ga0070672_1001575793 | 374 |
| 56 | 3300006042 | Ga0075368_10027585 | Ga0075368_100275852 | 374 |
| 57 | 3300006051 | Ga0075364_10004703 | Ga0075364_100047038 | 374 |
| 58 | 3300006178 | Ga0075367_10034360 | Ga0075367_100343603 | 374 |
| 59 | 3300006195 | Ga0075366_10057120 | Ga0075366_100571203 | 374 |
| 60 | 3300006353 | Ga0075370_10001417 | Ga0075370_100014173 | 374 |
| 61 | 3300006844 | Ga0075428_100034824 | Ga0075428_1000348243 | 374 |
| 62 | 3300006846 | Ga0075430_100003723 | Ga0075430_1000037233 | 374 |
| 63 | 3300006847 | Ga0075431_100004143 | Ga0075431_1000041438 | 374 |
| 64 | 3300006852 | Ga0075433_10039086 | Ga0075433_100390864 | 374 |
| 65 | 3300006914 | Ga0075436_100013462 | Ga0075436_1000134624 | 374 |
| 66 | 3300007076 | Ga0075435_100174019 | Ga0075435_1001740192 | 374 |
| 67 | 3300009147 | Ga0114129_10006755 | Ga0114129_100067557 | 374 |
| 68 | 3300011119 | Ga0105246_10274343 | Ga0105246_102743431 | 374 |
| 69 | 3300025940 | Ga0207691_10116592 | Ga0207691_101165924 | 374 |
| 70 | 3300026067 | Ga0207678_10176437 | Ga0207678_101764372 | 374 |
| 71 | 3300031548 | Ga0307408_100009085 | Ga0307408_1000090854 | 374 |
| 72 | 3300031824 | Ga0307413_10010037 | Ga0307413_100100373 | 374 |
| 73 | 3300031824 | Ga0307413_10026806 | Ga0307413_100268064 | 374 |
| 74 | 3300031852 | Ga0307410_10007724 | Ga0307410_100077244 | 374 |
| 75 | 3300031852 | Ga0307410_10011659 | Ga0307410_100116595 | 374 |
| 76 | 3300031852 | Ga0307410_10044084 | Ga0307410_100440842 | 374 |
| 77 | 3300031901 | Ga0307406_10006604 | Ga0307406_100066046 | 374 |
| 78 | 3300031901 | Ga0307406_10108867 | Ga0307406_101088673 | 374 |
| 79 | 3300031903 | Ga0307407_10002792 | Ga0307407_100027925 | 374 |
| 80 | 3300031903 | Ga0307407_10009270 | Ga0307407_100092702 | 374 |
| 81 | 3300031911 | Ga0307412_10018539 | Ga0307412_100185393 | 374 |
| 82 | 3300032002 | Ga0307416_100025849 | Ga0307416_1000258492 | 374 |
| 83 | 3300032002 | Ga0307416_100210795 | Ga0307416_1002107952 | 374 |
| 84 | 3300032005 | Ga0307411_10000942 | Ga0307411_100009429 | 374 |
| 85 | 3300032005 | Ga0307411_10015235 | Ga0307411_100152354 | 374 |
| 86 | 3300032005 | Ga0307411_10105554 | Ga0307411_101055541 | 374 |
| 87 | 3300032126 | Ga0307415_100010716 | Ga0307415_1000107164 | 374 |
| 88 | 3300035114 | Ga0373939_0020376 | Ga0373939_0020376_345_1508 | 374 |
| 89 | 3300035725 | Ga0373947_0004675 | Ga0373947_0004675_2532_3704 | 374 |
| 90 | 3300046455 | Ga0495603_0004665 | Ga0495603_0004665_550_1719 | 374 |
| 91 | 3300046499 | Ga0495594_0038523 | Ga0495594_0038523_213_1382 | 374 |
| 92 | 3300047321 | Ga0495676_0088119 | Ga0495676_0088119_662_1831 | 374 |
| 93 | 3300049576 | Ga0501040_0045262 | Ga0501040_0045262_1164_2372 | 374 |
| 94 | 3300049587 | Ga0501071_0122504 | Ga0501071_0122504_683_1891 | 374 |
| 95 | 3300049588 | Ga0501072_0143775 | Ga0501072_0143775_268_1476 | 374 |
| 96 | 3300049590 | Ga0501074_0061366 | Ga0501074_0061366_1318_2526 | 374 |
| 97 | 3300049593 | Ga0501077_0006581 | Ga0501077_0006581_5222_6430 | 374 |
| 98 | 3300049741 | Ga0501079_0051504 | Ga0501079_0051504_101_1309 | 374 |
| 99 | 3300049742 | Ga0501080_0075815 | Ga0501080_0075815_74_1282 | 374 |
| 100 | 3300049743 | Ga0501081_0111798 | Ga0501081_0111798_11_1219 | 374 |
| 101 | 3300049744 | Ga0501083_0112654 | Ga0501083_0112654_343_1551 | 374 |
| 102 | 3300050490 | nmdc:mga03n38_65086_c1 | nmdc:mga03n38_65086_c1_264_1439 | 374 |
| 103 | 3300050491 | nmdc:mga00v17_8834_c1 | nmdc:mga00v17_8834_c1_215_1390 | 374 |
| 104 | 3300050493 | nmdc:mga0k408_2937_c1 | nmdc:mga0k408_2937_c1_3960_5132 | 374 |
| 105 | 3300050494 | nmdc:mga06z11_32207_c1 | nmdc:mga06z11_32207_c1_952_2127 | 374 |
| 106 | 3300050496 | nmdc:mga07m45_2323_c1 | nmdc:mga07m45_2323_c1_3856_5031 | 374 |
| 107 | 3300050507 | nmdc:mga05p37_66443_c1 | nmdc:mga05p37_66443_c1_2680_3879 | 374 |
| 108 | 3300050509 | nmdc:mga0qj67_45220_c1 | nmdc:mga0qj67_45220_c1_2087_3286 | 374 |
| 109 | 3300050510 | nmdc:mga06r32_200620_c1 | nmdc:mga06r32_200620_c1_656_1855 | 374 |
| 110 | 3300050514 | nmdc:mga08x19_24715_c1 | nmdc:mga08x19_24715_c1_1509_2684 | 374 |
| 111 | 3300050514 | nmdc:mga08x19_40067_c1 | nmdc:mga08x19_40067_c1_420_1580 | 374 |
| 112 | 3300050515 | nmdc:mga0a205_123666_c1 | nmdc:mga0a205_123666_c1_1081_2277 | 374 |
| 113 | 3300054114 | Ga0501084_0012978 | Ga0501084_0012978_1612_2820 | 374 |
| 114 | 3300059421 | Ga0590071_002764 | Ga0590071_002764_1317_2555 | 374 |
| 115 | 3300059423 | Ga0590074_007339 | Ga0590074_007339_316_1554 | 374 |
| 116 | 3300059424 | Ga0590075_000589 | Ga0590075_000589_8184_9380 | 374 |
| 117 | 3300059426 | Ga0590077_000230 | Ga0590077_000230_1951_3147 | 374 |
| 118 | 3300059426 | Ga0590077_004444 | Ga0590077_004444_1471_2652 | 374 |
| 119 | 3300061734 | Ga0530510_0044874 | Ga0530510_0044874_265_1473 | 374 |
| 120 | 3300009148 | Ga0105243_10052628 | Ga0105243_100526283 | 375 |
| 121 | 3300009553 | Ga0105249_10007708 | Ga0105249_100077088 | 375 |
| 122 | 3300017792 | Ga0163161_10009615 | Ga0163161_100096156 | 375 |
| 123 | 3300025942 | Ga0207689_10202023 | Ga0207689_102020231 | 375 |
| 124 | 3300048904 | Ga0496101_0042185 | Ga0496101_0042185_128_1285 | 375 |
| 125 | 3300048910 | Ga0496107_0017189 | Ga0496107_0017189_3181_4338 | 375 |
| 126 | 3300049583 | Ga0501067_0046085 | Ga0501067_0046085_1161_2318 | 375 |
| 127 | 3300005295 | Ga0065707_10000940 | Ga0065707_1000094010 | 376 |
| 128 | 3300005354 | Ga0070675_100266695 | Ga0070675_1002666951 | 376 |
| 129 | 3300005440 | Ga0070705_100024343 | Ga0070705_1000243432 | 376 |
| 130 | 3300005518 | Ga0070699_100009224 | Ga0070699_1000092244 | 376 |
| 131 | 3300005546 | Ga0070696_100001063 | Ga0070696_10000106312 | 376 |
| 132 | 3300005844 | Ga0068862_100088601 | Ga0068862_1000886014 | 376 |
| 133 | 3300014326 | Ga0157380_10021759 | Ga0157380_100217596 | 376 |
| 134 | 3300025926 | Ga0207659_10091910 | Ga0207659_100919103 | 376 |
| 135 | 3300028380 | Ga0268265_10233825 | Ga0268265_102338252 | 376 |
| 136 | 3300031665 | Ga0316575_10015729 | Ga0316575_100157291 | 376 |
| 137 | 3300031691 | Ga0316579_10001252 | Ga0316579_100012523 | 376 |
| 138 | 3300031691 | Ga0316579_10051681 | Ga0316579_100516812 | 376 |
| 139 | 3300031728 | Ga0316578_10032189 | Ga0316578_100321893 | 376 |
| 140 | 3300032133 | Ga0316583_10021189 | Ga0316583_100211893 | 376 |
| 141 | 3300032137 | Ga0316585_10001762 | Ga0316585_100017627 | 376 |
| 142 | 3300036401 | Ga0373937_0130147 | Ga0373937_0130147_303_1460 | 376 |
| 143 | 3300036647 | Ga0316582_0036333 | Ga0316582_0036333_477_1634 | 376 |
| 144 | 3300036712 | Ga0316584_0003893 | Ga0316584_0003893_3835_4992 | 376 |
| 145 | 3300037588 | Ga0316581_0008357 | Ga0316581_0008357_283_1440 | 376 |
| 146 | 3300046642 | Ga0495634_0079702 | Ga0495634_0079702_873_2036 | 376 |
| 147 | 3300046664 | Ga0495659_0008259 | Ga0495659_0008259_418_1590 | 376 |
| 148 | 3300046691 | Ga0495670_0016529 | Ga0495670_0016529_658_1830 | 376 |
| 149 | 3300049577 | Ga0501041_0078355 | Ga0501041_0078355_355_1512 | 376 |
| 150 | 3300053084 | Ga0495595_0025603 | Ga0495595_0025603_384_1541 | 376 |
| 151 | 3300026088 | Ga0207641_10027269 | Ga0207641_100272693 | 377 |
| 152 | 3300045051 | Ga0451576_0069300 | Ga0451576_0069300_387_1559 | 377 |
| 153 | 3300046455 | Ga0495603_0069935 | Ga0495603_0069935_579_1751 | 377 |
| 154 | 3300046473 | Ga0495582_0121583 | Ga0495582_0121583_140_1312 | 377 |
| 155 | 3300046499 | Ga0495594_0017750 | Ga0495594_0017750_2128_3300 | 377 |
| 156 | 3300046674 | Ga0495588_0001065 | Ga0495588_0001065_9360_10532 | 377 |
| 157 | 3300050512 | nmdc:mga0n895_99494_c1 | nmdc:mga0n895_99494_c1_1264_2400 | 377 |
| 158 | 3300013306 | Ga0163162_10150303 | Ga0163162_101503032 | 378 |
| 159 | 3300005444 | Ga0070694_100007521 | Ga0070694_1000075214 | 379 |
| 160 | 3300005545 | Ga0070695_100005004 | Ga0070695_1000050047 | 379 |
| 161 | 3300005549 | Ga0070704_100003499 | Ga0070704_1000034994 | 379 |
| 162 | 3300006852 | Ga0075433_10073551 | Ga0075433_100735512 | 379 |
| 163 | 3300006852 | Ga0075433_10185334 | Ga0075433_101853341 | 379 |
| 164 | 3300007076 | Ga0075435_100002436 | Ga0075435_1000024366 | 379 |
| 165 | 3300009094 | Ga0111539_10273970 | Ga0111539_102739702 | 379 |
| 166 | 3300009147 | Ga0114129_10057692 | Ga0114129_100576922 | 379 |
| 167 | 3300025922 | Ga0207646_10070677 | Ga0207646_100706772 | 379 |
| 168 | 3300050507 | nmdc:mga05p37_207459_c1 | nmdc:mga05p37_207459_c1_29_1186 | 379 |
| 169 | 3300050513 | nmdc:mga0rr50_86276_c1 | nmdc:mga0rr50_86276_c1_714_1922 | 379 |
| 170 | 3300050515 | nmdc:mga0a205_92539_c1 | nmdc:mga0a205_92539_c1_1323_2486 | 379 |
| 171 | 3300009094 | Ga0111539_10086094 | Ga0111539_100860941 | 380 |
| 172 | 3300027907 | Ga0207428_10069258 | Ga0207428_100692583 | 380 |
| 173 | 3300050511 | nmdc:mga08y16_49148_c1 | nmdc:mga08y16_49148_c1_2905_4065 | 380 |
| 174 | 3300005328 | Ga0070676_10023318 | Ga0070676_100233182 | 384 |
| 175 | 3300005341 | Ga0070691_10012290 | Ga0070691_100122904 | 384 |
| 176 | 3300005345 | Ga0070692_10072408 | Ga0070692_100724082 | 384 |
| 177 | 3300005353 | Ga0070669_100041108 | Ga0070669_1000411084 | 384 |
| 178 | 3300005364 | Ga0070673_100176434 | Ga0070673_1001764341 | 384 |
| 179 | 3300005438 | Ga0070701_10072207 | Ga0070701_100722072 | 384 |
| 180 | 3300005440 | Ga0070705_100008580 | Ga0070705_1000085804 | 384 |
| 181 | 3300005441 | Ga0070700_100015456 | Ga0070700_1000154564 | 384 |
| 182 | 3300005444 | Ga0070694_100041096 | Ga0070694_1000410964 | 384 |
| 183 | 3300005459 | Ga0068867_100106501 | Ga0068867_1001065013 | 384 |
| 184 | 3300005545 | Ga0070695_100009117 | Ga0070695_1000091174 | 384 |
| 185 | 3300005546 | Ga0070696_100003538 | Ga0070696_1000035384 | 384 |
| 186 | 3300005549 | Ga0070704_100005169 | Ga0070704_1000051691 | 384 |
| 187 | 3300005615 | Ga0070702_100018066 | Ga0070702_1000180664 | 384 |
| 188 | 3300005719 | Ga0068861_100026065 | Ga0068861_1000260654 | 384 |
| 189 | 3300025907 | Ga0207645_10004842 | Ga0207645_100048428 | 384 |
| 190 | 3300025935 | Ga0207709_10050540 | Ga0207709_100505402 | 384 |
| 191 | 3300025960 | Ga0207651_10166578 | Ga0207651_101665782 | 384 |
| 192 | 3300026075 | Ga0207708_10024277 | Ga0207708_100242774 | 384 |
| 193 | 3300026118 | Ga0207675_100006507 | Ga0207675_10000650712 | 384 |
| 194 | 3300031727 | Ga0316576_10033347 | Ga0316576_100333472 | 384 |
| 195 | 3300005340 | Ga0070689_100107827 | Ga0070689_1001078271 | 385 |
| 196 | 3300005364 | Ga0070673_100118261 | Ga0070673_1001182611 | 385 |
| 197 | 3300005543 | Ga0070672_100002470 | Ga0070672_1000024708 | 385 |
| 198 | 3300005842 | Ga0068858_100168676 | Ga0068858_1001686762 | 385 |
| 199 | 3300005843 | Ga0068860_100092090 | Ga0068860_1000920902 | 385 |
| 200 | 3300006237 | Ga0097621_100003586 | Ga0097621_1000035866 | 385 |
| 201 | 3300006237 | Ga0097621_100148086 | Ga0097621_1001480862 | 385 |
| 202 | 3300006358 | Ga0068871_100002245 | Ga0068871_1000022456 | 385 |
| 203 | 3300006846 | Ga0075430_100050224 | Ga0075430_1000502244 | 385 |
| 204 | 3300006846 | Ga0075430_100056910 | Ga0075430_1000569102 | 385 |
| 205 | 3300006852 | Ga0075433_10023238 | Ga0075433_100232385 | 385 |
| 206 | 3300006871 | Ga0075434_100065316 | Ga0075434_1000653161 | 385 |
| 207 | 3300006931 | Ga0097620_100205905 | Ga0097620_1002059051 | 385 |
| 208 | 3300009094 | Ga0111539_10034682 | Ga0111539_100346821 | 385 |
| 209 | 3300009147 | Ga0114129_10007379 | Ga0114129_100073794 | 385 |
| 210 | 3300009177 | Ga0105248_10004554 | Ga0105248_100045542 | 385 |
| 211 | 3300013308 | Ga0157375_10223032 | Ga0157375_102230321 | 385 |
| 212 | 3300014968 | Ga0157379_10008023 | Ga0157379_100080237 | 385 |
| 213 | 3300014969 | Ga0157376_10069214 | Ga0157376_100692142 | 385 |
| 214 | 3300025923 | Ga0207681_10069859 | Ga0207681_100698593 | 385 |
| 215 | 3300025936 | Ga0207670_10067878 | Ga0207670_100678781 | 385 |
| 216 | 3300025940 | Ga0207691_10001989 | Ga0207691_1000198916 | 385 |
| 217 | 3300025941 | Ga0207711_10069075 | Ga0207711_100690755 | 385 |
| 218 | 3300025960 | Ga0207651_10039603 | Ga0207651_100396031 | 385 |
| 219 | 3300025986 | Ga0207658_10009779 | Ga0207658_100097797 | 385 |
| 220 | 3300026035 | Ga0207703_10167518 | Ga0207703_101675182 | 385 |
| 221 | 3300026088 | Ga0207641_10012265 | Ga0207641_100122655 | 385 |
| 222 | 3300027907 | Ga0207428_10095509 | Ga0207428_100955092 | 385 |
| 223 | 3300028380 | Ga0268265_10001821 | Ga0268265_100018217 | 385 |
| 224 | 3300042156 | Ga0439446_0000937 | Ga0439446_0000937_5041_6228 | 385 |
| 225 | 3300048917 | Ga0496114_0097564 | Ga0496114_0097564_1336_2493 | 385 |
| 226 | 3300049577 | Ga0501041_0017174 | Ga0501041_0017174_379_1629 | 385 |
| 227 | 3300049578 | Ga0501042_0002543 | Ga0501042_0002543_8875_10125 | 385 |
| 228 | 3300049580 | Ga0501046_0026443 | Ga0501046_0026443_3346_4596 | 385 |
| 229 | 3300049591 | Ga0501075_0010573 | Ga0501075_0010573_2408_3658 | 385 |
| 230 | 3300049592 | Ga0501076_0002161 | Ga0501076_0002161_3921_5171 | 385 |
| 231 | 3300049592 | Ga0501076_0115916 | Ga0501076_0115916_988_2148 | 385 |
| 232 | 3300049743 | Ga0501081_0006435 | Ga0501081_0006435_1076_2326 | 385 |
| 233 | 3300050507 | nmdc:mga05p37_120454_c1 | nmdc:mga05p37_120454_c1_27_1190 | 385 |
| 234 | 3300050507 | nmdc:mga05p37_15951_c1 | nmdc:mga05p37_15951_c1_169_1329 | 385 |
| 235 | 3300050507 | nmdc:mga05p37_69460_c1 | nmdc:mga05p37_69460_c1_1342_2505 | 385 |
| 236 | 3300050509 | nmdc:mga0qj67_7534_c1 | nmdc:mga0qj67_7534_c1_176_1342 | 385 |
| 237 | 3300050510 | nmdc:mga06r32_136646_c1 | nmdc:mga06r32_136646_c1_851_2017 | 385 |
| 238 | 3300050510 | nmdc:mga06r32_137323_c1 | nmdc:mga06r32_137323_c1_176_1342 | 385 |
| 239 | 3300050510 | nmdc:mga06r32_75208_c1 | nmdc:mga06r32_75208_c1_1873_3039 | 385 |
| 240 | 3300050512 | nmdc:mga0n895_169382_c1 | nmdc:mga0n895_169382_c1_778_1935 | 385 |
| 241 | 3300050513 | nmdc:mga0rr50_98986_c1 | nmdc:mga0rr50_98986_c1_810_1967 | 385 |
| 242 | 3300054114 | Ga0501084_0262648 | Ga0501084_0262648_63_1313 | 385 |
| 243 | 3300060353 | Ga0501082_0035115 | Ga0501082_0035115_130_1380 | 385 |
| 244 | 3300005293 | Ga0065715_10105614 | Ga0065715_101056142 | 386 |
| 245 | 3300005293 | Ga0065715_10111154 | Ga0065715_101111542 | 386 |
| 246 | 3300005295 | Ga0065707_10139908 | Ga0065707_101399082 | 386 |
| 247 | 3300005328 | Ga0070676_10061447 | Ga0070676_100614473 | 386 |
| 248 | 3300005328 | Ga0070676_10116194 | Ga0070676_101161942 | 386 |
| 249 | 3300005330 | Ga0070690_100208304 | Ga0070690_1002083041 | 386 |
| 250 | 3300005331 | Ga0070670_100066555 | Ga0070670_1000665552 | 386 |
| 251 | 3300005331 | Ga0070670_100132935 | Ga0070670_1001329352 | 386 |
| 252 | 3300005333 | Ga0070677_10001586 | Ga0070677_100015868 | 386 |
| 253 | 3300005333 | Ga0070677_10048460 | Ga0070677_100484602 | 386 |
| 254 | 3300005335 | Ga0070666_10008495 | Ga0070666_100084954 | 386 |
| 255 | 3300005335 | Ga0070666_10064521 | Ga0070666_100645212 | 386 |
| 256 | 3300005340 | Ga0070689_100177702 | Ga0070689_1001777022 | 386 |
| 257 | 3300005345 | Ga0070692_10065194 | Ga0070692_100651942 | 386 |
| 258 | 3300005347 | Ga0070668_100005585 | Ga0070668_1000055857 | 386 |
| 259 | 3300005347 | Ga0070668_100109579 | Ga0070668_1001095792 | 386 |
| 260 | 3300005353 | Ga0070669_100007749 | Ga0070669_1000077498 | 386 |
| 261 | 3300005353 | Ga0070669_100011782 | Ga0070669_1000117825 | 386 |
| 262 | 3300005353 | Ga0070669_100040904 | Ga0070669_1000409044 | 386 |
| 263 | 3300005354 | Ga0070675_100011700 | Ga0070675_1000117006 | 386 |
| 264 | 3300005354 | Ga0070675_100060240 | Ga0070675_1000602402 | 386 |
| 265 | 3300005354 | Ga0070675_100106181 | Ga0070675_1001061813 | 386 |
| 266 | 3300005354 | Ga0070675_100277916 | Ga0070675_1002779161 | 386 |
| 267 | 3300005356 | Ga0070674_100000794 | Ga0070674_10000079410 | 386 |
| 268 | 3300005356 | Ga0070674_100044638 | Ga0070674_1000446381 | 386 |
| 269 | 3300005364 | Ga0070673_100244586 | Ga0070673_1002445861 | 386 |
| 270 | 3300005365 | Ga0070688_100077711 | Ga0070688_1000777112 | 386 |
| 271 | 3300005366 | Ga0070659_100075393 | Ga0070659_1000753933 | 386 |
| 272 | 3300005434 | Ga0070709_10003094 | Ga0070709_100030947 | 386 |
| 273 | 3300005436 | Ga0070713_100009479 | Ga0070713_1000094794 | 386 |
| 274 | 3300005437 | Ga0070710_10202509 | Ga0070710_102025091 | 386 |
| 275 | 3300005438 | Ga0070701_10084218 | Ga0070701_100842181 | 386 |
| 276 | 3300005438 | Ga0070701_10084553 | Ga0070701_100845531 | 386 |
| 277 | 3300005441 | Ga0070700_100042898 | Ga0070700_1000428983 | 386 |
| 278 | 3300005441 | Ga0070700_100079812 | Ga0070700_1000798121 | 386 |
| 279 | 3300005456 | Ga0070678_100273346 | Ga0070678_1002733461 | 386 |
| 280 | 3300005457 | Ga0070662_100035122 | Ga0070662_1000351223 | 386 |
| 281 | 3300005457 | Ga0070662_100124349 | Ga0070662_1001243492 | 386 |
| 282 | 3300005459 | Ga0068867_100102005 | Ga0068867_1001020052 | 386 |
| 283 | 3300005459 | Ga0068867_100107910 | Ga0068867_1001079102 | 386 |
| 284 | 3300005459 | Ga0068867_100121223 | Ga0068867_1001212232 | 386 |
| 285 | 3300005466 | Ga0070685_10055057 | Ga0070685_100550573 | 386 |
| 286 | 3300005471 | Ga0070698_100078161 | Ga0070698_1000781612 | 386 |
| 287 | 3300005471 | Ga0070698_100227465 | Ga0070698_1002274652 | 386 |
| 288 | 3300005543 | Ga0070672_100054878 | Ga0070672_1000548782 | 386 |
| 289 | 3300005543 | Ga0070672_100126723 | Ga0070672_1001267232 | 386 |
| 290 | 3300005543 | Ga0070672_100142238 | Ga0070672_1001422381 | 386 |
| 291 | 3300005544 | Ga0070686_100000485 | Ga0070686_10000048518 | 386 |
| 292 | 3300005545 | Ga0070695_100120935 | Ga0070695_1001209352 | 386 |
| 293 | 3300005549 | Ga0070704_100186946 | Ga0070704_1001869461 | 386 |
| 294 | 3300005564 | Ga0070664_100025325 | Ga0070664_1000253253 | 386 |
| 295 | 3300005564 | Ga0070664_100032556 | Ga0070664_1000325565 | 386 |
| 296 | 3300005577 | Ga0068857_100027496 | Ga0068857_1000274966 | 386 |
| 297 | 3300005617 | Ga0068859_100155569 | Ga0068859_1001555692 | 386 |
| 298 | 3300005618 | Ga0068864_100032067 | Ga0068864_1000320675 | 386 |
| 299 | 3300005618 | Ga0068864_100130547 | Ga0068864_1001305472 | 386 |
| 300 | 3300005718 | Ga0068866_10053865 | Ga0068866_100538651 | 386 |
| 301 | 3300005719 | Ga0068861_100011238 | Ga0068861_1000112383 | 386 |
| 302 | 3300005840 | Ga0068870_10004599 | Ga0068870_100045996 | 386 |
| 303 | 3300005840 | Ga0068870_10011464 | Ga0068870_100114643 | 386 |
| 304 | 3300005840 | Ga0068870_10012755 | Ga0068870_100127554 | 386 |
| 305 | 3300005842 | Ga0068858_100066707 | Ga0068858_1000667072 | 386 |
| 306 | 3300005843 | Ga0068860_100298257 | Ga0068860_1002982572 | 386 |
| 307 | 3300005844 | Ga0068862_100059657 | Ga0068862_1000596573 | 386 |
| 308 | 3300005844 | Ga0068862_100067405 | Ga0068862_1000674054 | 386 |
| 309 | 3300005844 | Ga0068862_100244003 | Ga0068862_1002440032 | 386 |
| 310 | 3300006163 | Ga0070715_10021164 | Ga0070715_100211643 | 386 |
| 311 | 3300006237 | Ga0097621_100042035 | Ga0097621_1000420354 | 386 |
| 312 | 3300006358 | Ga0068871_100006871 | Ga0068871_1000068716 | 386 |
| 313 | 3300006358 | Ga0068871_100028426 | Ga0068871_1000284262 | 386 |
| 314 | 3300006844 | Ga0075428_100000076 | Ga0075428_1000000765 | 386 |
| 315 | 3300006844 | Ga0075428_100001245 | Ga0075428_10000124510 | 386 |
| 316 | 3300006844 | Ga0075428_100014752 | Ga0075428_1000147522 | 386 |
| 317 | 3300006846 | Ga0075430_100009469 | Ga0075430_1000094692 | 386 |
| 318 | 3300006847 | Ga0075431_100000835 | Ga0075431_1000008352 | 386 |
| 319 | 3300006847 | Ga0075431_100043337 | Ga0075431_1000433375 | 386 |
| 320 | 3300006852 | Ga0075433_10000646 | Ga0075433_100006463 | 386 |
| 321 | 3300006852 | Ga0075433_10001990 | Ga0075433_1000199011 | 386 |
| 322 | 3300006852 | Ga0075433_10017074 | Ga0075433_100170745 | 386 |
| 323 | 3300006852 | Ga0075433_10236587 | Ga0075433_102365871 | 386 |
| 324 | 3300006871 | Ga0075434_100001211 | Ga0075434_1000012118 | 386 |
| 325 | 3300006871 | Ga0075434_100005345 | Ga0075434_10000534510 | 386 |
| 326 | 3300006871 | Ga0075434_100017157 | Ga0075434_1000171572 | 386 |
| 327 | 3300006871 | Ga0075434_100042891 | Ga0075434_1000428913 | 386 |
| 328 | 3300006871 | Ga0075434_100112754 | Ga0075434_1001127542 | 386 |
| 329 | 3300006880 | Ga0075429_100021537 | Ga0075429_1000215373 | 386 |
| 330 | 3300006880 | Ga0075429_100027990 | Ga0075429_1000279905 | 386 |
| 331 | 3300006881 | Ga0068865_100024864 | Ga0068865_1000248642 | 386 |
| 332 | 3300006914 | Ga0075436_100000182 | Ga0075436_10000018224 | 386 |
| 333 | 3300006914 | Ga0075436_100021404 | Ga0075436_1000214043 | 386 |
| 334 | 3300006931 | Ga0097620_100155561 | Ga0097620_1001555612 | 386 |
| 335 | 3300007076 | Ga0075435_100000027 | Ga0075435_10000002751 | 386 |
| 336 | 3300007076 | Ga0075435_100036734 | Ga0075435_1000367343 | 386 |
| 337 | 3300007076 | Ga0075435_100040424 | Ga0075435_1000404244 | 386 |
| 338 | 3300007076 | Ga0075435_100072687 | Ga0075435_1000726873 | 386 |
| 339 | 3300007076 | Ga0075435_100092534 | Ga0075435_1000925343 | 386 |
| 340 | 3300007076 | Ga0075435_100158150 | Ga0075435_1001581502 | 386 |
| 341 | 3300009093 | Ga0105240_10128093 | Ga0105240_101280933 | 386 |
| 342 | 3300009094 | Ga0111539_10000010 | Ga0111539_10000010270 | 386 |
| 343 | 3300009094 | Ga0111539_10000112 | Ga0111539_1000011239 | 386 |
| 344 | 3300009094 | Ga0111539_10004375 | Ga0111539_1000437518 | 386 |
| 345 | 3300009094 | Ga0111539_10028232 | Ga0111539_100282326 | 386 |
| 346 | 3300009094 | Ga0111539_10050352 | Ga0111539_100503522 | 386 |
| 347 | 3300009094 | Ga0111539_10362305 | Ga0111539_103623052 | 386 |
| 348 | 3300009098 | Ga0105245_10034466 | Ga0105245_100344665 | 386 |
| 349 | 3300009147 | Ga0114129_10005683 | Ga0114129_100056832 | 386 |
| 350 | 3300009147 | Ga0114129_10011275 | Ga0114129_1001127516 | 386 |
| 351 | 3300009147 | Ga0114129_10016432 | Ga0114129_100164326 | 386 |
| 352 | 3300009147 | Ga0114129_10130592 | Ga0114129_101305923 | 386 |
| 353 | 3300009147 | Ga0114129_10183047 | Ga0114129_101830472 | 386 |
| 354 | 3300009147 | Ga0114129_10251250 | Ga0114129_102512502 | 386 |
| 355 | 3300009147 | Ga0114129_10257736 | Ga0114129_102577362 | 386 |
| 356 | 3300009147 | Ga0114129_10641564 | Ga0114129_106415641 | 386 |
| 357 | 3300009148 | Ga0105243_10041101 | Ga0105243_100411013 | 386 |
| 358 | 3300009148 | Ga0105243_10098001 | Ga0105243_100980013 | 386 |
| 359 | 3300009148 | Ga0105243_10147048 | Ga0105243_101470482 | 386 |
| 360 | 3300009176 | Ga0105242_10256404 | Ga0105242_102564042 | 386 |
| 361 | 3300009177 | Ga0105248_10101870 | Ga0105248_101018703 | 386 |
| 362 | 3300009553 | Ga0105249_10000263 | Ga0105249_1000026345 | 386 |
| 363 | 3300009553 | Ga0105249_10024991 | Ga0105249_100249914 | 386 |
| 364 | 3300009553 | Ga0105249_10064325 | Ga0105249_100643252 | 386 |
| 365 | 3300011119 | Ga0105246_10144730 | Ga0105246_101447302 | 386 |
| 366 | 3300013306 | Ga0163162_10050128 | Ga0163162_100501283 | 386 |
| 367 | 3300013306 | Ga0163162_10056073 | Ga0163162_100560734 | 386 |
| 368 | 3300013308 | Ga0157375_10230982 | Ga0157375_102309822 | 386 |
| 369 | 3300013308 | Ga0157375_10245319 | Ga0157375_102453192 | 386 |
| 370 | 3300014325 | Ga0163163_10180598 | Ga0163163_101805982 | 386 |
| 371 | 3300014326 | Ga0157380_10007713 | Ga0157380_100077133 | 386 |
| 372 | 3300014326 | Ga0157380_10036205 | Ga0157380_100362052 | 386 |
| 373 | 3300014326 | Ga0157380_10047815 | Ga0157380_100478154 | 386 |
| 374 | 3300014326 | Ga0157380_10066103 | Ga0157380_100661033 | 386 |
| 375 | 3300014326 | Ga0157380_10204354 | Ga0157380_102043542 | 386 |
| 376 | 3300014745 | Ga0157377_10021616 | Ga0157377_100216163 | 386 |
| 377 | 3300014968 | Ga0157379_10104399 | Ga0157379_101043991 | 386 |
| 378 | 3300014969 | Ga0157376_10016826 | Ga0157376_100168264 | 386 |
| 379 | 3300017792 | Ga0163161_10201801 | Ga0163161_102018012 | 386 |
| 380 | 3300025315 | Ga0207697_10028833 | Ga0207697_100288332 | 386 |
| 381 | 3300025893 | Ga0207682_10001143 | Ga0207682_100011434 | 386 |
| 382 | 3300025893 | Ga0207682_10012439 | Ga0207682_100124392 | 386 |
| 383 | 3300025898 | Ga0207692_10129576 | Ga0207692_101295762 | 386 |
| 384 | 3300025899 | Ga0207642_10020074 | Ga0207642_100200743 | 386 |
| 385 | 3300025901 | Ga0207688_10043861 | Ga0207688_100438612 | 386 |
| 386 | 3300025907 | Ga0207645_10083002 | Ga0207645_100830023 | 386 |
| 387 | 3300025907 | Ga0207645_10106119 | Ga0207645_101061192 | 386 |
| 388 | 3300025907 | Ga0207645_10120237 | Ga0207645_101202371 | 386 |
| 389 | 3300025908 | Ga0207643_10003970 | Ga0207643_100039705 | 386 |
| 390 | 3300025917 | Ga0207660_10249079 | Ga0207660_102490791 | 386 |
| 391 | 3300025918 | Ga0207662_10045891 | Ga0207662_100458912 | 386 |
| 392 | 3300025918 | Ga0207662_10046336 | Ga0207662_100463364 | 386 |
| 393 | 3300025922 | Ga0207646_10084772 | Ga0207646_100847723 | 386 |
| 394 | 3300025923 | Ga0207681_10006186 | Ga0207681_100061863 | 386 |
| 395 | 3300025923 | Ga0207681_10071741 | Ga0207681_100717412 | 386 |
| 396 | 3300025923 | Ga0207681_10144452 | Ga0207681_101444522 | 386 |
| 397 | 3300025925 | Ga0207650_10033641 | Ga0207650_100336412 | 386 |
| 398 | 3300025925 | Ga0207650_10232484 | Ga0207650_102324842 | 386 |
| 399 | 3300025926 | Ga0207659_10018297 | Ga0207659_100182975 | 386 |
| 400 | 3300025927 | Ga0207687_10020572 | Ga0207687_100205722 | 386 |
| 401 | 3300025933 | Ga0207706_10069532 | Ga0207706_100695322 | 386 |
| 402 | 3300025933 | Ga0207706_10106809 | Ga0207706_101068092 | 386 |
| 403 | 3300025933 | Ga0207706_10127129 | Ga0207706_101271293 | 386 |
| 404 | 3300025933 | Ga0207706_10222920 | Ga0207706_102229201 | 386 |
| 405 | 3300025934 | Ga0207686_10017943 | Ga0207686_100179435 | 386 |
| 406 | 3300025935 | Ga0207709_10081117 | Ga0207709_100811172 | 386 |
| 407 | 3300025937 | Ga0207669_10003660 | Ga0207669_100036604 | 386 |
| 408 | 3300025937 | Ga0207669_10126010 | Ga0207669_101260102 | 386 |
| 409 | 3300025937 | Ga0207669_10149025 | Ga0207669_101490251 | 386 |
| 410 | 3300025940 | Ga0207691_10073977 | Ga0207691_100739772 | 386 |
| 411 | 3300025940 | Ga0207691_10087487 | Ga0207691_100874873 | 386 |
| 412 | 3300025940 | Ga0207691_10117069 | Ga0207691_101170692 | 386 |
| 413 | 3300025940 | Ga0207691_10169471 | Ga0207691_101694712 | 386 |
| 414 | 3300025941 | Ga0207711_10080416 | Ga0207711_100804161 | 386 |
| 415 | 3300025945 | Ga0207679_10039206 | Ga0207679_100392065 | 386 |
| 416 | 3300025961 | Ga0207712_10039928 | Ga0207712_100399284 | 386 |
| 417 | 3300025961 | Ga0207712_10209542 | Ga0207712_102095421 | 386 |
| 418 | 3300025972 | Ga0207668_10087022 | Ga0207668_100870222 | 386 |
| 419 | 3300025981 | Ga0207640_10095994 | Ga0207640_100959942 | 386 |
| 420 | 3300025981 | Ga0207640_10129773 | Ga0207640_101297732 | 386 |
| 421 | 3300026089 | Ga0207648_10050298 | Ga0207648_100502985 | 386 |
| 422 | 3300026089 | Ga0207648_10083861 | Ga0207648_100838613 | 386 |
| 423 | 3300026089 | Ga0207648_10121130 | Ga0207648_101211302 | 386 |
| 424 | 3300026095 | Ga0207676_10262061 | Ga0207676_102620611 | 386 |
| 425 | 3300026116 | Ga0207674_10114349 | Ga0207674_101143493 | 386 |
| 426 | 3300026118 | Ga0207675_100016861 | Ga0207675_1000168617 | 386 |
| 427 | 3300026118 | Ga0207675_100061744 | Ga0207675_1000617444 | 386 |
| 428 | 3300026121 | Ga0207683_10015791 | Ga0207683_100157913 | 386 |
| 429 | 3300026121 | Ga0207683_10148321 | Ga0207683_101483212 | 386 |
| 430 | 3300027876 | Ga0209974_10024511 | Ga0209974_100245112 | 386 |
| 431 | 3300027907 | Ga0207428_10000097 | Ga0207428_1000009777 | 386 |
| 432 | 3300027907 | Ga0207428_10000875 | Ga0207428_100008753 | 386 |
| 433 | 3300027907 | Ga0207428_10005438 | Ga0207428_1000543810 | 386 |
| 434 | 3300027907 | Ga0207428_10009561 | Ga0207428_100095616 | 386 |
| 435 | 3300027907 | Ga0207428_10034419 | Ga0207428_100344194 | 386 |
| 436 | 3300027907 | Ga0207428_10063333 | Ga0207428_100633334 | 386 |
| 437 | 3300028380 | Ga0268265_10012315 | Ga0268265_100123157 | 386 |
| 438 | 3300028380 | Ga0268265_10251413 | Ga0268265_102514131 | 386 |
| 439 | 3300035115 | Ga0373941_0023541 | Ga0373941_0023541_13_1176 | 386 |
| 440 | 3300035170 | Ga0373943_0020373 | Ga0373943_0020373_727_1890 | 386 |
| 441 | 3300035410 | Ga0373924_0053418 | Ga0373924_0053418_75_1238 | 386 |
| 442 | 3300035692 | Ga0373935_0018073 | Ga0373935_0018073_2192_3355 | 386 |
| 443 | 3300035725 | Ga0373947_0053799 | Ga0373947_0053799_1151_2314 | 386 |
| 444 | 3300042461 | Ga0439460_0006001 | Ga0439460_0006001_1454_2620 | 386 |
| 445 | 3300042876 | Ga0451577_0003216 | Ga0451577_0003216_8364_9527 | 386 |
| 446 | 3300046459 | Ga0495629_0175090 | Ga0495629_0175090_287_1450 | 386 |
| 447 | 3300046511 | Ga0495608_0018395 | Ga0495608_0018395_2683_3846 | 386 |
| 448 | 3300046516 | Ga0495628_0025274 | Ga0495628_0025274_3044_4306 | 386 |
| 449 | 3300046535 | Ga0495586_0123034 | Ga0495586_0123034_125_1288 | 386 |
| 450 | 3300046539 | Ga0495621_0019729 | Ga0495621_0019729_684_1847 | 386 |
| 451 | 3300046543 | Ga0495645_0011900 | Ga0495645_0011900_2056_3219 | 386 |
| 452 | 3300046559 | Ga0495667_0037720 | Ga0495667_0037720_2036_3199 | 386 |
| 453 | 3300046684 | Ga0495669_0046036 | Ga0495669_0046036_716_1879 | 386 |
| 454 | 3300046689 | Ga0495613_0000507 | Ga0495613_0000507_12992_14155 | 386 |
| 455 | 3300047471 | Ga0495684_0000188 | Ga0495684_0000188_18816_19979 | 386 |
| 456 | 3300048904 | Ga0496101_0002514 | Ga0496101_0002514_1303_2466 | 386 |
| 457 | 3300048905 | Ga0496102_0148613 | Ga0496102_0148613_292_1455 | 386 |
| 458 | 3300048907 | Ga0496104_0050545 | Ga0496104_0050545_70_1233 | 386 |
| 459 | 3300048909 | Ga0496106_0005072 | Ga0496106_0005072_4003_5166 | 386 |
| 460 | 3300048917 | Ga0496114_0000462 | Ga0496114_0000462_25621_26784 | 386 |
| 461 | 3300049574 | Ga0501038_0212472 | Ga0501038_0212472_302_1501 | 386 |
| 462 | 3300049576 | Ga0501040_0112156 | Ga0501040_0112156_414_1613 | 386 |
| 463 | 3300049578 | Ga0501042_0048289 | Ga0501042_0048289_1734_2897 | 386 |
| 464 | 3300049587 | Ga0501071_0026618 | Ga0501071_0026618_1805_3004 | 386 |
| 465 | 3300049588 | Ga0501072_0066879 | Ga0501072_0066879_1029_2228 | 386 |
| 466 | 3300049589 | Ga0501073_0025396 | Ga0501073_0025396_1034_2206 | 386 |
| 467 | 3300049591 | Ga0501075_0034715 | Ga0501075_0034715_1817_3016 | 386 |
| 468 | 3300049592 | Ga0501076_0034974 | Ga0501076_0034974_1023_2222 | 386 |
| 469 | 3300049742 | Ga0501080_0370561 | Ga0501080_0370561_62_1261 | 386 |
| 470 | 3300050507 | nmdc:mga05p37_114738_c1 | nmdc:mga05p37_114738_c1_1718_2905 | 386 |
| 471 | 3300050507 | nmdc:mga05p37_22582_c1 | nmdc:mga05p37_22582_c1_890_2056 | 386 |
| 472 | 3300050507 | nmdc:mga05p37_25835_c1 | nmdc:mga05p37_25835_c1_4974_6137 | 386 |
| 473 | 3300050507 | nmdc:mga05p37_259924_c1 | nmdc:mga05p37_259924_c1_624_1784 | 386 |
| 474 | 3300050507 | nmdc:mga05p37_32632_c1 | nmdc:mga05p37_32632_c1_3649_4830 | 386 |
| 475 | 3300050507 | nmdc:mga05p37_645557_c1 | nmdc:mga05p37_645557_c1_15_1175 | 386 |
| 476 | 3300050508 | nmdc:mga09592_2024_c1 | nmdc:mga09592_2024_c1_11069_12250 | 386 |
| 477 | 3300050508 | nmdc:mga09592_260606_c1 | nmdc:mga09592_260606_c1_129_1316 | 386 |
| 478 | 3300050508 | nmdc:mga09592_37096_c1 | nmdc:mga09592_37096_c1_316_1500 | 386 |
| 479 | 3300050508 | nmdc:mga09592_52269_c1 | nmdc:mga09592_52269_c1_435_1595 | 386 |
| 480 | 3300050509 | nmdc:mga0qj67_7074_c1 | nmdc:mga0qj67_7074_c1_436_1596 | 386 |
| 481 | 3300050510 | nmdc:mga06r32_346427_c1 | nmdc:mga06r32_346427_c1_129_1313 | 386 |
| 482 | 3300050510 | nmdc:mga06r32_35683_c1 | nmdc:mga06r32_35683_c1_890_2053 | 386 |
| 483 | 3300050510 | nmdc:mga06r32_44524_c1 | nmdc:mga06r32_44524_c1_57_1217 | 386 |
| 484 | 3300050510 | nmdc:mga06r32_787_c1 | nmdc:mga06r32_787_c1_1563_2723 | 386 |
| 485 | 3300050511 | nmdc:mga08y16_10_c1 | nmdc:mga08y16_10_c1_189181_190353 | 386 |
| 486 | 3300050511 | nmdc:mga08y16_17955_c1 | nmdc:mga08y16_17955_c1_1917_3080 | 386 |
| 487 | 3300050511 | nmdc:mga08y16_1884_c1 | nmdc:mga08y16_1884_c1_1569_2762 | 386 |
| 488 | 3300050511 | nmdc:mga08y16_43599_c1 | nmdc:mga08y16_43599_c1_479_1639 | 386 |
| 489 | 3300050512 | nmdc:mga0n895_190_c1 | nmdc:mga0n895_190_c1_12717_13877 | 386 |
| 490 | 3300050512 | nmdc:mga0n895_3737_c1 | nmdc:mga0n895_3737_c1_9431_10636 | 386 |
| 491 | 3300050512 | nmdc:mga0n895_380855_c1 | nmdc:mga0n895_380855_c1_13_1197 | 386 |
| 492 | 3300050512 | nmdc:mga0n895_3_c1 | nmdc:mga0n895_3_c1_46738_47922 | 386 |
| 493 | 3300050512 | nmdc:mga0n895_425275_c1 | nmdc:mga0n895_425275_c1_124_1287 | 386 |
| 494 | 3300050513 | nmdc:mga0rr50_31708_c1 | nmdc:mga0rr50_31708_c1_1652_2836 | 386 |
| 495 | 3300050513 | nmdc:mga0rr50_32041_c1 | nmdc:mga0rr50_32041_c1_1290_2450 | 386 |
| 496 | 3300050513 | nmdc:mga0rr50_39_c1 | nmdc:mga0rr50_39_c1_47091_48275 | 386 |
| 497 | 3300050514 | nmdc:mga08x19_259_c1 | nmdc:mga08x19_259_c1_11745_12929 | 386 |
| 498 | 3300050515 | nmdc:mga0a205_12241_c1 | nmdc:mga0a205_12241_c1_270_1433 | 386 |
| 499 | 3300050515 | nmdc:mga0a205_574_c1 | nmdc:mga0a205_574_c1_23923_25083 | 386 |
| 500 | 3300050515 | nmdc:mga0a205_7422_c1 | nmdc:mga0a205_7422_c1_6164_7324 | 386 |
| 501 | 3300053084 | Ga0495595_0026664 | Ga0495595_0026664_1077_2240 | 386 |
| 502 | 3300053084 | Ga0495595_0073131 | Ga0495595_0073131_82_1245 | 386 |
| 503 | 3300053085 | Ga0495619_0026975 | Ga0495619_0026975_1126_2289 | 386 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4k05-assembly1.cif.gz_A | crystal structure of a duf1343 family protein (bf0371) from bacteroides fragilis nctc 9343 at 1.65 a resolution | 0.9078 | 2 | 386 |
| 4k05-assembly1.cif.gz_A | crystal structure of a duf1343 family protein (bf0371) from bacteroides fragilis nctc 9343 at 1.65 a resolution | 0.8941 | 2 | 386 |
| 4jja-assembly1.cif.gz_A | crystal structure of a duf1343 family protein (bf0379) from bacteroides fragilis nctc 9343 at 1.30 a resolution | 0.8254 | 1 | 386 |
| 4jja-assembly1.cif.gz_A | crystal structure of a duf1343 family protein (bf0379) from bacteroides fragilis nctc 9343 at 1.30 a resolution | 0.8144 | 1 | 386 |
| 4izg-assembly1.cif.gz_A | crystal structure of an enolase (mandelate racemase subgroup) from paracococus denitrificans pd1222 (target nysgrc-012907) with bound cis-4oh-d-proline betaine (product) | 0.6928 | 93 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4k05B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Uncharacterised protein PF07075, DUF1343 | 0.9065 | 2 | 213 | 3.40.50.12170 |
| 4k05B02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.8207 | 216 | 370 | 3.90.1150.140 |
| 4k05B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Uncharacterised protein PF07075, DUF1343 | 0.8179 | 2 | 213 | 3.40.50.12170 |
| 4k05B02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.8107 | 216 | 370 | 3.90.1150.140 |
| af_A0A1D6MYJ2_339_548_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.6929 | 93 | 136 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838S0N7-F1-model_v4 | DUF1343 domain-containing protein | 0.9841 | 254 | 386 |
GO:0033922
|
| AF-A0A838S0N7-F1-model_v4 | DUF1343 domain-containing protein | 0.9769 | 254 | 386 |
GO:0033922
|
| AF-A0A7W1TUB8-F1-model_v4 | DUF1343 domain-containing protein | 0.9719 | 197 | 386 |
GO:0033922
|
| AF-A0A2V7A8X7-F1-model_v4 | DUF1343 domain-containing protein | 0.9696 | 206 | 386 |
GO:0033922
|
| AF-A0A848WR91-F1-model_v4 | DUF1343 domain-containing protein | 0.9693 | 200 | 349 |
GO:0033922
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar