F455984

General Info

Members Datasets Scaffolds Average Seq Length
503 265 370 170

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10055268|Ga0075364_100552681
Length 188
Sequence MNEHTAATPFATSDAGRTVLNVAIASISDKRSAQDDPAGNLLADLVTQAGHRVVRRAVSPENKFEVRRILSDWIADGEVDVVLTAGGTGFADKNTTPEAVRVLFDKEIEGFGELFRQVSYAEIGGAAIQSRAIAGYANRTVIFCVPASSHACRTAWEYLIRDQLDSGQKPCNFANKVGALPPRKELAP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
6 2547132181 Kosakonia sacchari SP1 Isolate Stem
7 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
8 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
9 2561511199 Enterobacter sp. R4-368 Isolate Nodule
10 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
11 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
12 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
13 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
14 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
15 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
16 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
17 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
18 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
19 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
20 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
21 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
22 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
23 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
24 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
25 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
26 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
27 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
28 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
29 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
30 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
31 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
32 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
33 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
34 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
35 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
36 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
37 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
38 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
39 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
40 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
41 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
42 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
43 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
44 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
45 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
46 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
47 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
48 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
49 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
50 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
51 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
52 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
53 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
54 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
55 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
56 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
57 2636415599 Klebsiella variicola DX120E Isolate Unclassified
58 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
59 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
60 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
61 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
62 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
63 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
64 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
65 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
66 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
67 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
68 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
69 2751185917 Enterobacter sp. HK169 Isolate Unclassified
70 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
71 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
72 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
73 2775507074 Klebsiella sp. D5A Isolate Unclassified
74 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
75 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
76 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
77 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
78 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
79 2821118458 Enterobacter asburiae 609 Isolate Unclassified
80 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
81 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
82 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
83 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
84 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
85 2858950400 Achromobacter sp. K91 Isolate Unclassified
86 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
87 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
88 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
89 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
90 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
91 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
92 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
93 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
94 2904504865 Serratia marcescens 1822 Isolate Unclassified
95 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
96 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
97 2919150387 Rahnella aceris 1817 Isolate Unclassified
98 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
99 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
100 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
101 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
102 2927143783 Rahnella sp. 2050 Isolate Unclassified
103 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
104 2932406140 Serratia sp. 2723 Isolate Rhizosphere
105 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
106 2937539931 Pantoea sp. LS15 Isolate Unclassified
107 2937967321 Serratia sp. YC16 Isolate Unclassified
108 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
109 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
110 2939577877 Serratia sp. 509 Isolate Rhizosphere
111 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
112 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
113 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
114 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
115 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
116 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
117 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
118 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
119 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
120 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
121 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
122 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
123 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
124 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
125 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
126 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
127 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
128 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
129 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
130 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
131 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
132 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
133 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
134 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
135 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
136 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
137 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
138 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
139 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
140 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
141 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
142 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
143 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
144 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
145 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
146 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
147 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
148 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
149 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
150 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
151 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
152 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
153 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
154 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
159 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
160 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
161 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
162 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
163 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
164 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
165 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
166 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
167 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
173 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
174 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
176 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
177 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
185 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
191 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
192 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
193 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
194 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
195 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
196 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
197 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
198 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
199 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
200 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
201 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
202 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
205 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
206 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
207 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
208 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
209 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
210 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
213 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
218 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
221 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
222 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
230 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
231 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
238 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
239 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
240 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
241 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
244 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
250 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
251 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 640753048 Serratia proteamaculans 568 Isolate Endosphere
254 8004592986 Serratia sp. S119 Isolate Unclassified
255 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
256 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
257 8018221730 Enterobacter sp. CM29 Isolate Unclassified
258 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
259 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
260 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
261 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
262 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
263 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
264 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
265 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.56
Metatranscriptomes 0
Isolates 26.44

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 6.36
Nodule 4.37
Rhizoplane 11.93
Rhizosphere 44.73
Stem 0.2
Stem Tuber 0.8
Unclassified 31.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1219060 2162886007 Bacteria 2052
2 SwRhRL2b_contig_16462 2162886007 Bacteria 2117
3 SwRhRL2b_contig_220674 2162886007 Bacteria 1473
4 SwRhRL2b_contig_3442417 2162886007 Bacteria 1607
5 SwRhRL2b_contig_495415 2162886007 Bacteria 12725
6 JGI25162J39368_1000003 3300002737 Bacteria 575218
7 JGI25163J39215_1001618 3300002771 Bacteria 3368
8 JGI25164J39214_1002112 3300002772 Bacteria 3372
9 JGI25152J39213_1000744 3300002773 Bacteria 16643
10 JGI25165J46597_1007059 3300003214 Bacteria 1911
11 rootH1_10165750 3300003316 Bacteria 1142
12 rootH2_10210470 3300003320 Bacteria 4728
13 rootH2_10246418 3300003320 Bacteria 3305
14 rootH1_10118087 3300003323 Bacteria 9422
15 Ga0055538_1000005 3300003751 Bacteria 575218
16 Ga0055539_1000007 3300003752 Bacteria 575218
17 Ga0055533_1000009 3300003756 Bacteria 575218
18 Ga0055525_1000010 3300003759 Bacteria 575218
19 Ga0055541_1000005 3300003841 Bacteria 575218
20 Ga0058692_1000955 3300003856 Bacteria 11366
21 Ga0058692_1001096 3300003856 Bacteria 10511
22 Ga0058692_1001098 3300003856 Bacteria 10507
23 Ga0058692_1002632 3300003856 Bacteria 5915
24 Ga0058692_1028016 3300003856 Bacteria 1091
25 Ga0058692_1054480 3300003856 Bacteria 650
26 Ga0065703_1022110 3300005272 Bacteria 997
27 Ga0065704_10000426 3300005289 Bacteria 29816
28 Ga0065704_10000623 3300005289 Bacteria 15694
29 Ga0065704_10071306 3300005289 Bacteria 11840
30 Ga0065704_10085935 3300005289 Bacteria 3171
31 Ga0065704_10124328 3300005289 Bacteria 1719
32 Ga0070659_100225673 3300005366 Bacteria 1547
33 Ga0070697_101130036 3300005536 Bacteria 697
34 Ga0070665_100515748 3300005548 Bacteria 1207
35 Ga0068857_100000621 3300005577 Bacteria 26089
36 Ga0075364_10003213 3300006051 Bacteria 9260
37 Ga0075364_10055268 3300006051 Bacteria 2597
38 Ga0075364_10056812 3300006051 Bacteria 2563
39 Ga0075364_10101194 3300006051 Bacteria 1918
40 Ga0075364_10113920 3300006051 Bacteria 1807
41 Ga0079104_1000080 3300006946 Bacteria 140677
42 Ga0079104_1000087 3300006946 Bacteria 135647
43 Ga0079104_1000250 3300006946 Bacteria 72013
44 Ga0079104_1000324 3300006946 Bacteria 58816
45 Ga0079104_1000922 3300006946 Bacteria 23582
46 Ga0079104_1001828 3300006946 Bacteria 13067
47 Ga0079104_1004202 3300006946 Bacteria 6266
48 Ga0079104_1005246 3300006946 Bacteria 5228
49 Ga0079104_1011534 3300006946 Bacteria 2835
50 Ga0079104_1015417 3300006946 Bacteria 2265
51 Ga0105251_10000122 3300009011 Bacteria 78326
52 Ga0105251_10000227 3300009011 Bacteria 56730
53 Ga0105251_10000370 3300009011 Bacteria 44149
54 Ga0105251_10000374 3300009011 Bacteria 43851
55 Ga0105251_10000511 3300009011 Bacteria 36723
56 Ga0105251_10001094 3300009011 Bacteria 23572
57 Ga0105251_10006664 3300009011 Bacteria 7301
58 Ga0105251_10017712 3300009011 Bacteria 3808
59 Ga0105251_10018927 3300009011 Bacteria 3649
60 Ga0105244_10000006 3300009036 Bacteria 357997
61 Ga0105244_10000183 3300009036 Bacteria 63415
62 Ga0105244_10000221 3300009036 Bacteria 59112
63 Ga0105244_10000572 3300009036 Bacteria 33020
64 Ga0105244_10001185 3300009036 Bacteria 21548
65 Ga0105244_10004231 3300009036 Bacteria 9971
66 Ga0105244_10021827 3300009036 Bacteria 3531
67 Ga0105244_10029559 3300009036 Bacteria 2926
68 Ga0105244_10066222 3300009036 Bacteria 1809
69 Ga0105250_10000003 3300009092 Bacteria 547770
70 Ga0105250_10000026 3300009092 Bacteria 213233
71 Ga0105250_10000133 3300009092 Bacteria 64415
72 Ga0105250_10000326 3300009092 Bacteria 36660
73 Ga0105250_10016248 3300009092 Bacteria 3036
74 Ga0105250_10019474 3300009092 Bacteria 2744
75 Ga0105250_10217248 3300009092 Bacteria 810
76 Ga0105240_10623980 3300009093 Bacteria 1184
77 Ga0105247_10000018 3300009101 Bacteria 259335
78 Ga0105243_10012094 3300009148 Bacteria 6524
79 Ga0105243_10267731 3300009148 Bacteria 1533
80 Ga0105241_10000004 3300009174 Bacteria 803007
81 Ga0157373_10036909 3300013100 Bacteria 3505
82 Ga0157373_10099302 3300013100 Bacteria 2049
83 Ga0157373_10132514 3300013100 Bacteria 1752
84 Ga0157371_10000101 3300013102 Bacteria 129981
85 Ga0157371_10000462 3300013102 Bacteria 49728
86 Ga0157371_10108151 3300013102 Bacteria 1973
87 Ga0157371_10108152 3300013102 Bacteria 1973
88 Ga0157370_10000567 3300013104 Bacteria 46134
89 Ga0157369_10024023 3300013105 Bacteria 6783
90 Ga0163162_10106411 3300013306 Bacteria 2900
91 Ga0157372_10059046 3300013307 Bacteria 4289
92 Ga0157372_10072180 3300013307 Bacteria 3890
93 Ga0157372_10097295 3300013307 Bacteria 3356
94 Ga0163163_10216868 3300014325 Bacteria 1962
95 Ga0182008_10004157 3300014497 Bacteria 8523
96 Ga0182006_1000063 3300015261 Bacteria 154042
97 Ga0183366_1001 3300015679 Bacteria 2743932
98 Ga0183366_1002 3300015679 Bacteria 791639
99 Ga0183370_1001 3300015680 Bacteria 2743932
100 Ga0183370_1002 3300015680 Bacteria 791639
101 Ga0183369_1001 3300015685 Bacteria 2743932
102 Ga0183369_1002 3300015685 Bacteria 791621
103 Ga0183368_1001 3300015687 Bacteria 2743932
104 Ga0183368_1005 3300015687 Bacteria 791621
105 Ga0183361_10585 3300016635 Bacteria 1639
106 Ga0163161_10000001 3300017792 Bacteria 2041488
107 Ga0163161_10314735 3300017792 Bacteria 1236
108 Ga0213876_10000166 3300021384 Bacteria 69611
109 Ga0209760_100001 3300025207 Bacteria 348781
110 Ga0209784_100001 3300025224 Bacteria 3600592
111 Ga0209566_100001 3300025225 Bacteria 3600765
112 Ga0209674_100002 3300025226 Bacteria 3600592
113 Ga0209563_100008 3300025230 Bacteria 1554545
114 Ga0207427_100002 3300025231 Bacteria 1355321
115 Ga0209437_100007 3300025233 Bacteria 938377
116 Ga0209677_100004 3300025253 Bacteria 1554545
117 Ga0209129_1000015 3300025258 Bacteria 487967
118 Ga0209233_1001167 3300025261 Bacteria 10620
119 Ga0207696_1000001 3300025711 Bacteria 2579611
120 Ga0207696_1000003 3300025711 Bacteria 860639
121 Ga0207696_1000004 3300025711 Bacteria 671626
122 Ga0207696_1000059 3300025711 Bacteria 245763
123 Ga0207696_1000415 3300025711 Bacteria 39668
124 Ga0207696_1001947 3300025711 Bacteria 10496
125 Ga0207696_1009075 3300025711 Bacteria 3730
126 Ga0207696_1011582 3300025711 Bacteria 3166
127 Ga0207655_1000001 3300025728 Bacteria 1866413
128 Ga0207655_1000011 3300025728 Bacteria 643321
129 Ga0207655_1000032 3300025728 Bacteria 391253
130 Ga0207655_1000149 3300025728 Bacteria 129937
131 Ga0207655_1000157 3300025728 Bacteria 124885
132 Ga0207655_1000260 3300025728 Bacteria 83214
133 Ga0207655_1000334 3300025728 Bacteria 68683
134 Ga0207655_1000370 3300025728 Bacteria 63426
135 Ga0207655_1004497 3300025728 Bacteria 9872
136 Ga0207655_1034567 3300025728 Bacteria 2270
137 Ga0207713_1000005 3300025735 Bacteria 649958
138 Ga0207713_1000006 3300025735 Bacteria 586163
139 Ga0207713_1000024 3300025735 Bacteria 339156
140 Ga0207713_1000059 3300025735 Bacteria 214031
141 Ga0207713_1000316 3300025735 Bacteria 54767
142 Ga0207713_1001682 3300025735 Bacteria 17103
143 Ga0207713_1004701 3300025735 Bacteria 8797
144 Ga0207713_1027264 3300025735 Bacteria 2599
145 Ga0207713_1036719 3300025735 Bacteria 2098
146 Ga0207713_1096987 3300025735 Bacteria 1024
147 Ga0207713_1157394 3300025735 Bacteria 728
148 Ga0207710_10000049 3300025900 Bacteria 186492
149 Ga0207654_10000006 3300025911 Bacteria 815027
150 Ga0207709_10004155 3300025935 Bacteria 8423
151 Ga0207674_10002565 3300026116 Bacteria 22875
152 Ga0209281_1000001 3300027111 Bacteria 1933496
153 Ga0209281_1000008 3300027111 Bacteria 867470
154 Ga0209281_1000021 3300027111 Bacteria 541033
155 Ga0209281_1000101 3300027111 Bacteria 222707
156 Ga0209281_1000148 3300027111 Bacteria 168332
157 Ga0209281_1000201 3300027111 Bacteria 135580
158 Ga0209281_1000291 3300027111 Bacteria 91918
159 Ga0209281_1000780 3300027111 Bacteria 30266
160 Ga0209281_1001376 3300027111 Bacteria 14942
161 Ga0209281_1001548 3300027111 Bacteria 12704
162 Ga0209281_1004537 3300027111 Bacteria 4131
163 Ga0209371_1000001 3300027312 Bacteria 2771503
164 Ga0209371_1000047 3300027312 Bacteria 304732
165 Ga0209371_1000056 3300027312 Bacteria 242255
166 Ga0209371_1000742 3300027312 Bacteria 27264
167 Ga0209371_1002495 3300027312 Bacteria 10208
168 Ga0209371_1002999 3300027312 Bacteria 8745
169 Ga0209371_1010394 3300027312 Bacteria 2866
170 Ga0209371_1018865 3300027312 Bacteria 1739
171 Ga0209371_1058977 3300027312 Bacteria 710
172 Ga0268266_10542653 3300028379 Bacteria 1113
173 Ga0268256_1000001 3300030500 Bacteria 2771065
174 Ga0268256_1000003 3300030500 Bacteria 1289401
175 Ga0268256_1000071 3300030500 Bacteria 187591
176 Ga0268256_1000548 3300030500 Bacteria 30786
177 Ga0268256_1002228 3300030500 Bacteria 10188
178 Ga0268256_1006961 3300030500 Bacteria 4123
179 Ga0268256_1011149 3300030500 Bacteria 2866
180 Ga0268256_1030732 3300030500 Bacteria 1297
181 Ga0268256_1063177 3300030500 Bacteria 736
182 Ga0307408_100000279 3300031548 Bacteria 51312
183 Ga0265314_10565634 3300031711 Bacteria 590
184 Ga0316576_10054582 3300031727 Bacteria 2914
185 Ga0316576_10217839 3300031727 Bacteria 1436
186 Ga0316577_10112481 3300031733 Bacteria 1528
187 Ga0316577_10373942 3300031733 Bacteria 809
188 Ga0316583_10065676 3300032133 Bacteria 1270
189 Ga0316574_0032426 3300035398 Bacteria 3175
190 Ga0316582_0356719 3300036647 Bacteria 1006
191 Ga0316584_0124556 3300036712 Bacteria 1925
192 Ga0400484_24055 3300038725 Bacteria 26120
193 Ga0400484_26797 3300038725 Bacteria 6775
194 Ga0400490_00993 3300038726 Bacteria 10789
195 Ga0400491_01827 3300038727 Bacteria 2299
196 Ga0400485_07939 3300038735 Bacteria 3182
197 Ga0400488_04209 3300038741 Bacteria 6451
198 Ga0400488_18821 3300038741 Unclassified 1618
199 Ga0400488_20547 3300038741 Bacteria 2247
200 Ga0400483_109289 3300039062 Bacteria 14389
201 Ga0400483_277931 3300039062 Bacteria 49182
202 Ga0400487_45355 3300039110 Bacteria 8013
203 Ga0436365_0105401 3300039437 Bacteria 69559
204 Ga0436365_1850428 3300039437 Bacteria 854
205 Ga0439438_000001 3300041405 Bacteria 1263568
206 Ga0439438_005168 3300041405 Bacteria 4848
207 Ga0439438_032469 3300041405 Bacteria 1384
208 Ga0439438_048992 3300041405 Bacteria 1080
209 Ga0439447_002773 3300041407 Bacteria 6325
210 Ga0451802_0141483 3300041460 Bacteria 904
211 Ga0439432_002750 3300042006 Bacteria 6573
212 Ga0439432_006392 3300042006 Bacteria 4211
213 Ga0439452_000003 3300042010 Bacteria 942815
214 Ga0439452_000029 3300042010 Bacteria 197977
215 Ga0439452_000220 3300042010 Bacteria 40289
216 Ga0439452_003680 3300042010 Bacteria 5308
217 Ga0450902_022839 3300042137 Bacteria 1037
218 Ga0466981_0000023 3300044669 Bacteria 78984
219 Ga0453684_0050266 3300044712 Bacteria 5487
220 Ga0495627_000028 3300046453 Bacteria 234737
221 Ga0495627_023385 3300046453 Bacteria 2025
222 Ga0495591_000380 3300046458 Bacteria 37698
223 Ga0495591_002416 3300046458 Bacteria 10410
224 Ga0495638_0004017 3300046460 Bacteria 11289
225 Ga0495650_0000016 3300046471 Bacteria 554693
226 Ga0495607_0005503 3300046501 Bacteria 9045
227 Ga0495620_0013817 3300046515 Bacteria 4124
228 Ga0495637_0047014 3300046520 Bacteria 1824
229 Ga0495637_0052783 3300046520 Bacteria 1695
230 Ga0495643_0291443 3300046522 Bacteria 747
231 Ga0495654_0000358 3300046530 Bacteria 39515
232 Ga0495654_0003824 3300046530 Bacteria 9098
233 Ga0495654_0009483 3300046530 Bacteria 5334
234 Ga0495609_0087388 3300046538 Bacteria 1358
235 Ga0495597_0001596 3300046542 Bacteria 15921
236 Ga0495625_0011116 3300046660 Bacteria 7372
237 Ga0495588_0029153 3300046674 Bacteria 2767
238 Ga0495649_0000984 3300046694 Bacteria 22473
239 Ga0495649_0001470 3300046694 Bacteria 17710
240 Ga0495589_0000002 3300046794 Bacteria 758846
241 Ga0495660_0000007 3300046810 Bacteria 485295
242 Ga0495672_0000004 3300047320 Bacteria 631810
243 Ga0495672_0000070 3300047320 Bacteria 184471
244 Ga0495679_000021 3300047446 Bacteria 226183
245 Ga0495679_000893 3300047446 Bacteria 18704
246 Ga0495673_0000022 3300047469 Bacteria 544086
247 Ga0495673_0000023 3300047469 Bacteria 539904
248 Ga0495681_0059184 3300047470 Bacteria 1772
249 Ga0495681_0098170 3300047470 Bacteria 1284
250 Ga0496101_0162376 3300048904 Bacteria 1714
251 Ga0496103_0082173 3300048906 Bacteria 2027
252 Ga0496104_0000256 3300048907 Bacteria 47237
253 Ga0496104_0000747 3300048907 Bacteria 27762
254 Ga0496105_0068433 3300048908 Bacteria 2933
255 Ga0496105_0271793 3300048908 Bacteria 1368
256 Ga0496113_1123732 3300048916 Bacteria 616
257 Ga0496116_0000023 3300048919 Bacteria 475792
258 Ga0496116_0000127 3300048919 Bacteria 158773
259 Ga0496116_0020321 3300048919 Bacteria 5046
260 Ga0496116_0023585 3300048919 Bacteria 4578
261 Ga0496116_0299349 3300048919 Bacteria 766
262 Ga0496116_0327480 3300048919 Bacteria 713
263 Ga0496117_0001660 3300048920 Bacteria 31182
264 Ga0496117_0001826 3300048920 Bacteria 28910
265 Ga0496117_0001907 3300048920 Bacteria 27984
266 Ga0496117_0007050 3300048920 Bacteria 11118
267 Ga0496117_0018339 3300048920 Bacteria 5801
268 Ga0496117_0022556 3300048920 Bacteria 5046
269 Ga0496117_0028838 3300048920 Bacteria 4290
270 Ga0496117_0106902 3300048920 Bacteria 1754
271 Ga0496117_0139202 3300048920 Bacteria 1456
272 Ga0496117_0151722 3300048920 Bacteria 1370
273 Ga0496117_0327218 3300048920 Bacteria 800
274 Ga0496118_0001275 3300048921 Bacteria 38632
275 Ga0496118_0002095 3300048921 Bacteria 28029
276 Ga0496118_0011653 3300048921 Bacteria 8552
277 Ga0496118_0015676 3300048921 Bacteria 6999
278 Ga0496118_0015816 3300048921 Bacteria 6959
279 Ga0496118_0017441 3300048921 Bacteria 6535
280 Ga0496118_0069105 3300048921 Bacteria 2560
281 Ga0496118_0350155 3300048921 Bacteria 787
282 Ga0496119_0000529 3300048922 Bacteria 52025
283 Ga0496119_0001020 3300048922 Bacteria 35864
284 Ga0496119_0007193 3300048922 Bacteria 10082
285 Ga0496119_0009612 3300048922 Bacteria 8255
286 Ga0496119_0042651 3300048922 Bacteria 2875
287 Ga0496119_0047650 3300048922 Bacteria 2664
288 Ga0496119_0075040 3300048922 Bacteria 1966
289 Ga0496119_0090213 3300048922 Bacteria 1743
290 Ga0496119_0162968 3300048922 Bacteria 1183
291 Ga0496120_0002219 3300048923 Bacteria 20443
292 Ga0496120_0003841 3300048923 Bacteria 13195
293 Ga0496120_0007700 3300048923 Bacteria 7975
294 Ga0496120_0011835 3300048923 Bacteria 5969
295 Ga0496120_0014525 3300048923 Bacteria 5244
296 Ga0496120_0017254 3300048923 Bacteria 4688
297 Ga0496120_0042380 3300048923 Bacteria 2658
298 Ga0496120_0078356 3300048923 Bacteria 1796
299 Ga0496120_0098277 3300048923 Bacteria 1552
300 Ga0496120_0161956 3300048923 Bacteria 1114
301 Ga0496121_0000358 3300048924 Bacteria 93865
302 Ga0496121_0002246 3300048924 Bacteria 30101
303 Ga0496121_0005439 3300048924 Bacteria 16327
304 Ga0496121_0005522 3300048924 Bacteria 16156
305 Ga0496121_0026703 3300048924 Bacteria 5427
306 Ga0496121_0028947 3300048924 Bacteria 5141
307 Ga0496121_0032900 3300048924 Bacteria 4704
308 Ga0496122_0000013 3300048925 Bacteria 501039
309 Ga0496122_0000099 3300048925 Bacteria 198412
310 Ga0496122_0001096 3300048925 Bacteria 46958
311 Ga0496122_0001159 3300048925 Bacteria 45121
312 Ga0496122_0019192 3300048925 Bacteria 6261
313 Ga0496122_0048198 3300048925 Bacteria 3279
314 Ga0496122_0100694 3300048925 Bacteria 1932
315 Ga0496122_0101996 3300048925 Bacteria 1914
316 Ga0496122_0121018 3300048925 Bacteria 1688
317 Ga0496122_0168912 3300048925 Bacteria 1322
318 Ga0496122_0172392 3300048925 Bacteria 1302
319 Ga0496122_0427719 3300048925 Bacteria 663
320 Ga0496122_0427728 3300048925 Bacteria 663
321 Ga0496123_0000005 3300048926 Bacteria 658131
322 Ga0496123_0000010 3300048926 Bacteria 501039
323 Ga0496123_0000876 3300048926 Bacteria 47752
324 Ga0496123_0003763 3300048926 Bacteria 16636
325 Ga0496123_0012809 3300048926 Bacteria 7110
326 Ga0496123_0016160 3300048926 Bacteria 6075
327 Ga0496123_0028319 3300048926 Bacteria 4151
328 Ga0496123_0032887 3300048926 Bacteria 3743
329 Ga0496123_0187434 3300048926 Bacteria 1073
330 Ga0496123_0218015 3300048926 Bacteria 964
331 Ga0496123_0221639 3300048926 Bacteria 953
332 Ga0496124_0000039 3300048927 Bacteria 307831
333 Ga0496124_0000515 3300048927 Bacteria 66726
334 Ga0496124_0001815 3300048927 Bacteria 29535
335 Ga0496124_0002100 3300048927 Bacteria 26896
336 Ga0496124_0017069 3300048927 Bacteria 6863
337 Ga0496124_0076325 3300048927 Bacteria 2766
338 Ga0496124_0182506 3300048927 Bacteria 1613
339 Ga0496124_0216874 3300048927 Bacteria 1442
340 Ga0496124_0274155 3300048927 Bacteria 1233
341 Ga0496124_0354996 3300048927 Bacteria 1035
342 Ga0496124_0831292 3300048927 Bacteria 568
343 Ga0496125_0000016 3300048928 Bacteria 512512
344 Ga0496125_0000019 3300048928 Bacteria 474989
345 Ga0496125_0000369 3300048928 Bacteria 84710
346 Ga0496125_0011210 3300048928 Bacteria 8986
347 Ga0496125_0023610 3300048928 Bacteria 5671
348 Ga0496125_0029224 3300048928 Bacteria 4957
349 Ga0496125_0043025 3300048928 Bacteria 3839
350 Ga0496125_0043626 3300048928 Bacteria 3802
351 Ga0496125_0049668 3300048928 Bacteria 3482
352 Ga0496125_0146435 3300048928 Bacteria 1631
353 Ga0496125_0247132 3300048928 Bacteria 1128
354 Ga0496126_0000346 3300048929 Bacteria 96927
355 Ga0496126_0000736 3300048929 Bacteria 59445
356 Ga0496126_0023668 3300048929 Bacteria 5948
357 Ga0496126_0041682 3300048929 Bacteria 4246
358 Ga0496126_0151218 3300048929 Bacteria 1989
359 Ga0496126_0244755 3300048929 Bacteria 1496
360 Ga0496126_0527127 3300048929 Bacteria 940
361 Ga0496126_0864543 3300048929 Bacteria 688
362 Ga0501040_0197594 3300049576 Bacteria 1428
363 Ga0501075_0058120 3300049591 Bacteria 2913
364 Ga0501208_004697 3300049655 Bacteria 1629
365 nmdc:mga00v17_15047_c1 3300050491 Bacteria 4335
366 nmdc:mga00v17_151956_c1 3300050491 Bacteria 1488
367 nmdc:mga00v17_47388_c1 3300050491 Bacteria 2603
368 nmdc:mga00v17_53630_c1 3300050491 Bacteria 2458
369 nmdc:mga00v17_538_c1 3300050491 Bacteria 21202
370 nmdc:mga0k408_4828_c3 3300050493 Bacteria 3297

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006051 Ga0075364_10056812 Ga0075364_100568123 159
2 iso_pu_bacteria 2858950400 2858953775 160
3 3300006051 Ga0075364_10101194 Ga0075364_101011942 162
4 3300006051 Ga0075364_10113920 Ga0075364_101139202 162
5 3300050491 nmdc:mga00v17_15047_c1 nmdc:mga00v17_15047_c1_1097_1627 162
6 3300050491 nmdc:mga00v17_53630_c1 nmdc:mga00v17_53630_c1_1715_2236 162
7 3300006051 Ga0075364_10003213 Ga0075364_1000321312 164
8 3300050491 nmdc:mga00v17_151956_c1 nmdc:mga00v17_151956_c1_645_1184 164
9 iso_pu_bacteria 2565956521 2566034906 164
10 iso_pu_bacteria 2506520007 2506577346 166
11 iso_pu_bacteria 2506520008 2506582484 166
12 iso_pu_bacteria 2508501071 2508851280 166
13 iso_pu_bacteria 2537561728 2538426882 166
14 iso_pu_bacteria 2547132181 2547694573 166
15 iso_pu_bacteria 2547132416 2548647893 166
16 iso_pu_bacteria 2554235234 2555261496 166
17 iso_pu_bacteria 2561511199 2562466647 166
18 iso_pu_bacteria 2585427591 2585829953 166
19 iso_pu_bacteria 2585427592 2585831046 166
20 iso_pu_bacteria 2599185169 2599410563 166
21 iso_pu_bacteria 2600255254 2601523793 166
22 iso_pu_bacteria 2600255255 2601528952 166
23 iso_pu_bacteria 2600255256 2601532161 166
24 iso_pu_bacteria 2600255257 2601537531 166
25 iso_pu_bacteria 2600255280 2601615785 166
26 iso_pu_bacteria 2600255281 2601620495 166
27 iso_pu_bacteria 2600255287 2601646692 166
28 iso_pu_bacteria 2600255288 2601648892 166
29 iso_pu_bacteria 2600255289 2601653836 166
30 iso_pu_bacteria 2600255290 2601659256 166
31 iso_pu_bacteria 2600255291 2601666651 166
32 iso_pu_bacteria 2600255298 2601699611 166
33 iso_pu_bacteria 2600255299 2601704514 166
34 iso_pu_bacteria 2600255300 2601707587 166
35 iso_pu_bacteria 2600255301 2601712646 166
36 iso_pu_bacteria 2600255302 2601717096 166
37 iso_pu_bacteria 2600255303 2601724495 166
38 iso_pu_bacteria 2600255304 2601724742 166
39 iso_pu_bacteria 2600255305 2601732025 166
40 iso_pu_bacteria 2600255306 2601738097 166
41 iso_pu_bacteria 2600255307 2601742497 166
42 iso_pu_bacteria 2600255309 2601751949 166
43 iso_pu_bacteria 2600255310 2601755878 166
44 iso_pu_bacteria 2600255311 2601761247 166
45 iso_pu_bacteria 2600255392 2602020396 166
46 iso_pu_bacteria 2602042046 2603638728 166
47 iso_pu_bacteria 2602042047 2603643265 166
48 iso_pu_bacteria 2602042052 2603659341 166
49 iso_pu_bacteria 2602042053 2603664236 166
50 iso_pu_bacteria 2602042066 2603699863 166
51 iso_pu_bacteria 2602042067 2603703840 166
52 iso_pu_bacteria 2602042103 2603839442 166
53 iso_pu_bacteria 2602042104 2603844503 166
54 iso_pu_bacteria 2602042105 2603849598 166
55 iso_pu_bacteria 2602042106 2603854666 166
56 iso_pu_bacteria 2602042109 2603865974 166
57 iso_pu_bacteria 2602042110 2603869921 166
58 iso_pu_bacteria 2602042111 2603874861 166
59 iso_pu_bacteria 2603880178 2606047112 166
60 iso_pu_bacteria 2603880184 2606068666 166
61 iso_pu_bacteria 2603880202 2606146386 166
62 iso_pu_bacteria 2603880211 2606177312 166
63 iso_pu_bacteria 2609459761 2609914275 166
64 iso_pu_bacteria 2636415599 2637226328 166
65 iso_pu_bacteria 2648501241 2649120948 166
66 iso_pu_bacteria 2654587920 2656275262 166
67 iso_pu_bacteria 2667528172 2671102579 166
68 iso_pu_bacteria 2667528173 2671108158 166
69 iso_pu_bacteria 2671180115 2671586599 166
70 iso_pu_bacteria 2675903046 2676407517 166
71 iso_pu_bacteria 2681812866 2681995600 166
72 iso_pu_bacteria 2681812869 2682007394 166
73 iso_pu_bacteria 2687453601 2689443806 166
74 iso_pu_bacteria 2706794495 2707100589 166
75 iso_pu_bacteria 2711768156 2712470285 166
76 iso_pu_bacteria 2751185917 2753855218 166
77 iso_pu_bacteria 2765235842 2765588155 166
78 iso_pu_bacteria 2772190666 2772437854 166
79 iso_pu_bacteria 2775506706 2775541521 166
80 iso_pu_bacteria 2775507074 2777020355 166
81 iso_pu_bacteria 2791354903 2791924846 166
82 iso_pu_bacteria 2791355275 2793406178 166
83 iso_pu_bacteria 2806310673 2807180420 166
84 iso_pu_bacteria 2811995292 2813729786 166
85 iso_pu_bacteria 2814123068 2814697281 166
86 iso_pu_bacteria 2821118458 2821118995 166
87 iso_pu_bacteria 2823373977 2823376755 166
88 iso_pu_bacteria 2844425489 2844426753 166
89 iso_pu_bacteria 2852103415 2852103863 166
90 iso_pu_bacteria 2855195626 2855199276 166
91 iso_pu_bacteria 2858466076 2858467975 166
92 iso_pu_bacteria 2869551831 2869553211 166
93 iso_pu_bacteria 2871282230 2871286531 166
94 iso_pu_bacteria 2884086401 2884089771 166
95 iso_pu_bacteria 2888366609 2888367849 166
96 iso_pu_bacteria 2888373701 2888374475 166
97 iso_pu_bacteria 2891670763 2891673616 166
98 iso_pu_bacteria 2900051742 2900055437 166
99 iso_pu_bacteria 2904474040 2904475171 166
100 iso_pu_bacteria 2904504865 2904505433 166
101 iso_pu_bacteria 2904513164 2904517328 166
102 iso_pu_bacteria 2919108558 2919111873 166
103 iso_pu_bacteria 2919150387 2919151517 166
104 iso_pu_bacteria 2923634449 2923638646 166
105 iso_pu_bacteria 2927143783 2927146391 166
106 iso_pu_bacteria 2927833300 2927834856 166
107 iso_pu_bacteria 2932406140 2932408619 166
108 iso_pu_bacteria 2935625433 2935627402 166
109 iso_pu_bacteria 2937539931 2937543512 166
110 iso_pu_bacteria 2937967321 2937969582 166
111 iso_pu_bacteria 2939568625 2939570409 166
112 iso_pu_bacteria 2939573065 2939574529 166
113 iso_pu_bacteria 2939577877 2939579011 166
114 iso_pu_bacteria 2939607340 2939608283 166
115 iso_pu_bacteria 2939617950 2939621420 166
116 iso_pu_bacteria 2939642701 2939644503 166
117 iso_pu_bacteria 2945874760 2945878884 166
118 iso_pu_bacteria 2969079654 2969083307 166
119 iso_pu_bacteria 2971820967 2971824746 166
120 iso_pu_bacteria 2974310843 2974312921 166
121 iso_pu_bacteria 2974435778 2974437676 166
122 iso_pu_bacteria 2984559226 2984560324 166
123 iso_pu_bacteria 2984595703 2984598401 166
124 iso_pu_bacteria 3000376612 3000379871 166
125 iso_pu_bacteria 640753048 640936853 166
126 iso_pu_bacteria 8004592986 8004594939 166
127 iso_pu_bacteria 8015394850 8015399491 166
128 iso_pu_bacteria 8018221730 8018224050 166
129 iso_pu_bacteria 8018405270 8018408056 166
130 iso_pu_bacteria 8019504834 8019508439 166
131 iso_pu_bacteria 8054844752 8054847029 166
132 iso_pu_bacteria 8054849141 8054854048 166
133 iso_pu_bacteria 8055087960 8055088930 166
134 iso_pu_bacteria 8055092621 8055093860 166
135 iso_pu_bacteria 8055097453 8055099305 166
136 iso_pu_bacteria 8057304971 8057305839 166
137 iso_pu_bacteria 2919501602 2919504009 167
138 iso_pu_bacteria 2919688452 2919691771 167
139 iso_pu_bacteria 2926063275 2926065418 167
140 iso_pu_bacteria 8011350971 8011353734 167
141 3300003320 rootH2_10246418 rootH2_102464185 169
142 3300003323 rootH1_10118087 rootH1_101180872 169
143 3300013100 Ga0157373_10036909 Ga0157373_100369093 169
144 3300013102 Ga0157371_10000462 Ga0157371_1000046235 169
145 3300013307 Ga0157372_10097295 Ga0157372_100972954 169
146 3300031548 Ga0307408_100000279 Ga0307408_10000027910 169
147 3300031727 Ga0316576_10054582 Ga0316576_100545822 169
148 3300031727 Ga0316576_10217839 Ga0316576_102178392 169
149 3300031733 Ga0316577_10112481 Ga0316577_101124812 169
150 3300031733 Ga0316577_10373942 Ga0316577_103739422 169
151 3300036712 Ga0316584_0124556 Ga0316584_0124556_1278_1808 169
152 3300041405 Ga0439438_000001 Ga0439438_000001_173297_173809 169
153 3300041407 Ga0439447_002773 Ga0439447_002773_2400_2912 169
154 3300041460 Ga0451802_0141483 Ga0451802_0141483_64_579 169
155 3300042006 Ga0439432_006392 Ga0439432_006392_532_1044 169
156 3300044712 Ga0453684_0050266 Ga0453684_0050266_382_903 169
157 2162886007 SwRhRL2b_contig_1219060 SwRhRL2b_0354.00007550 170
158 2162886007 SwRhRL2b_contig_16462 SwRhRL2b_0003.00001680 170
159 2162886007 SwRhRL2b_contig_220674 SwRhRL2b_0630.00006040 170
160 2162886007 SwRhRL2b_contig_3442417 SwRhRL2b_0062.00004440 170
161 2162886007 SwRhRL2b_contig_495415 SwRhRL2b_0979.00003540 170
162 3300002737 JGI25162J39368_1000003 JGI25162J39368_1000003508 170
163 3300002771 JGI25163J39215_1001618 JGI25163J39215_10016185 170
164 3300002772 JGI25164J39214_1002112 JGI25164J39214_10021122 170
165 3300002773 JGI25152J39213_1000744 JGI25152J39213_100074414 170
166 3300003214 JGI25165J46597_1007059 JGI25165J46597_10070591 170
167 3300003316 rootH1_10165750 rootH1_101657502 170
168 3300003320 rootH2_10210470 rootH2_102104703 170
169 3300003751 Ga0055538_1000005 Ga0055538_1000005508 170
170 3300003752 Ga0055539_1000007 Ga0055539_1000007508 170
171 3300003756 Ga0055533_1000009 Ga0055533_1000009508 170
172 3300003759 Ga0055525_1000010 Ga0055525_1000010508 170
173 3300003841 Ga0055541_1000005 Ga0055541_100000557 170
174 3300003856 Ga0058692_1000955 Ga0058692_10009558 170
175 3300003856 Ga0058692_1001096 Ga0058692_10010962 170
176 3300003856 Ga0058692_1001098 Ga0058692_10010982 170
177 3300003856 Ga0058692_1002632 Ga0058692_10026322 170
178 3300003856 Ga0058692_1028016 Ga0058692_10280162 170
179 3300003856 Ga0058692_1054480 Ga0058692_10544801 170
180 3300005272 Ga0065703_1022110 Ga0065703_10221102 170
181 3300005289 Ga0065704_10000426 Ga0065704_1000042615 170
182 3300005289 Ga0065704_10000623 Ga0065704_100006233 170
183 3300005289 Ga0065704_10071306 Ga0065704_100713062 170
184 3300005289 Ga0065704_10085935 Ga0065704_100859353 170
185 3300005289 Ga0065704_10124328 Ga0065704_101243282 170
186 3300005366 Ga0070659_100225673 Ga0070659_1002256733 170
187 3300005536 Ga0070697_101130036 Ga0070697_1011300361 170
188 3300005548 Ga0070665_100515748 Ga0070665_1005157482 170
189 3300005577 Ga0068857_100000621 Ga0068857_10000062112 170
190 3300006051 Ga0075364_10055268 Ga0075364_100552681 170
191 3300006946 Ga0079104_1000080 Ga0079104_1000080104 170
192 3300006946 Ga0079104_1000087 Ga0079104_100008740 170
193 3300006946 Ga0079104_1000250 Ga0079104_100025034 170
194 3300006946 Ga0079104_1000324 Ga0079104_100032416 170
195 3300006946 Ga0079104_1000922 Ga0079104_100092214 170
196 3300006946 Ga0079104_1001828 Ga0079104_10018285 170
197 3300006946 Ga0079104_1004202 Ga0079104_10042024 170
198 3300006946 Ga0079104_1005246 Ga0079104_10052463 170
199 3300006946 Ga0079104_1011534 Ga0079104_10115344 170
200 3300006946 Ga0079104_1015417 Ga0079104_10154175 170
201 3300009011 Ga0105251_10000122 Ga0105251_1000012270 170
202 3300009011 Ga0105251_10000227 Ga0105251_1000022760 170
203 3300009011 Ga0105251_10000370 Ga0105251_1000037038 170
204 3300009011 Ga0105251_10000374 Ga0105251_1000037410 170
205 3300009011 Ga0105251_10000511 Ga0105251_1000051136 170
206 3300009011 Ga0105251_10001094 Ga0105251_1000109416 170
207 3300009011 Ga0105251_10006664 Ga0105251_100066648 170
208 3300009011 Ga0105251_10017712 Ga0105251_100177124 170
209 3300009011 Ga0105251_10018927 Ga0105251_100189273 170
210 3300009036 Ga0105244_10000006 Ga0105244_10000006346 170
211 3300009036 Ga0105244_10000183 Ga0105244_1000018335 170
212 3300009036 Ga0105244_10000221 Ga0105244_1000022136 170
213 3300009036 Ga0105244_10000572 Ga0105244_1000057236 170
214 3300009036 Ga0105244_10001185 Ga0105244_1000118522 170
215 3300009036 Ga0105244_10004231 Ga0105244_100042317 170
216 3300009036 Ga0105244_10021827 Ga0105244_100218273 170
217 3300009036 Ga0105244_10029559 Ga0105244_100295592 170
218 3300009036 Ga0105244_10066222 Ga0105244_100662222 170
219 3300009092 Ga0105250_10000003 Ga0105250_10000003238 170
220 3300009092 Ga0105250_10000026 Ga0105250_10000026141 170
221 3300009092 Ga0105250_10000133 Ga0105250_100001336 170
222 3300009092 Ga0105250_10000326 Ga0105250_1000032634 170
223 3300009092 Ga0105250_10016248 Ga0105250_100162485 170
224 3300009092 Ga0105250_10019474 Ga0105250_100194745 170
225 3300009092 Ga0105250_10217248 Ga0105250_102172481 170
226 3300009093 Ga0105240_10623980 Ga0105240_106239802 170
227 3300009101 Ga0105247_10000018 Ga0105247_10000018188 170
228 3300009148 Ga0105243_10012094 Ga0105243_100120943 170
229 3300009148 Ga0105243_10267731 Ga0105243_102677312 170
230 3300009174 Ga0105241_10000004 Ga0105241_10000004460 170
231 3300013100 Ga0157373_10099302 Ga0157373_100993023 170
232 3300013100 Ga0157373_10132514 Ga0157373_101325143 170
233 3300013102 Ga0157371_10000101 Ga0157371_1000010119 170
234 3300013102 Ga0157371_10108151 Ga0157371_101081515 170
235 3300013102 Ga0157371_10108152 Ga0157371_101081525 170
236 3300013104 Ga0157370_10000567 Ga0157370_1000056712 170
237 3300013105 Ga0157369_10024023 Ga0157369_100240234 170
238 3300013306 Ga0163162_10106411 Ga0163162_101064115 170
239 3300013307 Ga0157372_10059046 Ga0157372_100590464 170
240 3300013307 Ga0157372_10072180 Ga0157372_100721802 170
241 3300014325 Ga0163163_10216868 Ga0163163_102168682 170
242 3300014497 Ga0182008_10004157 Ga0182008_100041577 170
243 3300015261 Ga0182006_1000063 Ga0182006_100006346 170
244 3300015679 Ga0183366_1001 Ga0183366_1001524 170
245 3300015679 Ga0183366_1002 Ga0183366_100291 170
246 3300015680 Ga0183370_1001 Ga0183370_1001524 170
247 3300015680 Ga0183370_1002 Ga0183370_100291 170
248 3300015685 Ga0183369_1001 Ga0183369_1001524 170
249 3300015685 Ga0183369_1002 Ga0183369_100291 170
250 3300015687 Ga0183368_1001 Ga0183368_1001524 170
251 3300015687 Ga0183368_1005 Ga0183368_100591 170
252 3300016635 Ga0183361_10585 Ga0183361_105852 170
253 3300017792 Ga0163161_10000001 Ga0163161_1000000134 170
254 3300017792 Ga0163161_10314735 Ga0163161_103147351 170
255 3300021384 Ga0213876_10000166 Ga0213876_1000016641 170
256 3300025207 Ga0209760_100001 Ga0209760_100001226 170
257 3300025224 Ga0209784_100001 Ga0209784_1000011050 170
258 3300025225 Ga0209566_100001 Ga0209566_1000011050 170
259 3300025226 Ga0209674_100002 Ga0209674_1000021050 170
260 3300025230 Ga0209563_100008 Ga0209563_1000081051 170
261 3300025231 Ga0207427_100002 Ga0207427_100002226 170
262 3300025233 Ga0209437_100007 Ga0209437_100007503 170
263 3300025253 Ga0209677_100004 Ga0209677_1000041051 170
264 3300025258 Ga0209129_1000015 Ga0209129_1000015464 170
265 3300025261 Ga0209233_1001167 Ga0209233_10011672 170
266 3300025711 Ga0207696_1000001 Ga0207696_1000001103 170
267 3300025711 Ga0207696_1000003 Ga0207696_1000003686 170
268 3300025711 Ga0207696_1000004 Ga0207696_1000004395 170
269 3300025711 Ga0207696_1000059 Ga0207696_100005991 170
270 3300025711 Ga0207696_1000415 Ga0207696_100041510 170
271 3300025711 Ga0207696_1001947 Ga0207696_10019474 170
272 3300025711 Ga0207696_1009075 Ga0207696_10090752 170
273 3300025711 Ga0207696_1011582 Ga0207696_10115823 170
274 3300025728 Ga0207655_1000001 Ga0207655_1000001583 170
275 3300025728 Ga0207655_1000011 Ga0207655_1000011371 170
276 3300025728 Ga0207655_1000032 Ga0207655_1000032315 170
277 3300025728 Ga0207655_1000149 Ga0207655_100014979 170
278 3300025728 Ga0207655_1000157 Ga0207655_100015745 170
279 3300025728 Ga0207655_1000260 Ga0207655_100026046 170
280 3300025728 Ga0207655_1000334 Ga0207655_100033437 170
281 3300025728 Ga0207655_1000370 Ga0207655_100037035 170
282 3300025728 Ga0207655_1004497 Ga0207655_10044978 170
283 3300025728 Ga0207655_1034567 Ga0207655_10345674 170
284 3300025735 Ga0207713_1000005 Ga0207713_100000571 170
285 3300025735 Ga0207713_1000006 Ga0207713_1000006434 170
286 3300025735 Ga0207713_1000024 Ga0207713_100002429 170
287 3300025735 Ga0207713_1000059 Ga0207713_100005938 170
288 3300025735 Ga0207713_1000316 Ga0207713_100031651 170
289 3300025735 Ga0207713_1001682 Ga0207713_100168214 170
290 3300025735 Ga0207713_1004701 Ga0207713_10047016 170
291 3300025735 Ga0207713_1027264 Ga0207713_10272645 170
292 3300025735 Ga0207713_1036719 Ga0207713_10367192 170
293 3300025735 Ga0207713_1096987 Ga0207713_10969872 170
294 3300025735 Ga0207713_1157394 Ga0207713_11573942 170
295 3300025900 Ga0207710_10000049 Ga0207710_10000049118 170
296 3300025911 Ga0207654_10000006 Ga0207654_10000006477 170
297 3300025935 Ga0207709_10004155 Ga0207709_1000415511 170
298 3300026116 Ga0207674_10002565 Ga0207674_1000256516 170
299 3300027111 Ga0209281_1000001 Ga0209281_10000011368 170
300 3300027111 Ga0209281_1000008 Ga0209281_1000008320 170
301 3300027111 Ga0209281_1000021 Ga0209281_100002141 170
302 3300027111 Ga0209281_1000101 Ga0209281_1000101170 170
303 3300027111 Ga0209281_1000148 Ga0209281_1000148134 170
304 3300027111 Ga0209281_1000201 Ga0209281_100020140 170
305 3300027111 Ga0209281_1000291 Ga0209281_100029155 170
306 3300027111 Ga0209281_1000780 Ga0209281_10007804 170
307 3300027111 Ga0209281_1001376 Ga0209281_100137613 170
308 3300027111 Ga0209281_1001548 Ga0209281_100154814 170
309 3300027111 Ga0209281_1004537 Ga0209281_10045373 170
310 3300027312 Ga0209371_1000001 Ga0209371_1000001483 170
311 3300027312 Ga0209371_1000047 Ga0209371_1000047209 170
312 3300027312 Ga0209371_1000056 Ga0209371_100005695 170
313 3300027312 Ga0209371_1000742 Ga0209371_100074218 170
314 3300027312 Ga0209371_1002495 Ga0209371_10024954 170
315 3300027312 Ga0209371_1002999 Ga0209371_10029998 170
316 3300027312 Ga0209371_1010394 Ga0209371_10103942 170
317 3300027312 Ga0209371_1018865 Ga0209371_10188652 170
318 3300027312 Ga0209371_1058977 Ga0209371_10589771 170
319 3300028379 Ga0268266_10542653 Ga0268266_105426532 170
320 3300030500 Ga0268256_1000001 Ga0268256_10000012158 170
321 3300030500 Ga0268256_1000003 Ga0268256_1000003505 170
322 3300030500 Ga0268256_1000071 Ga0268256_1000071138 170
323 3300030500 Ga0268256_1000548 Ga0268256_100054812 170
324 3300030500 Ga0268256_1002228 Ga0268256_10022288 170
325 3300030500 Ga0268256_1006961 Ga0268256_10069614 170
326 3300030500 Ga0268256_1011149 Ga0268256_10111492 170
327 3300030500 Ga0268256_1030732 Ga0268256_10307321 170
328 3300030500 Ga0268256_1063177 Ga0268256_10631772 170
329 3300031711 Ga0265314_10565634 Ga0265314_105656341 170
330 3300032133 Ga0316583_10065676 Ga0316583_100656762 170
331 3300035398 Ga0316574_0032426 Ga0316574_0032426_47_583 170
332 3300036647 Ga0316582_0356719 Ga0316582_0356719_193_729 170
333 3300038725 Ga0400484_24055 Ga0400484_24055_221_751 170
334 3300038725 Ga0400484_26797 Ga0400484_26797_803_1333 170
335 3300038726 Ga0400490_00993 Ga0400490_00993_7544_8074 170
336 3300038727 Ga0400491_01827 Ga0400491_01827_1121_1651 170
337 3300038735 Ga0400485_07939 Ga0400485_07939_929_1459 170
338 3300038741 Ga0400488_04209 Ga0400488_04209_5716_6246 170
339 3300038741 Ga0400488_18821 Ga0400488_18821_1043_1573 170
340 3300038741 Ga0400488_20547 Ga0400488_20547_387_941 170
341 3300039062 Ga0400483_109289 Ga0400483_109289_2357_2869 170
342 3300039062 Ga0400483_277931 Ga0400483_277931_36797_37327 170
343 3300039110 Ga0400487_45355 Ga0400487_45355_1768_2298 170
344 3300039437 Ga0436365_0105401 Ga0436365_0105401_42541_43053 170
345 3300039437 Ga0436365_1850428 Ga0436365_1850428_286_798 170
346 3300041405 Ga0439438_005168 Ga0439438_005168_3628_4140 170
347 3300041405 Ga0439438_032469 Ga0439438_032469_112_657 170
348 3300041405 Ga0439438_048992 Ga0439438_048992_53_565 170
349 3300042006 Ga0439432_002750 Ga0439432_002750_1258_1770 170
350 3300042010 Ga0439452_000003 Ga0439452_000003_414822_415334 170
351 3300042010 Ga0439452_000029 Ga0439452_000029_194265_194777 170
352 3300042010 Ga0439452_000220 Ga0439452_000220_8069_8581 170
353 3300042010 Ga0439452_003680 Ga0439452_003680_2586_3098 170
354 3300042137 Ga0450902_022839 Ga0450902_022839_150_662 170
355 3300044669 Ga0466981_0000023 Ga0466981_0000023_46558_47070 170
356 3300046453 Ga0495627_000028 Ga0495627_000028_175527_176039 170
357 3300046453 Ga0495627_023385 Ga0495627_023385_1294_1806 170
358 3300046458 Ga0495591_000380 Ga0495591_000380_31435_31947 170
359 3300046458 Ga0495591_002416 Ga0495591_002416_8684_9199 170
360 3300046460 Ga0495638_0004017 Ga0495638_0004017_7125_7637 170
361 3300046471 Ga0495650_0000016 Ga0495650_0000016_140426_140938 170
362 3300046501 Ga0495607_0005503 Ga0495607_0005503_1899_2414 170
363 3300046515 Ga0495620_0013817 Ga0495620_0013817_466_978 170
364 3300046520 Ga0495637_0047014 Ga0495637_0047014_849_1361 170
365 3300046520 Ga0495637_0052783 Ga0495637_0052783_1004_1516 170
366 3300046522 Ga0495643_0291443 Ga0495643_0291443_203_715 170
367 3300046530 Ga0495654_0000358 Ga0495654_0000358_29586_30098 170
368 3300046530 Ga0495654_0003824 Ga0495654_0003824_5585_6097 170
369 3300046530 Ga0495654_0009483 Ga0495654_0009483_81_623 170
370 3300046538 Ga0495609_0087388 Ga0495609_0087388_661_1173 170
371 3300046542 Ga0495597_0001596 Ga0495597_0001596_12999_13511 170
372 3300046660 Ga0495625_0011116 Ga0495625_0011116_5502_6044 170
373 3300046674 Ga0495588_0029153 Ga0495588_0029153_1914_2426 170
374 3300046694 Ga0495649_0000984 Ga0495649_0000984_4973_5485 170
375 3300046694 Ga0495649_0001470 Ga0495649_0001470_17170_17682 170
376 3300046794 Ga0495589_0000002 Ga0495589_0000002_530555_531067 170
377 3300046810 Ga0495660_0000007 Ga0495660_0000007_96793_97305 170
378 3300047320 Ga0495672_0000004 Ga0495672_0000004_118190_118705 170
379 3300047320 Ga0495672_0000070 Ga0495672_0000070_37311_37823 170
380 3300047446 Ga0495679_000021 Ga0495679_000021_166896_167438 170
381 3300047446 Ga0495679_000893 Ga0495679_000893_18151_18663 170
382 3300047469 Ga0495673_0000022 Ga0495673_0000022_217035_217547 170
383 3300047469 Ga0495673_0000023 Ga0495673_0000023_34199_34714 170
384 3300047470 Ga0495681_0059184 Ga0495681_0059184_1101_1613 170
385 3300047470 Ga0495681_0098170 Ga0495681_0098170_404_916 170
386 3300048904 Ga0496101_0162376 Ga0496101_0162376_530_1042 170
387 3300048906 Ga0496103_0082173 Ga0496103_0082173_1460_1972 170
388 3300048907 Ga0496104_0000256 Ga0496104_0000256_4398_4910 170
389 3300048907 Ga0496104_0000747 Ga0496104_0000747_18414_18926 170
390 3300048908 Ga0496105_0068433 Ga0496105_0068433_395_907 170
391 3300048908 Ga0496105_0271793 Ga0496105_0271793_384_896 170
392 3300048916 Ga0496113_1123732 Ga0496113_1123732_28_540 170
393 3300048919 Ga0496116_0000023 Ga0496116_0000023_37768_38280 170
394 3300048919 Ga0496116_0000127 Ga0496116_0000127_96645_97157 170
395 3300048919 Ga0496116_0020321 Ga0496116_0020321_1273_1785 170
396 3300048919 Ga0496116_0023585 Ga0496116_0023585_2998_3510 170
397 3300048919 Ga0496116_0299349 Ga0496116_0299349_19_531 170
398 3300048919 Ga0496116_0327480 Ga0496116_0327480_33_545 170
399 3300048920 Ga0496117_0001660 Ga0496117_0001660_1749_2261 170
400 3300048920 Ga0496117_0001826 Ga0496117_0001826_17879_18391 170
401 3300048920 Ga0496117_0001907 Ga0496117_0001907_1267_1779 170
402 3300048920 Ga0496117_0007050 Ga0496117_0007050_1464_1976 170
403 3300048920 Ga0496117_0018339 Ga0496117_0018339_4023_4535 170
404 3300048920 Ga0496117_0022556 Ga0496117_0022556_3127_3639 170
405 3300048920 Ga0496117_0028838 Ga0496117_0028838_2961_3473 170
406 3300048920 Ga0496117_0106902 Ga0496117_0106902_908_1420 170
407 3300048920 Ga0496117_0139202 Ga0496117_0139202_642_1154 170
408 3300048920 Ga0496117_0151722 Ga0496117_0151722_496_1008 170
409 3300048920 Ga0496117_0327218 Ga0496117_0327218_119_634 170
410 3300048921 Ga0496118_0001275 Ga0496118_0001275_27149_27661 170
411 3300048921 Ga0496118_0002095 Ga0496118_0002095_24300_24812 170
412 3300048921 Ga0496118_0011653 Ga0496118_0011653_887_1399 170
413 3300048921 Ga0496118_0015676 Ga0496118_0015676_2196_2708 170
414 3300048921 Ga0496118_0015816 Ga0496118_0015816_1169_1681 170
415 3300048921 Ga0496118_0017441 Ga0496118_0017441_2835_3347 170
416 3300048921 Ga0496118_0069105 Ga0496118_0069105_1156_1668 170
417 3300048921 Ga0496118_0350155 Ga0496118_0350155_142_654 170
418 3300048922 Ga0496119_0000529 Ga0496119_0000529_46403_46915 170
419 3300048922 Ga0496119_0001020 Ga0496119_0001020_14454_14966 170
420 3300048922 Ga0496119_0007193 Ga0496119_0007193_4460_4975 170
421 3300048922 Ga0496119_0009612 Ga0496119_0009612_2867_3382 170
422 3300048922 Ga0496119_0042651 Ga0496119_0042651_1137_1649 170
423 3300048922 Ga0496119_0047650 Ga0496119_0047650_1448_1960 170
424 3300048922 Ga0496119_0075040 Ga0496119_0075040_286_798 170
425 3300048922 Ga0496119_0090213 Ga0496119_0090213_63_575 170
426 3300048922 Ga0496119_0162968 Ga0496119_0162968_604_1116 170
427 3300048923 Ga0496120_0002219 Ga0496120_0002219_15177_15692 170
428 3300048923 Ga0496120_0003841 Ga0496120_0003841_4575_5090 170
429 3300048923 Ga0496120_0007700 Ga0496120_0007700_688_1200 170
430 3300048923 Ga0496120_0011835 Ga0496120_0011835_4913_5425 170
431 3300048923 Ga0496120_0014525 Ga0496120_0014525_407_919 170
432 3300048923 Ga0496120_0017254 Ga0496120_0017254_2336_2848 170
433 3300048923 Ga0496120_0042380 Ga0496120_0042380_1536_2048 170
434 3300048923 Ga0496120_0078356 Ga0496120_0078356_1169_1681 170
435 3300048923 Ga0496120_0098277 Ga0496120_0098277_430_942 170
436 3300048923 Ga0496120_0161956 Ga0496120_0161956_545_1057 170
437 3300048924 Ga0496121_0000358 Ga0496121_0000358_51864_52376 170
438 3300048924 Ga0496121_0002246 Ga0496121_0002246_27119_27631 170
439 3300048924 Ga0496121_0005439 Ga0496121_0005439_9458_9970 170
440 3300048924 Ga0496121_0005522 Ga0496121_0005522_1933_2445 170
441 3300048924 Ga0496121_0026703 Ga0496121_0026703_4055_4567 170
442 3300048924 Ga0496121_0028947 Ga0496121_0028947_1166_1678 170
443 3300048924 Ga0496121_0032900 Ga0496121_0032900_1725_2237 170
444 3300048925 Ga0496122_0000013 Ga0496122_0000013_144724_145236 170
445 3300048925 Ga0496122_0000099 Ga0496122_0000099_42682_43194 170
446 3300048925 Ga0496122_0001096 Ga0496122_0001096_26931_27443 170
447 3300048925 Ga0496122_0001159 Ga0496122_0001159_37484_37996 170
448 3300048925 Ga0496122_0019192 Ga0496122_0019192_720_1232 170
449 3300048925 Ga0496122_0048198 Ga0496122_0048198_2705_3217 170
450 3300048925 Ga0496122_0100694 Ga0496122_0100694_494_1006 170
451 3300048925 Ga0496122_0101996 Ga0496122_0101996_909_1421 170
452 3300048925 Ga0496122_0121018 Ga0496122_0121018_925_1437 170
453 3300048925 Ga0496122_0168912 Ga0496122_0168912_431_943 170
454 3300048925 Ga0496122_0172392 Ga0496122_0172392_554_1066 170
455 3300048925 Ga0496122_0427719 Ga0496122_0427719_69_581 170
456 3300048925 Ga0496122_0427728 Ga0496122_0427728_83_595 170
457 3300048926 Ga0496123_0000005 Ga0496123_0000005_257249_257761 170
458 3300048926 Ga0496123_0000010 Ga0496123_0000010_355804_356316 170
459 3300048926 Ga0496123_0000876 Ga0496123_0000876_19809_20321 170
460 3300048926 Ga0496123_0003763 Ga0496123_0003763_277_789 170
461 3300048926 Ga0496123_0012809 Ga0496123_0012809_3754_4266 170
462 3300048926 Ga0496123_0016160 Ga0496123_0016160_4395_4907 170
463 3300048926 Ga0496123_0028319 Ga0496123_0028319_1310_1822 170
464 3300048926 Ga0496123_0032887 Ga0496123_0032887_174_686 170
465 3300048926 Ga0496123_0187434 Ga0496123_0187434_17_529 170
466 3300048926 Ga0496123_0218015 Ga0496123_0218015_436_948 170
467 3300048926 Ga0496123_0221639 Ga0496123_0221639_235_747 170
468 3300048927 Ga0496124_0000039 Ga0496124_0000039_13253_13768 170
469 3300048927 Ga0496124_0000515 Ga0496124_0000515_19795_20307 170
470 3300048927 Ga0496124_0001815 Ga0496124_0001815_11988_12500 170
471 3300048927 Ga0496124_0002100 Ga0496124_0002100_1956_2468 170
472 3300048927 Ga0496124_0017069 Ga0496124_0017069_6027_6539 170
473 3300048927 Ga0496124_0076325 Ga0496124_0076325_478_990 170
474 3300048927 Ga0496124_0182506 Ga0496124_0182506_805_1317 170
475 3300048927 Ga0496124_0216874 Ga0496124_0216874_16_528 170
476 3300048927 Ga0496124_0274155 Ga0496124_0274155_702_1214 170
477 3300048927 Ga0496124_0354996 Ga0496124_0354996_21_533 170
478 3300048927 Ga0496124_0831292 Ga0496124_0831292_24_536 170
479 3300048928 Ga0496125_0000016 Ga0496125_0000016_111473_111985 170
480 3300048928 Ga0496125_0000019 Ga0496125_0000019_86446_86958 170
481 3300048928 Ga0496125_0000369 Ga0496125_0000369_31884_32396 170
482 3300048928 Ga0496125_0011210 Ga0496125_0011210_3630_4142 170
483 3300048928 Ga0496125_0023610 Ga0496125_0023610_315_827 170
484 3300048928 Ga0496125_0029224 Ga0496125_0029224_3558_4070 170
485 3300048928 Ga0496125_0043025 Ga0496125_0043025_1273_1785 170
486 3300048928 Ga0496125_0043626 Ga0496125_0043626_357_869 170
487 3300048928 Ga0496125_0049668 Ga0496125_0049668_47_559 170
488 3300048928 Ga0496125_0146435 Ga0496125_0146435_1073_1585 170
489 3300048928 Ga0496125_0247132 Ga0496125_0247132_502_1014 170
490 3300048929 Ga0496126_0000346 Ga0496126_0000346_59535_60047 170
491 3300048929 Ga0496126_0000736 Ga0496126_0000736_50972_51484 170
492 3300048929 Ga0496126_0023668 Ga0496126_0023668_2427_2939 170
493 3300048929 Ga0496126_0041682 Ga0496126_0041682_437_949 170
494 3300048929 Ga0496126_0151218 Ga0496126_0151218_1291_1803 170
495 3300048929 Ga0496126_0244755 Ga0496126_0244755_491_1003 170
496 3300048929 Ga0496126_0527127 Ga0496126_0527127_354_866 170
497 3300048929 Ga0496126_0864543 Ga0496126_0864543_62_574 170
498 3300049576 Ga0501040_0197594 Ga0501040_0197594_53_598 170
499 3300049591 Ga0501075_0058120 Ga0501075_0058120_420_965 170
500 3300049655 Ga0501208_004697 Ga0501208_004697_939_1505 170
501 3300050491 nmdc:mga00v17_47388_c1 nmdc:mga00v17_47388_c1_239_751 170
502 3300050491 nmdc:mga00v17_538_c1 nmdc:mga00v17_538_c1_14622_15188 170
503 3300050493 nmdc:mga0k408_4828_c3 nmdc:mga0k408_4828_c3_62_574 170

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

23

166

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mkz-assembly1.cif.gz_A crystal structure of moab protein at 1.6 a resolution. 0.9874 5 170
1r2k-assembly1.cif.gz_B crystal structure of moab from escherichia coli 0.9853 5 170
1r2k-assembly1.cif.gz_B crystal structure of moab from escherichia coli 0.968 5 170
1y5e-assembly1.cif.gz_C crystal structure of molybdenum cofactor biosynthesis protein b 0.9482 3 155
3iwt-assembly1.cif.gz_A structure of hypothetical molybdenum cofactor biosynthesis protein b from sulfolobus tokodaii 0.9446 9 151
ID Description Score Start End Superfamily
1r2kA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9851 5 170 3.40.980.10
1r2kA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9675 5 170 3.40.980.10
1y5eB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9486 3 155 3.40.980.10
2pjkA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9443 9 151 3.40.980.10
af_P39205_1_179_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.929 10 155 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A1N7FG22-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9965 6 170 GO:0005829
GO:0006777
AF-A0A5E7BI58-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9961 6 170 GO:0005829
GO:0006777
AF-A0A446AUT0-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.996 6 170 GO:0005829
GO:0006777
AF-A0A1Q8ENU0-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9957 6 170 GO:0005829
GO:0006777
AF-A0A3L8BDX0-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9952 7 167 GO:0005829
GO:0006777

Feature Viewer

pLDDT pTM Quality
95.11 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map