F455952
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 503 | 360 | 454 | 169 |
Family's Representative Sequence
| Representative Sequence | 3300002738|JGI25154J39366_1000025|JGI25154J39366_100002511 |
| Length | 197 |
| Sequence | MSEPFLAMLILFGGNFAIRGWAMAWGQILSIAQNTALFSLLGTTYGGNGQTTFALPDLRGRAPIGWGQGPGLSNYSLGQIGGTENTTLLITNMPAHNHTGVISGGTSTISASTGAGTTNTPGPTMVPAVLPTIGSGPGATQIKGYKVQDNTTTLAPGTVSGNVTIGIAGGSQPFSIQNPYLALTYLIALEGIFPSRN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 3 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 4 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 5 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 6 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 7 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 8 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 9 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 10 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 11 | 2865002811 | Paenibacillus sp. R-74131 | Isolate | Unclassified |
| 12 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 13 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 14 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 15 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 16 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 17 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 18 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 19 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 20 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 21 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 22 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 23 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 24 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 25 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 26 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 27 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 28 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 29 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 30 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 31 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 32 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 33 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 34 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 35 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 36 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 37 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 38 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 39 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 40 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 41 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 42 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 43 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 44 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 45 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 46 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 47 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 48 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 49 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 50 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 51 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 53 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 54 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 55 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 56 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 57 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 58 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 59 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 60 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 61 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 62 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 66 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 69 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 71 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 96 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 103 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 105 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 106 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 107 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 109 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 110 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 111 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 112 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 113 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 114 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 115 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 116 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 117 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 118 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 119 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 120 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 121 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 122 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 123 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 125 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 127 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 128 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 129 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 130 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 131 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 132 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 134 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 157 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 162 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 163 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 164 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 166 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 169 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 222 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 225 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 227 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 228 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 229 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 231 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 233 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 234 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 235 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 237 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 238 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 239 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 240 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 241 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 245 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 246 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 247 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 248 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 249 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 250 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 251 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 253 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 254 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 255 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 256 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 257 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 258 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 259 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 260 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 261 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 262 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 263 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 264 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 265 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 266 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 267 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 268 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 269 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 300 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 301 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 302 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 303 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 304 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 305 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 306 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 307 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 320 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 321 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 324 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 325 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 328 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 329 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 330 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 331 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 340 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 343 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 344 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 346 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 347 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 349 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 359 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 360 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.87 |
| Metatranscriptomes | 1.99 |
| Isolates | 9.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.36 |
| Nodule | 6.76 |
| Rhizoplane | 3.38 |
| Rhizosphere | 75.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_3585791 | 2162886011 | Bacteria | 941 |
| 2 | LJQas_1010480 | 3300000549 | Bacteria | 1110 |
| 3 | JGI24736J21556_1021942 | 3300001904 | Bacteria | 1000 |
| 4 | JGI24740J21852_10010677 | 3300001979 | Bacteria | 3525 |
| 5 | JGI24743J22301_10069433 | 3300001991 | Bacteria | 734 |
| 6 | JGI25156J39149_1008579 | 3300002705 | Bacteria | 2557 |
| 7 | JGI25154J39366_1000025 | 3300002738 | Bacteria | 211189 |
| 8 | JGI25157J39369_1000700 | 3300002741 | Bacteria | 18085 |
| 9 | JGI25157J39369_1002640 | 3300002741 | Unclassified | 4209 |
| 10 | JGI25406J46586_10118235 | 3300003203 | Bacteria | 781 |
| 11 | JGI25153J46596_10002276 | 3300003215 | Bacteria | 11185 |
| 12 | rootH1_10041215 | 3300003323 | Bacteria | 2479 |
| 13 | rootH1_10067345 | 3300003323 | Bacteria | 3056 |
| 14 | rootH1_10303365 | 3300003323 | Bacteria | 2866 |
| 15 | JGI25160J50197_1006075 | 3300003354 | Bacteria | 4929 |
| 16 | Ga0055535_1001614 | 3300003761 | Bacteria | 10567 |
| 17 | Ga0055542_1013046 | 3300003762 | Bacteria | 1413 |
| 18 | Ga0058863_10026864 | 3300004799 | Unclassified | 965 |
| 19 | Ga0065165_1013992 | 3300005262 | Bacteria | 3143 |
| 20 | Ga0065714_10037453 | 3300005288 | Bacteria | 959 |
| 21 | Ga0065714_10146305 | 3300005288 | Bacteria | 1136 |
| 22 | Ga0065714_10153743 | 3300005288 | Bacteria | 1090 |
| 23 | Ga0065704_10142336 | 3300005289 | Bacteria | 1459 |
| 24 | Ga0065712_10080023 | 3300005290 | Bacteria | 3153 |
| 25 | Ga0065712_10149860 | 3300005290 | Bacteria | 1378 |
| 26 | Ga0070676_10243677 | 3300005328 | Bacteria | 1197 |
| 27 | Ga0070690_100005999 | 3300005330 | Bacteria | 6863 |
| 28 | Ga0070690_100051113 | 3300005330 | Bacteria | 2637 |
| 29 | Ga0070670_100004949 | 3300005331 | Bacteria | 11211 |
| 30 | Ga0070670_100381828 | 3300005331 | Bacteria | 1241 |
| 31 | Ga0068869_100001770 | 3300005334 | Bacteria | 12931 |
| 32 | Ga0068869_100103319 | 3300005334 | Bacteria | 2159 |
| 33 | Ga0068869_100901227 | 3300005334 | Bacteria | 765 |
| 34 | Ga0070666_10006804 | 3300005335 | Bacteria | 7044 |
| 35 | Ga0070680_100024813 | 3300005336 | Bacteria | 4792 |
| 36 | Ga0068868_100000513 | 3300005338 | Bacteria | 25868 |
| 37 | Ga0068868_100099612 | 3300005338 | Bacteria | 2351 |
| 38 | Ga0070660_100011649 | 3300005339 | Bacteria | 6259 |
| 39 | Ga0070689_100023208 | 3300005340 | Bacteria | 4642 |
| 40 | Ga0070689_100061486 | 3300005340 | Bacteria | 2922 |
| 41 | Ga0070691_10528455 | 3300005341 | Bacteria | 686 |
| 42 | Ga0070687_100137167 | 3300005343 | Bacteria | 1420 |
| 43 | Ga0070687_100739015 | 3300005343 | Unclassified | 691 |
| 44 | Ga0070661_100081367 | 3300005344 | Bacteria | 2391 |
| 45 | Ga0070692_10011135 | 3300005345 | Bacteria | 4121 |
| 46 | Ga0070692_10018199 | 3300005345 | Bacteria | 3373 |
| 47 | Ga0070692_10048312 | 3300005345 | Unclassified | 2204 |
| 48 | Ga0070668_100012747 | 3300005347 | Bacteria | 6257 |
| 49 | Ga0070669_100024053 | 3300005353 | Unclassified | 4365 |
| 50 | Ga0070669_100069679 | 3300005353 | Bacteria | 2598 |
| 51 | Ga0070669_100362676 | 3300005353 | Bacteria | 1179 |
| 52 | Ga0070671_100095480 | 3300005355 | Bacteria | 2492 |
| 53 | Ga0070671_100166668 | 3300005355 | Bacteria | 1863 |
| 54 | Ga0070674_100618437 | 3300005356 | Unclassified | 917 |
| 55 | Ga0070673_100022523 | 3300005364 | Bacteria | 4587 |
| 56 | Ga0070673_101198068 | 3300005364 | Unclassified | 711 |
| 57 | Ga0070659_100000437 | 3300005366 | Bacteria | 31405 |
| 58 | Ga0070667_100075014 | 3300005367 | Bacteria | 2887 |
| 59 | Ga0070667_100460872 | 3300005367 | Bacteria | 1162 |
| 60 | Ga0070709_10075324 | 3300005434 | Bacteria | 2189 |
| 61 | Ga0070713_101225766 | 3300005436 | Bacteria | 726 |
| 62 | Ga0070710_10498593 | 3300005437 | Bacteria | 833 |
| 63 | Ga0070711_100018416 | 3300005439 | Bacteria | 4458 |
| 64 | Ga0070705_100595508 | 3300005440 | Unclassified | 854 |
| 65 | Ga0070705_100972921 | 3300005440 | Unclassified | 687 |
| 66 | Ga0070700_100001026 | 3300005441 | Bacteria | 13798 |
| 67 | Ga0070700_100092403 | 3300005441 | Unclassified | 1977 |
| 68 | Ga0070694_100036907 | 3300005444 | Unclassified | 3239 |
| 69 | Ga0070663_100767764 | 3300005455 | Unclassified | 824 |
| 70 | Ga0070662_100095471 | 3300005457 | Bacteria | 2241 |
| 71 | Ga0070662_100155982 | 3300005457 | Unclassified | 1782 |
| 72 | Ga0070685_10045374 | 3300005466 | Bacteria | 2520 |
| 73 | Ga0070685_10456124 | 3300005466 | Bacteria | 896 |
| 74 | Ga0070706_100906577 | 3300005467 | Bacteria | 814 |
| 75 | Ga0070707_100037936 | 3300005468 | Bacteria | 4601 |
| 76 | Ga0070697_100076984 | 3300005536 | Bacteria | 2744 |
| 77 | Ga0068853_100017586 | 3300005539 | Bacteria | 5900 |
| 78 | Ga0070686_100093282 | 3300005544 | Bacteria | 2018 |
| 79 | Ga0070695_100000714 | 3300005545 | Bacteria | 17670 |
| 80 | Ga0070695_100256098 | 3300005545 | Bacteria | 1276 |
| 81 | Ga0070696_100100244 | 3300005546 | Bacteria | 2074 |
| 82 | Ga0070693_100003595 | 3300005547 | Bacteria | 7236 |
| 83 | Ga0070693_100008236 | 3300005547 | Bacteria | 5127 |
| 84 | Ga0070665_100137064 | 3300005548 | Bacteria | 2450 |
| 85 | Ga0070704_100035895 | 3300005549 | Unclassified | 3373 |
| 86 | Ga0070704_100670284 | 3300005549 | Unclassified | 917 |
| 87 | Ga0070704_100686014 | 3300005549 | Bacteria | 907 |
| 88 | Ga0068855_100345358 | 3300005563 | Bacteria | 1640 |
| 89 | Ga0070664_100416443 | 3300005564 | Bacteria | 1230 |
| 90 | Ga0070664_100684623 | 3300005564 | Bacteria | 954 |
| 91 | Ga0068857_100711342 | 3300005577 | Bacteria | 955 |
| 92 | Ga0068854_100298763 | 3300005578 | Bacteria | 1302 |
| 93 | Ga0068854_100885214 | 3300005578 | Bacteria | 784 |
| 94 | Ga0068856_100019362 | 3300005614 | Bacteria | 6607 |
| 95 | Ga0070702_100209994 | 3300005615 | Bacteria | 1295 |
| 96 | Ga0068852_100015113 | 3300005616 | Bacteria | 5972 |
| 97 | Ga0068852_100052227 | 3300005616 | Bacteria | 3512 |
| 98 | Ga0068859_100079652 | 3300005617 | Bacteria | 3316 |
| 99 | Ga0068859_100099968 | 3300005617 | Bacteria | 2956 |
| 100 | Ga0068864_100055319 | 3300005618 | Bacteria | 3425 |
| 101 | Ga0068864_100469478 | 3300005618 | Bacteria | 1206 |
| 102 | Ga0068866_10059105 | 3300005718 | Bacteria | 1982 |
| 103 | Ga0068861_100027087 | 3300005719 | Bacteria | 4172 |
| 104 | Ga0068863_100095124 | 3300005841 | Bacteria | 2827 |
| 105 | Ga0068858_100091082 | 3300005842 | Bacteria | 2838 |
| 106 | Ga0068860_100078015 | 3300005843 | Bacteria | 3150 |
| 107 | Ga0068862_100021413 | 3300005844 | Bacteria | 5402 |
| 108 | Ga0068862_101022061 | 3300005844 | Bacteria | 818 |
| 109 | Ga0081538_10044625 | 3300005981 | Unclassified | 2762 |
| 110 | Ga0081539_10055841 | 3300005985 | Bacteria | 2194 |
| 111 | Ga0081539_10197210 | 3300005985 | Unclassified | 933 |
| 112 | Ga0075365_10039414 | 3300006038 | Bacteria | 3076 |
| 113 | Ga0075364_10000219 | 3300006051 | Bacteria | 27057 |
| 114 | Ga0075364_10025156 | 3300006051 | Bacteria | 3787 |
| 115 | Ga0075364_10054039 | 3300006051 | Bacteria | 2626 |
| 116 | Ga0070715_10000068 | 3300006163 | Bacteria | 33105 |
| 117 | Ga0070715_10238856 | 3300006163 | Bacteria | 944 |
| 118 | Ga0070716_100368775 | 3300006173 | Unclassified | 1022 |
| 119 | Ga0070716_100437164 | 3300006173 | Bacteria | 950 |
| 120 | Ga0070712_100088880 | 3300006175 | Bacteria | 2258 |
| 121 | Ga0070712_100596128 | 3300006175 | Bacteria | 935 |
| 122 | Ga0075367_10099756 | 3300006178 | Bacteria | 1774 |
| 123 | Ga0097621_100010379 | 3300006237 | Bacteria | 6812 |
| 124 | Ga0075428_100152424 | 3300006844 | Bacteria | 2511 |
| 125 | Ga0075430_100023918 | 3300006846 | Bacteria | 5202 |
| 126 | Ga0075430_100032014 | 3300006846 | Bacteria | 4463 |
| 127 | Ga0075430_100137547 | 3300006846 | Bacteria | 2035 |
| 128 | Ga0075431_100002439 | 3300006847 | Bacteria | 17891 |
| 129 | Ga0075431_100089044 | 3300006847 | Bacteria | 3186 |
| 130 | Ga0075431_100305824 | 3300006847 | Bacteria | 1606 |
| 131 | Ga0075433_10203048 | 3300006852 | Bacteria | 1762 |
| 132 | Ga0075434_100056963 | 3300006871 | Bacteria | 3884 |
| 133 | Ga0068865_100050201 | 3300006881 | Bacteria | 2880 |
| 134 | Ga0097620_100079652 | 3300006931 | Bacteria | 3316 |
| 135 | Ga0097620_100099964 | 3300006931 | Bacteria | 2956 |
| 136 | Ga0075435_100263784 | 3300007076 | Bacteria | 1468 |
| 137 | Ga0105251_10043885 | 3300009011 | Bacteria | 2163 |
| 138 | Ga0105244_10081516 | 3300009036 | Bacteria | 1601 |
| 139 | Ga0105245_10067605 | 3300009098 | Bacteria | 3236 |
| 140 | Ga0105247_10065465 | 3300009101 | Bacteria | 2261 |
| 141 | Ga0105247_11191589 | 3300009101 | Bacteria | 606 |
| 142 | Ga0114129_10017606 | 3300009147 | Bacteria | 10171 |
| 143 | Ga0114129_10210844 | 3300009147 | Bacteria | 2626 |
| 144 | Ga0114129_10263576 | 3300009147 | Bacteria | 2308 |
| 145 | Ga0114129_10846272 | 3300009147 | Bacteria | 1163 |
| 146 | Ga0114129_11400649 | 3300009147 | Bacteria | 863 |
| 147 | Ga0114129_11651391 | 3300009147 | Bacteria | 783 |
| 148 | Ga0105243_10315082 | 3300009148 | Bacteria | 1423 |
| 149 | Ga0105243_10828415 | 3300009148 | Bacteria | 914 |
| 150 | Ga0105243_11838428 | 3300009148 | Bacteria | 637 |
| 151 | Ga0105241_10512710 | 3300009174 | Bacteria | 1071 |
| 152 | Ga0105242_10001700 | 3300009176 | Bacteria | 17415 |
| 153 | Ga0105242_10005282 | 3300009176 | Bacteria | 9971 |
| 154 | Ga0105242_10110519 | 3300009176 | Bacteria | 2342 |
| 155 | Ga0105242_10227206 | 3300009176 | Bacteria | 1671 |
| 156 | Ga0105248_10247208 | 3300009177 | Bacteria | 2008 |
| 157 | Ga0105237_10316691 | 3300009545 | Bacteria | 1563 |
| 158 | Ga0105249_10000092 | 3300009553 | Bacteria | 125188 |
| 159 | Ga0105249_10210249 | 3300009553 | Bacteria | 1909 |
| 160 | Ga0105249_10282643 | 3300009553 | Bacteria | 1658 |
| 161 | Ga0105249_10353338 | 3300009553 | Bacteria | 1489 |
| 162 | Ga0105249_10714379 | 3300009553 | Bacteria | 1063 |
| 163 | Ga0105239_10794674 | 3300010375 | Bacteria | 1084 |
| 164 | Ga0105246_10351345 | 3300011119 | Bacteria | 1208 |
| 165 | Ga0157371_10341777 | 3300013102 | Bacteria | 1089 |
| 166 | Ga0157369_10483639 | 3300013105 | Bacteria | 1281 |
| 167 | Ga0157369_10850923 | 3300013105 | Unclassified | 936 |
| 168 | Ga0157374_10077447 | 3300013296 | Bacteria | 3147 |
| 169 | Ga0157374_10090146 | 3300013296 | Bacteria | 2922 |
| 170 | Ga0157378_10050897 | 3300013297 | Bacteria | 3685 |
| 171 | Ga0157378_10081313 | 3300013297 | Bacteria | 2928 |
| 172 | Ga0163162_10000002 | 3300013306 | Bacteria | 717331 |
| 173 | Ga0163162_10048688 | 3300013306 | Bacteria | 4247 |
| 174 | Ga0163162_10111213 | 3300013306 | Bacteria | 2837 |
| 175 | Ga0157372_11513665 | 3300013307 | Unclassified | 773 |
| 176 | Ga0157375_10086695 | 3300013308 | Bacteria | 3182 |
| 177 | Ga0163163_10099403 | 3300014325 | Bacteria | 2931 |
| 178 | Ga0157380_10009008 | 3300014326 | Bacteria | 7129 |
| 179 | Ga0157380_10016696 | 3300014326 | Bacteria | 5420 |
| 180 | Ga0157380_10173413 | 3300014326 | Unclassified | 1887 |
| 181 | Ga0157380_10442146 | 3300014326 | Bacteria | 1246 |
| 182 | Ga0182008_10000032 | 3300014497 | Bacteria | 162985 |
| 183 | Ga0157377_10093747 | 3300014745 | Bacteria | 1778 |
| 184 | Ga0157379_10049298 | 3300014968 | Bacteria | 3759 |
| 185 | Ga0157376_10133138 | 3300014969 | Bacteria | 2221 |
| 186 | Ga0157376_11272498 | 3300014969 | Bacteria | 765 |
| 187 | Ga0163161_10050447 | 3300017792 | Bacteria | 3012 |
| 188 | Ga0163161_10215541 | 3300017792 | Bacteria | 1484 |
| 189 | Ga0163161_10632850 | 3300017792 | Bacteria | 885 |
| 190 | Ga0213872_10045997 | 3300021361 | Bacteria | 1986 |
| 191 | Ga0213876_10000935 | 3300021384 | Bacteria | 19266 |
| 192 | Ga0213875_10227601 | 3300021388 | Bacteria | 878 |
| 193 | Ga0209258_100252 | 3300025242 | Bacteria | 97179 |
| 194 | Ga0209646_1000037 | 3300025246 | Bacteria | 355116 |
| 195 | Ga0209026_1000050 | 3300025250 | Bacteria | 254994 |
| 196 | Ga0209026_1000290 | 3300025250 | Bacteria | 56927 |
| 197 | Ga0209148_1000217 | 3300025254 | Bacteria | 98076 |
| 198 | Ga0209759_1000229 | 3300025256 | Bacteria | 83575 |
| 199 | Ga0209758_1007454 | 3300025297 | Bacteria | 7440 |
| 200 | Ga0207426_1000371 | 3300025302 | Bacteria | 79084 |
| 201 | Ga0209257_1033040 | 3300025304 | Bacteria | 1632 |
| 202 | Ga0207713_1113747 | 3300025735 | Bacteria | 916 |
| 203 | Ga0207682_10125532 | 3300025893 | Bacteria | 1142 |
| 204 | Ga0207642_10284038 | 3300025899 | Bacteria | 953 |
| 205 | Ga0207710_10016665 | 3300025900 | Bacteria | 3110 |
| 206 | Ga0207710_10116558 | 3300025900 | Bacteria | 1272 |
| 207 | Ga0207680_10050854 | 3300025903 | Bacteria | 2475 |
| 208 | Ga0207685_10000059 | 3300025905 | Bacteria | 33076 |
| 209 | Ga0207699_10588361 | 3300025906 | Bacteria | 810 |
| 210 | Ga0207699_10667961 | 3300025906 | Bacteria | 760 |
| 211 | Ga0207684_11009377 | 3300025910 | Unclassified | 696 |
| 212 | Ga0207695_11394358 | 3300025913 | Bacteria | 581 |
| 213 | Ga0207671_10169395 | 3300025914 | Bacteria | 1695 |
| 214 | Ga0207693_10075453 | 3300025915 | Bacteria | 2640 |
| 215 | Ga0207693_10111695 | 3300025915 | Bacteria | 2144 |
| 216 | Ga0207660_10112525 | 3300025917 | Bacteria | 2050 |
| 217 | Ga0207662_10101789 | 3300025918 | Bacteria | 1781 |
| 218 | Ga0207657_10007640 | 3300025919 | Bacteria | 11064 |
| 219 | Ga0207649_10098144 | 3300025920 | Bacteria | 1933 |
| 220 | Ga0207681_10100805 | 3300025923 | Bacteria | 2082 |
| 221 | Ga0207650_10036271 | 3300025925 | Bacteria | 3586 |
| 222 | Ga0207659_10096964 | 3300025926 | Bacteria | 2214 |
| 223 | Ga0207687_11116222 | 3300025927 | Bacteria | 677 |
| 224 | Ga0207700_10229675 | 3300025928 | Bacteria | 1577 |
| 225 | Ga0207700_10441137 | 3300025928 | Bacteria | 1146 |
| 226 | Ga0207644_10047647 | 3300025931 | Bacteria | 3059 |
| 227 | Ga0207644_10125202 | 3300025931 | Bacteria | 1961 |
| 228 | Ga0207690_10000535 | 3300025932 | Bacteria | 24774 |
| 229 | Ga0207706_10121990 | 3300025933 | Unclassified | 2292 |
| 230 | Ga0207706_10127371 | 3300025933 | Bacteria | 2239 |
| 231 | Ga0207686_10001331 | 3300025934 | Bacteria | 14069 |
| 232 | Ga0207686_10011983 | 3300025934 | Bacteria | 4759 |
| 233 | Ga0207686_10081792 | 3300025934 | Bacteria | 2109 |
| 234 | Ga0207686_10296884 | 3300025934 | Bacteria | 1199 |
| 235 | Ga0207670_10024018 | 3300025936 | Bacteria | 3805 |
| 236 | Ga0207704_10024455 | 3300025938 | Bacteria | 3276 |
| 237 | Ga0207704_10499082 | 3300025938 | Bacteria | 980 |
| 238 | Ga0207665_10086921 | 3300025939 | Bacteria | 2161 |
| 239 | Ga0207665_10426977 | 3300025939 | Unclassified | 1013 |
| 240 | Ga0207691_10020607 | 3300025940 | Bacteria | 6234 |
| 241 | Ga0207711_10041631 | 3300025941 | Bacteria | 3912 |
| 242 | Ga0207689_10011112 | 3300025942 | Bacteria | 7731 |
| 243 | Ga0207689_10170532 | 3300025942 | Bacteria | 1794 |
| 244 | Ga0207689_10237434 | 3300025942 | Bacteria | 1507 |
| 245 | Ga0207679_10313722 | 3300025945 | Bacteria | 1356 |
| 246 | Ga0207679_10554546 | 3300025945 | Bacteria | 1031 |
| 247 | Ga0207679_11136946 | 3300025945 | Bacteria | 716 |
| 248 | Ga0207667_10781721 | 3300025949 | Bacteria | 952 |
| 249 | Ga0207712_10000135 | 3300025961 | Bacteria | 77342 |
| 250 | Ga0207712_11567390 | 3300025961 | Unclassified | 590 |
| 251 | Ga0207668_10003342 | 3300025972 | Bacteria | 9398 |
| 252 | Ga0207640_10201376 | 3300025981 | Bacteria | 1509 |
| 253 | Ga0207640_10375268 | 3300025981 | Bacteria | 1151 |
| 254 | Ga0207658_10039642 | 3300025986 | Bacteria | 3399 |
| 255 | Ga0207677_10000065 | 3300026023 | Bacteria | 88193 |
| 256 | Ga0207677_10119925 | 3300026023 | Bacteria | 1976 |
| 257 | Ga0207703_10043031 | 3300026035 | Bacteria | 3623 |
| 258 | Ga0207639_10472393 | 3300026041 | Bacteria | 1142 |
| 259 | Ga0207708_10001475 | 3300026075 | Bacteria | 17580 |
| 260 | Ga0207708_10235062 | 3300026075 | Bacteria | 1472 |
| 261 | Ga0207702_10030748 | 3300026078 | Bacteria | 4473 |
| 262 | Ga0207641_10089104 | 3300026088 | Bacteria | 2695 |
| 263 | Ga0207676_10073518 | 3300026095 | Bacteria | 2751 |
| 264 | Ga0207675_100012195 | 3300026118 | Bacteria | 8028 |
| 265 | Ga0207683_10379328 | 3300026121 | Bacteria | 1299 |
| 266 | Ga0207698_10061202 | 3300026142 | Bacteria | 2932 |
| 267 | Ga0207698_10356573 | 3300026142 | Bacteria | 1383 |
| 268 | Ga0268265_10029443 | 3300028380 | Unclassified | 3941 |
| 269 | Ga0268265_11204697 | 3300028380 | Bacteria | 755 |
| 270 | Ga0268264_10080783 | 3300028381 | Bacteria | 2777 |
| 271 | Ga0265338_10029923 | 3300028800 | Bacteria | 5384 |
| 272 | Ga0316176_1123934 | 3300030732 | Bacteria | 1011 |
| 273 | Ga0265762_1035543 | 3300030760 | Bacteria | 959 |
| 274 | Ga0265767_100429 | 3300030836 | Bacteria | 1768 |
| 275 | Ga0265325_10040260 | 3300031241 | Bacteria | 2455 |
| 276 | Ga0265339_10000205 | 3300031249 | Bacteria | 48438 |
| 277 | Ga0307408_100154382 | 3300031548 | Bacteria | 1816 |
| 278 | Ga0265313_10000353 | 3300031595 | Bacteria | 50100 |
| 279 | Ga0307508_10013297 | 3300031616 | Bacteria | 7528 |
| 280 | Ga0265342_10103102 | 3300031712 | Bacteria | 1622 |
| 281 | Ga0307516_10031784 | 3300031730 | Bacteria | 5320 |
| 282 | Ga0307405_10496620 | 3300031731 | Bacteria | 977 |
| 283 | Ga0307413_10001087 | 3300031824 | Bacteria | 9944 |
| 284 | Ga0307413_10003345 | 3300031824 | Bacteria | 6736 |
| 285 | Ga0307410_10735499 | 3300031852 | Bacteria | 834 |
| 286 | Ga0307406_10123128 | 3300031901 | Bacteria | 1807 |
| 287 | Ga0307412_10105003 | 3300031911 | Bacteria | 2006 |
| 288 | Ga0307412_10934668 | 3300031911 | Bacteria | 762 |
| 289 | Ga0307409_100059689 | 3300031995 | Bacteria | 2970 |
| 290 | Ga0307409_101039770 | 3300031995 | Bacteria | 838 |
| 291 | Ga0307416_100045428 | 3300032002 | Bacteria | 3459 |
| 292 | Ga0307416_100104981 | 3300032002 | Bacteria | 2472 |
| 293 | Ga0307416_102874930 | 3300032002 | Unclassified | 576 |
| 294 | Ga0307414_10009476 | 3300032004 | Bacteria | 5596 |
| 295 | Ga0307414_10599642 | 3300032004 | Bacteria | 987 |
| 296 | Ga0307411_10000001 | 3300032005 | Bacteria | 931810 |
| 297 | Ga0307411_10040107 | 3300032005 | Bacteria | 2968 |
| 298 | Ga0307415_100016347 | 3300032126 | Bacteria | 4421 |
| 299 | Ga0307415_100213486 | 3300032126 | Bacteria | 1541 |
| 300 | Ga0307415_100657238 | 3300032126 | Bacteria | 940 |
| 301 | Ga0373940_0168393 | 3300035088 | Bacteria | 707 |
| 302 | Ga0373945_0073210 | 3300035116 | Bacteria | 1301 |
| 303 | Ga0373961_0217662 | 3300035241 | Bacteria | 680 |
| 304 | Ga0373927_0144169 | 3300035695 | Bacteria | 1559 |
| 305 | Ga0395900_1162217 | 3300037418 | Bacteria | 688 |
| 306 | Ga0395900_1878692 | 3300037418 | Unclassified | 509 |
| 307 | Ga0436364_1180439 | 3300037853 | Bacteria | 1849 |
| 308 | Ga0436365_1526301 | 3300039437 | Bacteria | 136420 |
| 309 | Ga0436361_0400086 | 3300039447 | Bacteria | 7525 |
| 310 | Ga0436363_0118154 | 3300039450 | Bacteria | 946 |
| 311 | Ga0439465_0036843 | 3300041413 | Bacteria | 1572 |
| 312 | Ga0451797_1019589 | 3300041453 | Bacteria | 786 |
| 313 | Ga0439431_0005150 | 3300041997 | Bacteria | 2883 |
| 314 | Ga0439448_0022006 | 3300042005 | Bacteria | 1978 |
| 315 | Ga0439449_0144239 | 3300042007 | Bacteria | 887 |
| 316 | Ga0450896_005192 | 3300042133 | Bacteria | 1775 |
| 317 | Ga0439446_0054471 | 3300042156 | Bacteria | 1200 |
| 318 | Ga0439459_0022508 | 3300042438 | Bacteria | 1220 |
| 319 | Ga0450893_0113209 | 3300042532 | Bacteria | 561 |
| 320 | Ga0451577_0173725 | 3300042876 | Bacteria | 1942 |
| 321 | Ga0451577_0566924 | 3300042876 | Bacteria | 1031 |
| 322 | Ga0451577_0603856 | 3300042876 | Bacteria | 996 |
| 323 | Ga0453683_0221162 | 3300044673 | Bacteria | 1204 |
| 324 | Ga0453683_0259218 | 3300044673 | Bacteria | 1109 |
| 325 | Ga0466963_0047368 | 3300044694 | Bacteria | 2837 |
| 326 | Ga0466964_0646058 | 3300044706 | Bacteria | 585 |
| 327 | Ga0466971_0073418 | 3300044719 | Bacteria | 1555 |
| 328 | Ga0466971_0147766 | 3300044719 | Bacteria | 1096 |
| 329 | Ga0466970_0077973 | 3300044765 | Bacteria | 1787 |
| 330 | Ga0466957_0073494 | 3300044842 | Bacteria | 2119 |
| 331 | Ga0466957_0119400 | 3300044842 | Bacteria | 1679 |
| 332 | Ga0451576_0853319 | 3300045051 | Bacteria | 956 |
| 333 | Ga0451576_0876293 | 3300045051 | Bacteria | 942 |
| 334 | Ga0466958_0009055 | 3300045836 | Bacteria | 5529 |
| 335 | Ga0466967_0157127 | 3300045976 | Bacteria | 2131 |
| 336 | Ga0466967_0836030 | 3300045976 | Bacteria | 915 |
| 337 | Ga0495607_0218435 | 3300046501 | Bacteria | 934 |
| 338 | Ga0495583_0013117 | 3300046506 | Bacteria | 4643 |
| 339 | Ga0495606_0001529 | 3300046507 | Bacteria | 30601 |
| 340 | Ga0495628_0601846 | 3300046516 | Unclassified | 785 |
| 341 | Ga0495631_0006658 | 3300046518 | Bacteria | 5940 |
| 342 | Ga0495631_0064602 | 3300046518 | Bacteria | 1584 |
| 343 | Ga0495644_0241212 | 3300046523 | Bacteria | 701 |
| 344 | Ga0495663_0046652 | 3300046525 | Bacteria | 1331 |
| 345 | Ga0495652_0362137 | 3300046529 | Bacteria | 1036 |
| 346 | Ga0495609_0022213 | 3300046538 | Bacteria | 2924 |
| 347 | Ga0495645_0061373 | 3300046543 | Bacteria | 2724 |
| 348 | Ga0495633_0000776 | 3300046558 | Bacteria | 28552 |
| 349 | Ga0495633_0112705 | 3300046558 | Bacteria | 1261 |
| 350 | Ga0495667_0230520 | 3300046559 | Bacteria | 1181 |
| 351 | Ga0495611_0107523 | 3300046648 | Bacteria | 1297 |
| 352 | Ga0495625_0017249 | 3300046660 | Bacteria | 5653 |
| 353 | Ga0495625_0152292 | 3300046660 | Bacteria | 1554 |
| 354 | Ga0495635_0604462 | 3300046663 | Bacteria | 716 |
| 355 | Ga0495669_0000011 | 3300046684 | Bacteria | 158720 |
| 356 | Ga0495672_0083334 | 3300047320 | Bacteria | 1776 |
| 357 | Ga0495687_000077 | 3300047443 | Bacteria | 148889 |
| 358 | Ga0495686_0285464 | 3300047472 | Bacteria | 916 |
| 359 | Ga0496100_0315525 | 3300048903 | Bacteria | 1173 |
| 360 | Ga0496100_0557143 | 3300048903 | Bacteria | 887 |
| 361 | Ga0496103_0405780 | 3300048906 | Bacteria | 875 |
| 362 | Ga0496104_0205197 | 3300048907 | Bacteria | 1883 |
| 363 | Ga0496104_1145732 | 3300048907 | Bacteria | 681 |
| 364 | Ga0496105_0177059 | 3300048908 | Bacteria | 1747 |
| 365 | Ga0496108_1618907 | 3300048911 | Bacteria | 535 |
| 366 | Ga0496110_0473479 | 3300048913 | Unclassified | 1141 |
| 367 | Ga0496110_0804851 | 3300048913 | Bacteria | 844 |
| 368 | Ga0496111_0726237 | 3300048914 | Bacteria | 721 |
| 369 | Ga0496112_0196472 | 3300048915 | Bacteria | 1978 |
| 370 | Ga0496113_0028422 | 3300048916 | Bacteria | 4022 |
| 371 | Ga0496113_0145418 | 3300048916 | Bacteria | 1867 |
| 372 | Ga0496114_0054330 | 3300048917 | Bacteria | 3340 |
| 373 | Ga0496114_0072232 | 3300048917 | Bacteria | 2902 |
| 374 | Ga0496115_0247608 | 3300048918 | Bacteria | 1468 |
| 375 | Ga0496117_0001287 | 3300048920 | Bacteria | 36971 |
| 376 | Ga0496118_0001350 | 3300048921 | Bacteria | 37040 |
| 377 | Ga0496121_0003107 | 3300048924 | Bacteria | 24004 |
| 378 | Ga0496122_0003368 | 3300048925 | Bacteria | 21040 |
| 379 | Ga0496123_0002880 | 3300048926 | Bacteria | 20186 |
| 380 | Ga0496124_0005075 | 3300048927 | Bacteria | 15016 |
| 381 | Ga0496125_0004515 | 3300048928 | Bacteria | 15998 |
| 382 | Ga0496125_0403429 | 3300048928 | Bacteria | 798 |
| 383 | Ga0496126_0022071 | 3300048929 | Bacteria | 6202 |
| 384 | Ga0496126_0031130 | 3300048929 | Bacteria | 5046 |
| 385 | Ga0501032_0073744 | 3300049569 | Bacteria | 2274 |
| 386 | Ga0501034_0000462 | 3300049571 | Bacteria | 67291 |
| 387 | Ga0501034_0346971 | 3300049571 | Bacteria | 1413 |
| 388 | Ga0501037_0207704 | 3300049573 | Bacteria | 1382 |
| 389 | Ga0501043_0264624 | 3300049579 | Bacteria | 1321 |
| 390 | Ga0501046_0031293 | 3300049580 | Bacteria | 4315 |
| 391 | Ga0501047_0038356 | 3300049581 | Bacteria | 4636 |
| 392 | Ga0501047_0203853 | 3300049581 | Bacteria | 1838 |
| 393 | Ga0501047_0311574 | 3300049581 | Bacteria | 1414 |
| 394 | Ga0501067_0422011 | 3300049583 | Bacteria | 744 |
| 395 | Ga0501068_0120906 | 3300049584 | Bacteria | 1632 |
| 396 | Ga0501068_0149200 | 3300049584 | Unclassified | 1469 |
| 397 | Ga0501069_0050086 | 3300049585 | Bacteria | 2322 |
| 398 | Ga0501070_0013611 | 3300049586 | Bacteria | 6856 |
| 399 | Ga0501070_1464006 | 3300049586 | Unclassified | 517 |
| 400 | Ga0501073_0211197 | 3300049589 | Bacteria | 1341 |
| 401 | Ga0501074_0069229 | 3300049590 | Bacteria | 2537 |
| 402 | Ga0501235_027726 | 3300049669 | Bacteria | 1271 |
| 403 | Ga0501249_009717 | 3300049679 | Bacteria | 2001 |
| 404 | Ga0501079_0077104 | 3300049741 | Bacteria | 2578 |
| 405 | Ga0501080_0042679 | 3300049742 | Bacteria | 4222 |
| 406 | Ga0501080_0279012 | 3300049742 | Bacteria | 1519 |
| 407 | Ga0501241_026082 | 3300049758 | Bacteria | 1090 |
| 408 | Ga0501266_000023 | 3300049763 | Bacteria | 82396 |
| 409 | Ga0501035_1159949 | 3300049822 | Bacteria | 601 |
| 410 | Ga0501044_0344954 | 3300049823 | Bacteria | 1410 |
| 411 | Ga0501044_0636249 | 3300049823 | Bacteria | 957 |
| 412 | nmdc:mga03683_102317_c1 | 3300050489 | Bacteria | 1260 |
| 413 | nmdc:mga03n38_26765_c1 | 3300050490 | Bacteria | 2385 |
| 414 | nmdc:mga00v17_44324_c1 | 3300050491 | Bacteria | 2682 |
| 415 | nmdc:mga0yw44_29501_c1 | 3300050492 | Bacteria | 3167 |
| 416 | nmdc:mga0yw44_32864_c1 | 3300050492 | Bacteria | 3026 |
| 417 | nmdc:mga05p37_1091298_c1 | 3300050507 | Bacteria | 837 |
| 418 | nmdc:mga05p37_1342_c1 | 3300050507 | Bacteria | 28603 |
| 419 | nmdc:mga05p37_1427824_c1 | 3300050507 | Bacteria | 695 |
| 420 | nmdc:mga05p37_812235_c1 | 3300050507 | Bacteria | 1021 |
| 421 | nmdc:mga09592_143450_c1 | 3300050508 | Bacteria | 2059 |
| 422 | nmdc:mga0qj67_11676_c1 | 3300050509 | Bacteria | 6589 |
| 423 | nmdc:mga06r32_126897_c1 | 3300050510 | Bacteria | 2521 |
| 424 | nmdc:mga06r32_14293_c1 | 3300050510 | Bacteria | 7200 |
| 425 | nmdc:mga06r32_551835_c1 | 3300050510 | Bacteria | 1126 |
| 426 | nmdc:mga08y16_1687210_c1 | 3300050511 | Unclassified | 589 |
| 427 | nmdc:mga08y16_722286_c1 | 3300050511 | Bacteria | 994 |
| 428 | nmdc:mga0n895_579034_c1 | 3300050512 | Bacteria | 1126 |
| 429 | nmdc:mga0rr50_207993_c2 | 3300050513 | Bacteria | 1162 |
| 430 | nmdc:mga0a205_1458812_c1 | 3300050515 | Bacteria | 532 |
| 431 | nmdc:mga0a205_243466_c1 | 3300050515 | Bacteria | 1679 |
| 432 | nmdc:mga0a205_635635_c1 | 3300050515 | Bacteria | 919 |
| 433 | Ga0500610_0000028 | 3300053079 | Bacteria | 52793 |
| 434 | Ga0495655_0001346 | 3300053083 | Bacteria | 3779 |
| 435 | Ga0500644_0000203 | 3300053088 | Bacteria | 35985 |
| 436 | Ga0500644_0291550 | 3300053088 | Bacteria | 696 |
| 437 | Ga0500641_0000417 | 3300053096 | Bacteria | 15703 |
| 438 | Ga0500652_005122 | 3300053131 | Bacteria | 4102 |
| 439 | Ga0500658_0000003 | 3300053134 | Bacteria | 512506 |
| 440 | Ga0500568_0003948 | 3300053139 | Bacteria | 8071 |
| 441 | Ga0500568_0011991 | 3300053139 | Bacteria | 4000 |
| 442 | Ga0500568_0032027 | 3300053139 | Unclassified | 2164 |
| 443 | Ga0500589_078035 | 3300053147 | Bacteria | 1483 |
| 444 | Ga0500627_0209109 | 3300053158 | Bacteria | 873 |
| 445 | Ga0500645_000001 | 3300053730 | Bacteria | 455558 |
| 446 | Ga0501084_0064835 | 3300054114 | Bacteria | 3056 |
| 447 | Ga0587083_0063080 | 3300059505 | Bacteria | 841 |
| 448 | Ga0587086_042205 | 3300059507 | Unclassified | 710 |
| 449 | Ga0587109_023302 | 3300059624 | Bacteria | 1121 |
| 450 | Ga0587076_020642 | 3300059645 | Bacteria | 1083 |
| 451 | Ga0587107_064510 | 3300059652 | Bacteria | 654 |
| 452 | Ga0587071_063967 | 3300060344 | Bacteria | 787 |
| 453 | Ga0587111_0028617 | 3300060346 | Bacteria | 1123 |
| 454 | Ga0501082_0019281 | 3300060353 | Bacteria | 5880 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006038 | Ga0075365_10039414 | Ga0075365_100394142 | 135 |
| 2 | 3300048913 | Ga0496110_0804851 | Ga0496110_0804851_210_632 | 135 |
| 3 | 3300048914 | Ga0496111_0726237 | Ga0496111_0726237_257_679 | 135 |
| 4 | 3300048916 | Ga0496113_0145418 | Ga0496113_0145418_913_1335 | 135 |
| 5 | 3300048920 | Ga0496117_0001287 | Ga0496117_0001287_29612_30034 | 135 |
| 6 | 3300048921 | Ga0496118_0001350 | Ga0496118_0001350_6995_7417 | 135 |
| 7 | 3300048924 | Ga0496121_0003107 | Ga0496121_0003107_9523_9945 | 135 |
| 8 | 3300048925 | Ga0496122_0003368 | Ga0496122_0003368_10416_10838 | 135 |
| 9 | 3300048926 | Ga0496123_0002880 | Ga0496123_0002880_13612_14034 | 135 |
| 10 | 3300048927 | Ga0496124_0005075 | Ga0496124_0005075_1418_1840 | 135 |
| 11 | 3300048929 | Ga0496126_0022071 | Ga0496126_0022071_2488_2910 | 135 |
| 12 | 3300050492 | nmdc:mga0yw44_32864_c1 | nmdc:mga0yw44_32864_c1_2354_2776 | 135 |
| 13 | 3300042532 | Ga0450893_0113209 | Ga0450893_0113209_101_541 | 139 |
| 14 | 3300005330 | Ga0070690_100005999 | Ga0070690_1000059999 | 140 |
| 15 | 3300005345 | Ga0070692_10048312 | Ga0070692_100483122 | 140 |
| 16 | 3300005353 | Ga0070669_100024053 | Ga0070669_1000240533 | 140 |
| 17 | 3300005441 | Ga0070700_100092403 | Ga0070700_1000924033 | 140 |
| 18 | 3300005444 | Ga0070694_100036907 | Ga0070694_1000369072 | 140 |
| 19 | 3300005457 | Ga0070662_100155982 | Ga0070662_1001559822 | 140 |
| 20 | 3300005549 | Ga0070704_100035895 | Ga0070704_1000358954 | 140 |
| 21 | 3300005844 | Ga0068862_100021413 | Ga0068862_1000214135 | 140 |
| 22 | 3300014326 | Ga0157380_10009008 | Ga0157380_100090084 | 140 |
| 23 | 3300025933 | Ga0207706_10121990 | Ga0207706_101219903 | 140 |
| 24 | 3300026075 | Ga0207708_10235062 | Ga0207708_102350621 | 140 |
| 25 | 3300028380 | Ga0268265_10029443 | Ga0268265_100294434 | 140 |
| 26 | 3300050489 | nmdc:mga03683_102317_c1 | nmdc:mga03683_102317_c1_54_524 | 141 |
| 27 | 3300013105 | Ga0157369_10483639 | Ga0157369_104836392 | 142 |
| 28 | 3300037418 | Ga0395900_1878692 | Ga0395900_1878692_66_494 | 142 |
| 29 | iso_pu_bacteria | 2965110997 | 2965116921 | 143 |
| 30 | 3300009147 | Ga0114129_11400649 | Ga0114129_114006492 | 145 |
| 31 | 3300049669 | Ga0501235_027726 | Ga0501235_027726_586_1089 | 145 |
| 32 | 3300050515 | nmdc:mga0a205_1458812_c1 | nmdc:mga0a205_1458812_c1_32_511 | 145 |
| 33 | 3300005578 | Ga0068854_100298763 | Ga0068854_1002987632 | 146 |
| 34 | 3300009147 | Ga0114129_10263576 | Ga0114129_102635763 | 146 |
| 35 | 3300044673 | Ga0453683_0221162 | Ga0453683_0221162_405_944 | 146 |
| 36 | 3300050507 | nmdc:mga05p37_812235_c1 | nmdc:mga05p37_812235_c1_442_951 | 146 |
| 37 | iso_pu_bacteria | 3004239961 | 3004241419 | 146 |
| 38 | 3300006847 | Ga0075431_100002439 | Ga0075431_10000243912 | 147 |
| 39 | 3300050509 | nmdc:mga0qj67_11676_c1 | nmdc:mga0qj67_11676_c1_3986_4489 | 147 |
| 40 | 3300050510 | nmdc:mga06r32_14293_c1 | nmdc:mga06r32_14293_c1_5262_5765 | 147 |
| 41 | 3300006846 | Ga0075430_100032014 | Ga0075430_1000320143 | 148 |
| 42 | 3300006844 | Ga0075428_100152424 | Ga0075428_1001524242 | 149 |
| 43 | 3300035088 | Ga0373940_0168393 | Ga0373940_0168393_208_687 | 150 |
| 44 | 3300049571 | Ga0501034_0346971 | Ga0501034_0346971_27_500 | 150 |
| 45 | 3300049573 | Ga0501037_0207704 | Ga0501037_0207704_52_525 | 150 |
| 46 | 3300049579 | Ga0501043_0264624 | Ga0501043_0264624_51_524 | 150 |
| 47 | 3300049580 | Ga0501046_0031293 | Ga0501046_0031293_3067_3540 | 150 |
| 48 | 3300049581 | Ga0501047_0311574 | Ga0501047_0311574_53_526 | 150 |
| 49 | 3300049583 | Ga0501067_0422011 | Ga0501067_0422011_190_663 | 150 |
| 50 | 3300049585 | Ga0501069_0050086 | Ga0501069_0050086_504_977 | 150 |
| 51 | 3300049586 | Ga0501070_0013611 | Ga0501070_0013611_2605_3078 | 150 |
| 52 | 3300049586 | Ga0501070_1464006 | Ga0501070_1464006_31_504 | 150 |
| 53 | 3300049589 | Ga0501073_0211197 | Ga0501073_0211197_783_1256 | 150 |
| 54 | 3300049590 | Ga0501074_0069229 | Ga0501074_0069229_1147_1620 | 150 |
| 55 | 3300049741 | Ga0501079_0077104 | Ga0501079_0077104_1384_1857 | 150 |
| 56 | 3300049742 | Ga0501080_0279012 | Ga0501080_0279012_53_526 | 150 |
| 57 | 3300054114 | Ga0501084_0064835 | Ga0501084_0064835_682_1155 | 150 |
| 58 | 3300060353 | Ga0501082_0019281 | Ga0501082_0019281_1563_2036 | 150 |
| 59 | 3300031616 | Ga0307508_10013297 | Ga0307508_100132973 | 151 |
| 60 | 3300031901 | Ga0307406_10123128 | Ga0307406_101231281 | 151 |
| 61 | 3300032005 | Ga0307411_10000001 | Ga0307411_1000000133 | 151 |
| 62 | 3300049758 | Ga0501241_026082 | Ga0501241_026082_217_804 | 151 |
| 63 | 3300049763 | Ga0501266_000023 | Ga0501266_000023_9898_10485 | 151 |
| 64 | 3300046507 | Ga0495606_0001529 | Ga0495606_0001529_4702_5205 | 152 |
| 65 | 3300005549 | Ga0070704_100670284 | Ga0070704_1006702842 | 153 |
| 66 | 3300006051 | Ga0075364_10000219 | Ga0075364_1000021911 | 153 |
| 67 | 3300048907 | Ga0496104_1145732 | Ga0496104_1145732_48_539 | 153 |
| 68 | 3300005436 | Ga0070713_101225766 | Ga0070713_1012257661 | 154 |
| 69 | 3300006163 | Ga0070715_10000068 | Ga0070715_100000686 | 154 |
| 70 | 3300009174 | Ga0105241_10512710 | Ga0105241_105127102 | 154 |
| 71 | 3300009176 | Ga0105242_10001700 | Ga0105242_100017003 | 154 |
| 72 | 3300009176 | Ga0105242_10005282 | Ga0105242_100052829 | 154 |
| 73 | 3300017792 | Ga0163161_10215541 | Ga0163161_102155412 | 154 |
| 74 | 3300025905 | Ga0207685_10000059 | Ga0207685_1000005920 | 154 |
| 75 | 3300025928 | Ga0207700_10441137 | Ga0207700_104411372 | 154 |
| 76 | 3300030760 | Ga0265762_1035543 | Ga0265762_10355431 | 154 |
| 77 | 3300005334 | Ga0068869_100901227 | Ga0068869_1009012271 | 155 |
| 78 | 3300049679 | Ga0501249_009717 | Ga0501249_009717_366_953 | 155 |
| 79 | iso_pu_bacteria | 2818991318 | 2819428860 | 155 |
| 80 | 3300001979 | JGI24740J21852_10010677 | JGI24740J21852_100106772 | 156 |
| 81 | 3300005564 | Ga0070664_100684623 | Ga0070664_1006846231 | 156 |
| 82 | 3300009147 | Ga0114129_10210844 | Ga0114129_102108441 | 156 |
| 83 | 3300009553 | Ga0105249_10353338 | Ga0105249_103533382 | 156 |
| 84 | 3300025900 | Ga0207710_10116558 | Ga0207710_101165582 | 156 |
| 85 | 3300025945 | Ga0207679_10313722 | Ga0207679_103137222 | 156 |
| 86 | 3300025981 | Ga0207640_10375268 | Ga0207640_103752682 | 156 |
| 87 | 3300035241 | Ga0373961_0217662 | Ga0373961_0217662_50_550 | 156 |
| 88 | 3300046538 | Ga0495609_0022213 | Ga0495609_0022213_1611_2120 | 156 |
| 89 | 3300050507 | nmdc:mga05p37_1427824_c1 | nmdc:mga05p37_1427824_c1_149_670 | 156 |
| 90 | 3300050511 | nmdc:mga08y16_1687210_c1 | nmdc:mga08y16_1687210_c1_72_566 | 156 |
| 91 | 3300050515 | nmdc:mga0a205_635635_c1 | nmdc:mga0a205_635635_c1_273_773 | 156 |
| 92 | iso_pu_bacteria | 3004334049 | 3004337009 | 156 |
| 93 | 3300009147 | Ga0114129_10017606 | Ga0114129_100176069 | 157 |
| 94 | 3300044765 | Ga0466970_0077973 | Ga0466970_0077973_139_675 | 157 |
| 95 | 3300050507 | nmdc:mga05p37_1342_c1 | nmdc:mga05p37_1342_c1_10024_10515 | 157 |
| 96 | 3300005340 | Ga0070689_100023208 | Ga0070689_1000232085 | 158 |
| 97 | 3300005353 | Ga0070669_100362676 | Ga0070669_1003626762 | 158 |
| 98 | 3300005355 | Ga0070671_100166668 | Ga0070671_1001666684 | 158 |
| 99 | 3300009553 | Ga0105249_10282643 | Ga0105249_102826432 | 158 |
| 100 | 3300025893 | Ga0207682_10125532 | Ga0207682_101255322 | 158 |
| 101 | 3300025926 | Ga0207659_10096964 | Ga0207659_100969642 | 158 |
| 102 | 3300025931 | Ga0207644_10125202 | Ga0207644_101252022 | 158 |
| 103 | 3300031824 | Ga0307413_10001087 | Ga0307413_100010873 | 158 |
| 104 | 3300050512 | nmdc:mga0n895_579034_c1 | nmdc:mga0n895_579034_c1_432_935 | 158 |
| 105 | iso_pu_bacteria | 2939622612 | 2939623077 | 158 |
| 106 | 3300005290 | Ga0065712_10080023 | Ga0065712_100800234 | 159 |
| 107 | 3300005339 | Ga0070660_100011649 | Ga0070660_1000116497 | 159 |
| 108 | 3300005345 | Ga0070692_10018199 | Ga0070692_100181993 | 159 |
| 109 | 3300005364 | Ga0070673_100022523 | Ga0070673_1000225236 | 159 |
| 110 | 3300005366 | Ga0070659_100000437 | Ga0070659_10000043722 | 159 |
| 111 | 3300005367 | Ga0070667_100460872 | Ga0070667_1004608722 | 159 |
| 112 | 3300005466 | Ga0070685_10045374 | Ga0070685_100453744 | 159 |
| 113 | 3300005547 | Ga0070693_100008236 | Ga0070693_1000082366 | 159 |
| 114 | 3300021384 | Ga0213876_10000935 | Ga0213876_1000093517 | 159 |
| 115 | 3300021388 | Ga0213875_10227601 | Ga0213875_102276012 | 159 |
| 116 | 3300025919 | Ga0207657_10007640 | Ga0207657_100076407 | 159 |
| 117 | 3300025928 | Ga0207700_10229675 | Ga0207700_102296751 | 159 |
| 118 | 3300025932 | Ga0207690_10000535 | Ga0207690_1000053516 | 159 |
| 119 | 3300037853 | Ga0436364_1180439 | Ga0436364_1180439_605_1114 | 159 |
| 120 | 3300039437 | Ga0436365_1526301 | Ga0436365_1526301_119647_120150 | 159 |
| 121 | 3300048917 | Ga0496114_0072232 | Ga0496114_0072232_1696_2208 | 159 |
| 122 | 3300053083 | Ga0495655_0001346 | Ga0495655_0001346_3211_3711 | 159 |
| 123 | 3300001904 | JGI24736J21556_1021942 | JGI24736J21556_10219422 | 160 |
| 124 | 3300001991 | JGI24743J22301_10069433 | JGI24743J22301_100694331 | 160 |
| 125 | 3300002705 | JGI25156J39149_1008579 | JGI25156J39149_10085793 | 160 |
| 126 | 3300002741 | JGI25157J39369_1000700 | JGI25157J39369_10007003 | 160 |
| 127 | 3300005331 | Ga0070670_100004949 | Ga0070670_1000049493 | 160 |
| 128 | 3300005334 | Ga0068869_100001770 | Ga0068869_1000017707 | 160 |
| 129 | 3300005338 | Ga0068868_100000513 | Ga0068868_10000051315 | 160 |
| 130 | 3300005345 | Ga0070692_10011135 | Ga0070692_100111353 | 160 |
| 131 | 3300005536 | Ga0070697_100076984 | Ga0070697_1000769841 | 160 |
| 132 | 3300005539 | Ga0068853_100017586 | Ga0068853_1000175862 | 160 |
| 133 | 3300005545 | Ga0070695_100000714 | Ga0070695_1000007149 | 160 |
| 134 | 3300005545 | Ga0070695_100256098 | Ga0070695_1002560983 | 160 |
| 135 | 3300005563 | Ga0068855_100345358 | Ga0068855_1003453582 | 160 |
| 136 | 3300005577 | Ga0068857_100711342 | Ga0068857_1007113422 | 160 |
| 137 | 3300005578 | Ga0068854_100885214 | Ga0068854_1008852141 | 160 |
| 138 | 3300005614 | Ga0068856_100019362 | Ga0068856_1000193623 | 160 |
| 139 | 3300005615 | Ga0070702_100209994 | Ga0070702_1002099941 | 160 |
| 140 | 3300005616 | Ga0068852_100015113 | Ga0068852_1000151133 | 160 |
| 141 | 3300005618 | Ga0068864_100469478 | Ga0068864_1004694782 | 160 |
| 142 | 3300006173 | Ga0070716_100437164 | Ga0070716_1004371642 | 160 |
| 143 | 3300006846 | Ga0075430_100023918 | Ga0075430_1000239183 | 160 |
| 144 | 3300006871 | Ga0075434_100056963 | Ga0075434_1000569633 | 160 |
| 145 | 3300009101 | Ga0105247_11191589 | Ga0105247_111915891 | 160 |
| 146 | 3300009147 | Ga0114129_10846272 | Ga0114129_108462721 | 160 |
| 147 | 3300009148 | Ga0105243_11838428 | Ga0105243_118384282 | 160 |
| 148 | 3300009545 | Ga0105237_10316691 | Ga0105237_103166912 | 160 |
| 149 | 3300013296 | Ga0157374_10077447 | Ga0157374_100774471 | 160 |
| 150 | 3300021361 | Ga0213872_10045997 | Ga0213872_100459973 | 160 |
| 151 | 3300025250 | Ga0209026_1000050 | Ga0209026_100005060 | 160 |
| 152 | 3300025256 | Ga0209759_1000229 | Ga0209759_100022947 | 160 |
| 153 | 3300025304 | Ga0209257_1033040 | Ga0209257_10330402 | 160 |
| 154 | 3300025906 | Ga0207699_10667961 | Ga0207699_106679611 | 160 |
| 155 | 3300025913 | Ga0207695_11394358 | Ga0207695_113943581 | 160 |
| 156 | 3300025914 | Ga0207671_10169395 | Ga0207671_101693952 | 160 |
| 157 | 3300025917 | Ga0207660_10112525 | Ga0207660_101125253 | 160 |
| 158 | 3300025925 | Ga0207650_10036271 | Ga0207650_100362713 | 160 |
| 159 | 3300025942 | Ga0207689_10011112 | Ga0207689_100111123 | 160 |
| 160 | 3300025945 | Ga0207679_10554546 | Ga0207679_105545461 | 160 |
| 161 | 3300025949 | Ga0207667_10781721 | Ga0207667_107817212 | 160 |
| 162 | 3300025981 | Ga0207640_10201376 | Ga0207640_102013763 | 160 |
| 163 | 3300026023 | Ga0207677_10000065 | Ga0207677_1000006526 | 160 |
| 164 | 3300026041 | Ga0207639_10472393 | Ga0207639_104723932 | 160 |
| 165 | 3300026078 | Ga0207702_10030748 | Ga0207702_100307484 | 160 |
| 166 | 3300026142 | Ga0207698_10356573 | Ga0207698_103565731 | 160 |
| 167 | 3300031548 | Ga0307408_100154382 | Ga0307408_1001543822 | 160 |
| 168 | 3300031730 | Ga0307516_10031784 | Ga0307516_100317843 | 160 |
| 169 | 3300031731 | Ga0307405_10496620 | Ga0307405_104966202 | 160 |
| 170 | 3300031824 | Ga0307413_10003345 | Ga0307413_100033453 | 160 |
| 171 | 3300031852 | Ga0307410_10735499 | Ga0307410_107354992 | 160 |
| 172 | 3300031911 | Ga0307412_10105003 | Ga0307412_101050032 | 160 |
| 173 | 3300031911 | Ga0307412_10934668 | Ga0307412_109346681 | 160 |
| 174 | 3300031995 | Ga0307409_100059689 | Ga0307409_1000596892 | 160 |
| 175 | 3300031995 | Ga0307409_101039770 | Ga0307409_1010397702 | 160 |
| 176 | 3300032002 | Ga0307416_100045428 | Ga0307416_1000454282 | 160 |
| 177 | 3300032126 | Ga0307415_100016347 | Ga0307415_1000163475 | 160 |
| 178 | 3300032126 | Ga0307415_100213486 | Ga0307415_1002134862 | 160 |
| 179 | 3300035695 | Ga0373927_0144169 | Ga0373927_0144169_235_738 | 160 |
| 180 | 3300037418 | Ga0395900_1162217 | Ga0395900_1162217_60_563 | 160 |
| 181 | 3300039447 | Ga0436361_0400086 | Ga0436361_0400086_676_1215 | 160 |
| 182 | 3300042005 | Ga0439448_0022006 | Ga0439448_0022006_98_601 | 160 |
| 183 | 3300042438 | Ga0439459_0022508 | Ga0439459_0022508_617_1120 | 160 |
| 184 | 3300042876 | Ga0451577_0603856 | Ga0451577_0603856_243_746 | 160 |
| 185 | 3300044706 | Ga0466964_0646058 | Ga0466964_0646058_49_555 | 160 |
| 186 | 3300044719 | Ga0466971_0073418 | Ga0466971_0073418_180_686 | 160 |
| 187 | 3300044842 | Ga0466957_0073494 | Ga0466957_0073494_870_1376 | 160 |
| 188 | 3300045976 | Ga0466967_0157127 | Ga0466967_0157127_81_584 | 160 |
| 189 | 3300046523 | Ga0495644_0241212 | Ga0495644_0241212_80_583 | 160 |
| 190 | 3300046558 | Ga0495633_0112705 | Ga0495633_0112705_534_1121 | 160 |
| 191 | 3300047320 | Ga0495672_0083334 | Ga0495672_0083334_634_1143 | 160 |
| 192 | 3300048906 | Ga0496103_0405780 | Ga0496103_0405780_299_802 | 160 |
| 193 | 3300048928 | Ga0496125_0403429 | Ga0496125_0403429_96_599 | 160 |
| 194 | 3300049569 | Ga0501032_0073744 | Ga0501032_0073744_1379_1882 | 160 |
| 195 | 3300049571 | Ga0501034_0000462 | Ga0501034_0000462_65946_66449 | 160 |
| 196 | 3300049581 | Ga0501047_0038356 | Ga0501047_0038356_3259_3762 | 160 |
| 197 | 3300049742 | Ga0501080_0042679 | Ga0501080_0042679_1486_1989 | 160 |
| 198 | 3300049823 | Ga0501044_0344954 | Ga0501044_0344954_855_1358 | 160 |
| 199 | 3300050507 | nmdc:mga05p37_1091298_c1 | nmdc:mga05p37_1091298_c1_289_795 | 160 |
| 200 | 3300053139 | Ga0500568_0003948 | Ga0500568_0003948_6220_6729 | 160 |
| 201 | 3300059624 | Ga0587109_023302 | Ga0587109_023302_546_1055 | 160 |
| 202 | iso_pu_bacteria | 2865002811 | 2865003017 | 160 |
| 203 | 3300007076 | Ga0075435_100263784 | Ga0075435_1002637842 | 161 |
| 204 | 3300014326 | Ga0157380_10442146 | Ga0157380_104421462 | 161 |
| 205 | 3300032004 | Ga0307414_10009476 | Ga0307414_100094764 | 161 |
| 206 | 3300050513 | nmdc:mga0rr50_207993_c2 | nmdc:mga0rr50_207993_c2_143_649 | 161 |
| 207 | iso_pu_bacteria | 2775506987 | 2776612199 | 161 |
| 208 | 3300005441 | Ga0070700_100001026 | Ga0070700_10000102610 | 162 |
| 209 | 3300006163 | Ga0070715_10238856 | Ga0070715_102388561 | 162 |
| 210 | 3300006173 | Ga0070716_100368775 | Ga0070716_1003687751 | 162 |
| 211 | 3300006175 | Ga0070712_100596128 | Ga0070712_1005961282 | 162 |
| 212 | 3300006847 | Ga0075431_100089044 | Ga0075431_1000890442 | 162 |
| 213 | 3300009147 | Ga0114129_11651391 | Ga0114129_116513912 | 162 |
| 214 | 3300014497 | Ga0182008_10000032 | Ga0182008_1000003231 | 162 |
| 215 | 3300014969 | Ga0157376_11272498 | Ga0157376_112724982 | 162 |
| 216 | 3300025915 | Ga0207693_10075453 | Ga0207693_100754532 | 162 |
| 217 | 3300025927 | Ga0207687_11116222 | Ga0207687_111162222 | 162 |
| 218 | 3300025939 | Ga0207665_10426977 | Ga0207665_104269771 | 162 |
| 219 | 3300026075 | Ga0207708_10001475 | Ga0207708_1000147512 | 162 |
| 220 | 3300030732 | Ga0316176_1123934 | Ga0316176_11239342 | 162 |
| 221 | 3300032002 | Ga0307416_100104981 | Ga0307416_1001049813 | 162 |
| 222 | 3300032004 | Ga0307414_10599642 | Ga0307414_105996421 | 162 |
| 223 | 3300032126 | Ga0307415_100657238 | Ga0307415_1006572382 | 162 |
| 224 | 3300041453 | Ga0451797_1019589 | Ga0451797_1019589_143_661 | 162 |
| 225 | 3300042876 | Ga0451577_0173725 | Ga0451577_0173725_1148_1648 | 162 |
| 226 | 3300048911 | Ga0496108_1618907 | Ga0496108_1618907_22_522 | 162 |
| 227 | 3300050508 | nmdc:mga09592_143450_c1 | nmdc:mga09592_143450_c1_516_1016 | 162 |
| 228 | 3300050510 | nmdc:mga06r32_126897_c1 | nmdc:mga06r32_126897_c1_1679_2179 | 162 |
| 229 | 3300003203 | JGI25406J46586_10118235 | JGI25406J46586_101182352 | 163 |
| 230 | 3300005289 | Ga0065704_10142336 | Ga0065704_101423363 | 163 |
| 231 | 3300005336 | Ga0070680_100024813 | Ga0070680_1000248133 | 163 |
| 232 | 3300005985 | Ga0081539_10055841 | Ga0081539_100558413 | 163 |
| 233 | 3300009176 | Ga0105242_10227206 | Ga0105242_102272062 | 163 |
| 234 | 3300013297 | Ga0157378_10081313 | Ga0157378_100813132 | 163 |
| 235 | 3300048915 | Ga0496112_0196472 | Ga0496112_0196472_634_1128 | 163 |
| 236 | 3300048916 | Ga0496113_0028422 | Ga0496113_0028422_3513_4007 | 163 |
| 237 | 3300049584 | Ga0501068_0149200 | Ga0501068_0149200_465_956 | 163 |
| 238 | 3300053088 | Ga0500644_0291550 | Ga0500644_0291550_18_536 | 163 |
| 239 | iso_pu_bacteria | 2643221611 | 2644072712 | 163 |
| 240 | iso_pu_bacteria | 2687453392 | 2688596215 | 163 |
| 241 | iso_pu_bacteria | 2856328259 | 2856329496 | 163 |
| 242 | iso_pu_bacteria | 2856334872 | 2856339825 | 163 |
| 243 | iso_pu_bacteria | 2857367948 | 2857369149 | 163 |
| 244 | iso_pu_bacteria | 2869271264 | 2869271903 | 163 |
| 245 | iso_pu_bacteria | 2874162495 | 2874168169 | 163 |
| 246 | iso_pu_bacteria | 2876399893 | 2876404587 | 163 |
| 247 | iso_pu_bacteria | 2876406927 | 2876410497 | 163 |
| 248 | iso_pu_bacteria | 2878774303 | 2878778349 | 163 |
| 249 | iso_pu_bacteria | 2878781027 | 2878781130 | 163 |
| 250 | iso_pu_bacteria | 2906386501 | 2906388115 | 163 |
| 251 | iso_pu_bacteria | 2906408224 | 2906408934 | 163 |
| 252 | iso_pu_bacteria | 2922151315 | 2922152413 | 163 |
| 253 | iso_pu_bacteria | 2922172374 | 2922173206 | 163 |
| 254 | iso_pu_bacteria | 2922178524 | 2922184776 | 163 |
| 255 | iso_pu_bacteria | 2924748358 | 2924754060 | 163 |
| 256 | iso_pu_bacteria | 2958122699 | 2958126814 | 163 |
| 257 | iso_pu_bacteria | 2958137437 | 2958140183 | 163 |
| 258 | iso_pu_bacteria | 2958158011 | 2958162500 | 163 |
| 259 | iso_pu_bacteria | 2961136820 | 2961140880 | 163 |
| 260 | iso_pu_bacteria | 2965025482 | 2965026750 | 163 |
| 261 | iso_pu_bacteria | 2965032056 | 2965038160 | 163 |
| 262 | iso_pu_bacteria | 2965047637 | 2965051005 | 163 |
| 263 | iso_pu_bacteria | 2965102966 | 2965107260 | 163 |
| 264 | iso_pu_bacteria | 2970547951 | 2970550845 | 163 |
| 265 | iso_pu_bacteria | 2977872689 | 2977875844 | 163 |
| 266 | iso_pu_bacteria | 2977935797 | 2977938013 | 163 |
| 267 | iso_pu_bacteria | 2977957713 | 2977964322 | 163 |
| 268 | iso_pu_bacteria | 2979793036 | 2979796832 | 163 |
| 269 | iso_pu_bacteria | 2987673487 | 2987673848 | 163 |
| 270 | iso_pu_bacteria | 649633066 | 649870773 | 163 |
| 271 | iso_pu_bacteria | 8004300914 | 8004306863 | 163 |
| 272 | 3300005331 | Ga0070670_100381828 | Ga0070670_1003818282 | 164 |
| 273 | 3300005343 | Ga0070687_100739015 | Ga0070687_1007390151 | 164 |
| 274 | 3300005434 | Ga0070709_10075324 | Ga0070709_100753243 | 164 |
| 275 | 3300005440 | Ga0070705_100972921 | Ga0070705_1009729211 | 164 |
| 276 | 3300005467 | Ga0070706_100906577 | Ga0070706_1009065772 | 164 |
| 277 | 3300005468 | Ga0070707_100037936 | Ga0070707_1000379366 | 164 |
| 278 | 3300005547 | Ga0070693_100003595 | Ga0070693_1000035955 | 164 |
| 279 | 3300005549 | Ga0070704_100686014 | Ga0070704_1006860141 | 164 |
| 280 | 3300005985 | Ga0081539_10197210 | Ga0081539_101972101 | 164 |
| 281 | 3300006051 | Ga0075364_10054039 | Ga0075364_100540393 | 164 |
| 282 | 3300006846 | Ga0075430_100137547 | Ga0075430_1001375472 | 164 |
| 283 | 3300006847 | Ga0075431_100305824 | Ga0075431_1003058243 | 164 |
| 284 | 3300025910 | Ga0207684_11009377 | Ga0207684_110093771 | 164 |
| 285 | 3300025934 | Ga0207686_10001331 | Ga0207686_100013313 | 164 |
| 286 | 3300025934 | Ga0207686_10011983 | Ga0207686_100119835 | 164 |
| 287 | 3300025938 | Ga0207704_10499082 | Ga0207704_104990822 | 164 |
| 288 | 3300028800 | Ga0265338_10029923 | Ga0265338_100299235 | 164 |
| 289 | 3300030836 | Ga0265767_100429 | Ga0265767_1004293 | 164 |
| 290 | 3300031241 | Ga0265325_10040260 | Ga0265325_100402604 | 164 |
| 291 | 3300031249 | Ga0265339_10000205 | Ga0265339_100002056 | 164 |
| 292 | 3300031595 | Ga0265313_10000353 | Ga0265313_100003536 | 164 |
| 293 | 3300031712 | Ga0265342_10103102 | Ga0265342_101031023 | 164 |
| 294 | 3300050490 | nmdc:mga03n38_26765_c1 | nmdc:mga03n38_26765_c1_1556_2074 | 164 |
| 295 | 3300050491 | nmdc:mga00v17_44324_c1 | nmdc:mga00v17_44324_c1_1856_2374 | 164 |
| 296 | 3300050510 | nmdc:mga06r32_551835_c1 | nmdc:mga06r32_551835_c1_54_572 | 164 |
| 297 | 3300053139 | Ga0500568_0011991 | Ga0500568_0011991_2820_3332 | 164 |
| 298 | 3300059507 | Ga0587086_042205 | Ga0587086_042205_23_541 | 164 |
| 299 | 3300060344 | Ga0587071_063967 | Ga0587071_063967_40_558 | 164 |
| 300 | 3300060346 | Ga0587111_0028617 | Ga0587111_0028617_183_701 | 164 |
| 301 | iso_pu_bacteria | 2643221611 | 2644072710 | 164 |
| 302 | 3300005288 | Ga0065714_10146305 | Ga0065714_101463051 | 165 |
| 303 | 3300005288 | Ga0065714_10153743 | Ga0065714_101537431 | 165 |
| 304 | 3300005341 | Ga0070691_10528455 | Ga0070691_105284551 | 165 |
| 305 | 3300005437 | Ga0070710_10498593 | Ga0070710_104985932 | 165 |
| 306 | 3300005439 | Ga0070711_100018416 | Ga0070711_1000184162 | 165 |
| 307 | 3300005546 | Ga0070696_100100244 | Ga0070696_1001002443 | 165 |
| 308 | 3300006175 | Ga0070712_100088880 | Ga0070712_1000888802 | 165 |
| 309 | 3300009553 | Ga0105249_10714379 | Ga0105249_107143791 | 165 |
| 310 | 3300010375 | Ga0105239_10794674 | Ga0105239_107946741 | 165 |
| 311 | 3300013306 | Ga0163162_10111213 | Ga0163162_101112131 | 165 |
| 312 | 3300017792 | Ga0163161_10632850 | Ga0163161_106328502 | 165 |
| 313 | 3300025906 | Ga0207699_10588361 | Ga0207699_105883612 | 165 |
| 314 | 3300025915 | Ga0207693_10111695 | Ga0207693_101116952 | 165 |
| 315 | 3300025934 | Ga0207686_10296884 | Ga0207686_102968842 | 165 |
| 316 | 3300025939 | Ga0207665_10086921 | Ga0207665_100869212 | 165 |
| 317 | 3300032004 | Ga0307414_10009476 | Ga0307414_100094762 | 165 |
| 318 | 3300032004 | Ga0307414_10009476 | Ga0307414_100094763 | 165 |
| 319 | 3300046525 | Ga0495663_0046652 | Ga0495663_0046652_41_589 | 165 |
| 320 | 3300046660 | Ga0495625_0152292 | Ga0495625_0152292_826_1374 | 165 |
| 321 | 3300048903 | Ga0496100_0557143 | Ga0496100_0557143_350_850 | 165 |
| 322 | 3300000549 | LJQas_1010480 | LJQas_10104801 | 166 |
| 323 | 3300003761 | Ga0055535_1001614 | Ga0055535_10016143 | 166 |
| 324 | 3300003762 | Ga0055542_1013046 | Ga0055542_10130462 | 166 |
| 325 | 3300035116 | Ga0373945_0073210 | Ga0373945_0073210_654_1154 | 166 |
| 326 | 3300042156 | Ga0439446_0054471 | Ga0439446_0054471_34_549 | 166 |
| 327 | 3300042876 | Ga0451577_0566924 | Ga0451577_0566924_507_1007 | 166 |
| 328 | 3300045051 | Ga0451576_0876293 | Ga0451576_0876293_163_678 | 166 |
| 329 | 3300045976 | Ga0466967_0836030 | Ga0466967_0836030_170_688 | 166 |
| 330 | 3300046516 | Ga0495628_0601846 | Ga0495628_0601846_241_753 | 166 |
| 331 | 3300046543 | Ga0495645_0061373 | Ga0495645_0061373_1580_2092 | 166 |
| 332 | 3300046559 | Ga0495667_0230520 | Ga0495667_0230520_167_679 | 166 |
| 333 | 3300046663 | Ga0495635_0604462 | Ga0495635_0604462_78_590 | 166 |
| 334 | 3300053088 | Ga0500644_0000203 | Ga0500644_0000203_12051_12569 | 166 |
| 335 | iso_pu_bacteria | 2513020052 | 2513235864 | 166 |
| 336 | iso_pu_bacteria | 2929921140 | 2929925730 | 166 |
| 337 | iso_pu_bacteria | 8003151029 | 8003153300 | 166 |
| 338 | 3300005343 | Ga0070687_100137167 | Ga0070687_1001371672 | 167 |
| 339 | 3300005353 | Ga0070669_100069679 | Ga0070669_1000696792 | 167 |
| 340 | 3300005617 | Ga0068859_100099968 | Ga0068859_1000999682 | 167 |
| 341 | 3300005719 | Ga0068861_100027087 | Ga0068861_1000270874 | 167 |
| 342 | 3300005844 | Ga0068862_101022061 | Ga0068862_1010220611 | 167 |
| 343 | 3300006931 | Ga0097620_100099964 | Ga0097620_1000999642 | 167 |
| 344 | 3300011119 | Ga0105246_10351345 | Ga0105246_103513452 | 167 |
| 345 | 3300014326 | Ga0157380_10173413 | Ga0157380_101734131 | 167 |
| 346 | 3300014745 | Ga0157377_10093747 | Ga0157377_100937471 | 167 |
| 347 | 3300025918 | Ga0207662_10101789 | Ga0207662_101017893 | 167 |
| 348 | 3300025923 | Ga0207681_10100805 | Ga0207681_101008052 | 167 |
| 349 | 3300025940 | Ga0207691_10020607 | Ga0207691_100206075 | 167 |
| 350 | 3300025942 | Ga0207689_10237434 | Ga0207689_102374341 | 167 |
| 351 | 3300026118 | Ga0207675_100012195 | Ga0207675_1000121952 | 167 |
| 352 | 3300028380 | Ga0268265_11204697 | Ga0268265_112046972 | 167 |
| 353 | 3300041413 | Ga0439465_0036843 | Ga0439465_0036843_21_539 | 167 |
| 354 | 3300041997 | Ga0439431_0005150 | Ga0439431_0005150_1825_2343 | 167 |
| 355 | 3300042007 | Ga0439449_0144239 | Ga0439449_0144239_99_617 | 167 |
| 356 | 3300042133 | Ga0450896_005192 | Ga0450896_005192_349_867 | 167 |
| 357 | 3300046529 | Ga0495652_0362137 | Ga0495652_0362137_17_520 | 167 |
| 358 | 3300049581 | Ga0501047_0203853 | Ga0501047_0203853_391_924 | 167 |
| 359 | 3300049584 | Ga0501068_0120906 | Ga0501068_0120906_71_577 | 167 |
| 360 | 3300049822 | Ga0501035_1159949 | Ga0501035_1159949_12_545 | 167 |
| 361 | 3300050511 | nmdc:mga08y16_722286_c1 | nmdc:mga08y16_722286_c1_278_796 | 167 |
| 362 | iso_pu_bacteria | 2987645492 | 2987651501 | 167 |
| 363 | 3300005288 | Ga0065714_10037453 | Ga0065714_100374531 | 168 |
| 364 | 3300005548 | Ga0070665_100137064 | Ga0070665_1001370642 | 168 |
| 365 | 3300009036 | Ga0105244_10081516 | Ga0105244_100815162 | 168 |
| 366 | 3300026121 | Ga0207683_10379328 | Ga0207683_103793282 | 168 |
| 367 | 3300047472 | Ga0495686_0285464 | Ga0495686_0285464_362_892 | 168 |
| 368 | 3300050492 | nmdc:mga0yw44_29501_c1 | nmdc:mga0yw44_29501_c1_1606_2136 | 168 |
| 369 | 3300053134 | Ga0500658_0000003 | Ga0500658_0000003_416502_417089 | 168 |
| 370 | 3300004799 | Ga0058863_10026864 | Ga0058863_100268642 | 169 |
| 371 | 3300013105 | Ga0157369_10850923 | Ga0157369_108509232 | 169 |
| 372 | 3300039450 | Ga0436363_0118154 | Ga0436363_0118154_162_695 | 169 |
| 373 | 3300044694 | Ga0466963_0047368 | Ga0466963_0047368_126_635 | 169 |
| 374 | 3300044719 | Ga0466971_0147766 | Ga0466971_0147766_154_663 | 169 |
| 375 | 3300044842 | Ga0466957_0119400 | Ga0466957_0119400_722_1231 | 169 |
| 376 | 3300045836 | Ga0466958_0009055 | Ga0466958_0009055_2012_2521 | 169 |
| 377 | 3300053096 | Ga0500641_0000417 | Ga0500641_0000417_3657_4214 | 169 |
| 378 | 3300053147 | Ga0500589_078035 | Ga0500589_078035_606_1163 | 169 |
| 379 | 3300053158 | Ga0500627_0209109 | Ga0500627_0209109_114_671 | 169 |
| 380 | 3300059505 | Ga0587083_0063080 | Ga0587083_0063080_25_534 | 169 |
| 381 | 3300059645 | Ga0587076_020642 | Ga0587076_020642_104_613 | 169 |
| 382 | 3300059652 | Ga0587107_064510 | Ga0587107_064510_18_527 | 169 |
| 383 | 3300003215 | JGI25153J46596_10002276 | JGI25153J46596_100022764 | 170 |
| 384 | 3300003323 | rootH1_10041215 | rootH1_100412153 | 170 |
| 385 | 3300003323 | rootH1_10067345 | rootH1_100673452 | 170 |
| 386 | 3300003354 | JGI25160J50197_1006075 | JGI25160J50197_10060752 | 170 |
| 387 | 3300005262 | Ga0065165_1013992 | Ga0065165_10139922 | 170 |
| 388 | 3300025242 | Ga0209258_100252 | Ga0209258_10025275 | 170 |
| 389 | 3300025254 | Ga0209148_1000217 | Ga0209148_100021775 | 170 |
| 390 | 3300025297 | Ga0209758_1007454 | Ga0209758_10074544 | 170 |
| 391 | 3300025302 | Ga0207426_1000371 | Ga0207426_10003715 | 170 |
| 392 | 3300048903 | Ga0496100_0315525 | Ga0496100_0315525_203_718 | 170 |
| 393 | 3300049823 | Ga0501044_0636249 | Ga0501044_0636249_349_939 | 170 |
| 394 | iso_pu_bacteria | 2857618242 | 2857618879 | 170 |
| 395 | 3300002738 | JGI25154J39366_1000025 | JGI25154J39366_100002511 | 171 |
| 396 | 3300002741 | JGI25157J39369_1002640 | JGI25157J39369_10026403 | 171 |
| 397 | 3300006852 | Ga0075433_10203048 | Ga0075433_102030483 | 171 |
| 398 | 3300025246 | Ga0209646_1000037 | Ga0209646_100003712 | 171 |
| 399 | 3300025250 | Ga0209026_1000290 | Ga0209026_100029034 | 171 |
| 400 | 3300032002 | Ga0307416_102874930 | Ga0307416_1028749301 | 171 |
| 401 | 3300032005 | Ga0307411_10040107 | Ga0307411_100401075 | 171 |
| 402 | 3300045051 | Ga0451576_0853319 | Ga0451576_0853319_301_861 | 171 |
| 403 | 3300050515 | nmdc:mga0a205_243466_c1 | nmdc:mga0a205_243466_c1_950_1471 | 171 |
| 404 | 3300053131 | Ga0500652_005122 | Ga0500652_005122_2752_3345 | 171 |
| 405 | 3300053139 | Ga0500568_0032027 | Ga0500568_0032027_509_1102 | 171 |
| 406 | 3300003323 | rootH1_10303365 | rootH1_103033652 | 172 |
| 407 | 3300005981 | Ga0081538_10044625 | Ga0081538_100446252 | 172 |
| 408 | 3300048918 | Ga0496115_0247608 | Ga0496115_0247608_181_774 | 172 |
| 409 | 3300048928 | Ga0496125_0004515 | Ga0496125_0004515_10018_10611 | 172 |
| 410 | 3300048929 | Ga0496126_0031130 | Ga0496126_0031130_2040_2633 | 172 |
| 411 | 3300005347 | Ga0070668_100012747 | Ga0070668_1000127476 | 173 |
| 412 | 3300005347 | Ga0070668_100012747 | Ga0070668_1000127477 | 173 |
| 413 | 3300009553 | Ga0105249_10000092 | Ga0105249_1000009259 | 173 |
| 414 | 3300013306 | Ga0163162_10000002 | Ga0163162_10000002429 | 173 |
| 415 | 3300014326 | Ga0157380_10016696 | Ga0157380_100166963 | 173 |
| 416 | 3300025961 | Ga0207712_10000135 | Ga0207712_1000013542 | 173 |
| 417 | 3300025972 | Ga0207668_10003342 | Ga0207668_1000334211 | 173 |
| 418 | 3300005328 | Ga0070676_10243677 | Ga0070676_102436772 | 174 |
| 419 | 3300046501 | Ga0495607_0218435 | Ga0495607_0218435_13_546 | 174 |
| 420 | 3300046506 | Ga0495583_0013117 | Ga0495583_0013117_843_1376 | 174 |
| 421 | 3300046518 | Ga0495631_0006658 | Ga0495631_0006658_1628_2161 | 174 |
| 422 | 3300046518 | Ga0495631_0064602 | Ga0495631_0064602_159_692 | 174 |
| 423 | 3300046558 | Ga0495633_0000776 | Ga0495633_0000776_6586_7119 | 174 |
| 424 | 3300046648 | Ga0495611_0107523 | Ga0495611_0107523_686_1219 | 174 |
| 425 | 3300046660 | Ga0495625_0017249 | Ga0495625_0017249_3072_3605 | 174 |
| 426 | 3300046684 | Ga0495669_0000011 | Ga0495669_0000011_55959_56492 | 174 |
| 427 | 3300047443 | Ga0495687_000077 | Ga0495687_000077_92498_93031 | 174 |
| 428 | 3300053079 | Ga0500610_0000028 | Ga0500610_0000028_697_1230 | 174 |
| 429 | 3300053730 | Ga0500645_000001 | Ga0500645_000001_166080_166613 | 174 |
| 430 | 2162886011 | MRS1b_contig_3585791 | MRS1b_0061.00001330 | 175 |
| 431 | 3300005290 | Ga0065712_10149860 | Ga0065712_101498602 | 175 |
| 432 | 3300005330 | Ga0070690_100051113 | Ga0070690_1000511132 | 175 |
| 433 | 3300005334 | Ga0068869_100103319 | Ga0068869_1001033192 | 175 |
| 434 | 3300005335 | Ga0070666_10006804 | Ga0070666_100068042 | 175 |
| 435 | 3300005338 | Ga0068868_100099612 | Ga0068868_1000996122 | 175 |
| 436 | 3300005340 | Ga0070689_100061486 | Ga0070689_1000614862 | 175 |
| 437 | 3300005344 | Ga0070661_100081367 | Ga0070661_1000813674 | 175 |
| 438 | 3300005355 | Ga0070671_100095480 | Ga0070671_1000954802 | 175 |
| 439 | 3300005356 | Ga0070674_100618437 | Ga0070674_1006184371 | 175 |
| 440 | 3300005364 | Ga0070673_101198068 | Ga0070673_1011980681 | 175 |
| 441 | 3300005367 | Ga0070667_100075014 | Ga0070667_1000750145 | 175 |
| 442 | 3300005440 | Ga0070705_100595508 | Ga0070705_1005955081 | 175 |
| 443 | 3300005455 | Ga0070663_100767764 | Ga0070663_1007677641 | 175 |
| 444 | 3300005457 | Ga0070662_100095471 | Ga0070662_1000954712 | 175 |
| 445 | 3300005466 | Ga0070685_10456124 | Ga0070685_104561242 | 175 |
| 446 | 3300005544 | Ga0070686_100093282 | Ga0070686_1000932824 | 175 |
| 447 | 3300005564 | Ga0070664_100416443 | Ga0070664_1004164432 | 175 |
| 448 | 3300005616 | Ga0068852_100052227 | Ga0068852_1000522272 | 175 |
| 449 | 3300005617 | Ga0068859_100079652 | Ga0068859_1000796522 | 175 |
| 450 | 3300005618 | Ga0068864_100055319 | Ga0068864_1000553194 | 175 |
| 451 | 3300005718 | Ga0068866_10059105 | Ga0068866_100591052 | 175 |
| 452 | 3300005841 | Ga0068863_100095124 | Ga0068863_1000951242 | 175 |
| 453 | 3300005842 | Ga0068858_100091082 | Ga0068858_1000910822 | 175 |
| 454 | 3300005843 | Ga0068860_100078015 | Ga0068860_1000780154 | 175 |
| 455 | 3300006051 | Ga0075364_10025156 | Ga0075364_100251564 | 175 |
| 456 | 3300006178 | Ga0075367_10099756 | Ga0075367_100997563 | 175 |
| 457 | 3300006237 | Ga0097621_100010379 | Ga0097621_1000103796 | 175 |
| 458 | 3300006881 | Ga0068865_100050201 | Ga0068865_1000502015 | 175 |
| 459 | 3300006931 | Ga0097620_100079652 | Ga0097620_1000796525 | 175 |
| 460 | 3300009011 | Ga0105251_10043885 | Ga0105251_100438853 | 175 |
| 461 | 3300009098 | Ga0105245_10067605 | Ga0105245_100676053 | 175 |
| 462 | 3300009101 | Ga0105247_10065465 | Ga0105247_100654652 | 175 |
| 463 | 3300009148 | Ga0105243_10315082 | Ga0105243_103150822 | 175 |
| 464 | 3300009148 | Ga0105243_10828415 | Ga0105243_108284151 | 175 |
| 465 | 3300009176 | Ga0105242_10110519 | Ga0105242_101105193 | 175 |
| 466 | 3300009177 | Ga0105248_10247208 | Ga0105248_102472082 | 175 |
| 467 | 3300009553 | Ga0105249_10210249 | Ga0105249_102102492 | 175 |
| 468 | 3300013102 | Ga0157371_10341777 | Ga0157371_103417771 | 175 |
| 469 | 3300013296 | Ga0157374_10090146 | Ga0157374_100901464 | 175 |
| 470 | 3300013297 | Ga0157378_10050897 | Ga0157378_100508972 | 175 |
| 471 | 3300013306 | Ga0163162_10048688 | Ga0163162_100486884 | 175 |
| 472 | 3300013307 | Ga0157372_11513665 | Ga0157372_115136651 | 175 |
| 473 | 3300013308 | Ga0157375_10086695 | Ga0157375_100866952 | 175 |
| 474 | 3300014325 | Ga0163163_10099403 | Ga0163163_100994034 | 175 |
| 475 | 3300014968 | Ga0157379_10049298 | Ga0157379_100492982 | 175 |
| 476 | 3300014969 | Ga0157376_10133138 | Ga0157376_101331382 | 175 |
| 477 | 3300017792 | Ga0163161_10050447 | Ga0163161_100504473 | 175 |
| 478 | 3300025735 | Ga0207713_1113747 | Ga0207713_11137471 | 175 |
| 479 | 3300025899 | Ga0207642_10284038 | Ga0207642_102840382 | 175 |
| 480 | 3300025900 | Ga0207710_10016665 | Ga0207710_100166652 | 175 |
| 481 | 3300025903 | Ga0207680_10050854 | Ga0207680_100508542 | 175 |
| 482 | 3300025920 | Ga0207649_10098144 | Ga0207649_100981442 | 175 |
| 483 | 3300025931 | Ga0207644_10047647 | Ga0207644_100476472 | 175 |
| 484 | 3300025933 | Ga0207706_10127371 | Ga0207706_101273713 | 175 |
| 485 | 3300025934 | Ga0207686_10081792 | Ga0207686_100817921 | 175 |
| 486 | 3300025936 | Ga0207670_10024018 | Ga0207670_100240183 | 175 |
| 487 | 3300025938 | Ga0207704_10024455 | Ga0207704_100244552 | 175 |
| 488 | 3300025941 | Ga0207711_10041631 | Ga0207711_100416314 | 175 |
| 489 | 3300025942 | Ga0207689_10170532 | Ga0207689_101705322 | 175 |
| 490 | 3300025945 | Ga0207679_11136946 | Ga0207679_111369461 | 175 |
| 491 | 3300025961 | Ga0207712_11567390 | Ga0207712_115673901 | 175 |
| 492 | 3300025986 | Ga0207658_10039642 | Ga0207658_100396422 | 175 |
| 493 | 3300026023 | Ga0207677_10119925 | Ga0207677_101199252 | 175 |
| 494 | 3300026035 | Ga0207703_10043031 | Ga0207703_100430312 | 175 |
| 495 | 3300026088 | Ga0207641_10089104 | Ga0207641_100891042 | 175 |
| 496 | 3300026095 | Ga0207676_10073518 | Ga0207676_100735183 | 175 |
| 497 | 3300026142 | Ga0207698_10061202 | Ga0207698_100612024 | 175 |
| 498 | 3300028381 | Ga0268264_10080783 | Ga0268264_100807832 | 175 |
| 499 | 3300044673 | Ga0453683_0259218 | Ga0453683_0259218_171_698 | 175 |
| 500 | 3300048907 | Ga0496104_0205197 | Ga0496104_0205197_769_1296 | 175 |
| 501 | 3300048908 | Ga0496105_0177059 | Ga0496105_0177059_1010_1537 | 175 |
| 502 | 3300048913 | Ga0496110_0473479 | Ga0496110_0473479_104_631 | 175 |
| 503 | 3300048917 | Ga0496114_0054330 | Ga0496114_0054330_1167_1694 | 175 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5lye-assembly1.cif.gz_A-3 | re-refined structure of the bacteriophage t4 short tail fibre pdb entry 1h6w containing 71 additionally identified residues | 0.8566 | 6 | 59 |
| 2xgf-assembly1.cif.gz_C | structure of the bacteriophage t4 long tail fibre needle-shaped receptor-binding tip | 0.6806 | 4 | 106 |
| 5iv5-assembly1.cif.gz_O | cryo-electron microscopy structure of the hexagonal pre-attachment t4 baseplate-tail tube complex | 0.549 | 6 | 169 |
| 1ocy-assembly1.cif.gz_A | structure of the receptor-binding domain of the bacteriophage t4 short tail fibre | 0.5464 | 6 | 169 |
| 1pdi-assembly1.cif.gz_A | fitting of the c-terminal part of the short tail fibers into the cryo-em reconstruction of t4 baseplate | 0.5334 | 6 | 169 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ocyA01 | Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain | 0.8397 | 6 | 59 | 3.90.1340.10 |
| 2xgfC01 | Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain | 0.8376 | 4 | 57 | 3.90.1340.10 |
| 1h6wA03 | Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain | 0.7872 | 12 | 58 | 3.90.1340.10 |
| 2xgfC01 | Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain | 0.686 | 4 | 57 | 3.90.1340.10 |
| 1ocyA01 | Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain | 0.6093 | 6 | 59 | 3.90.1340.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y2FQZ0-F1-model_v4 | Phage tail protein | 0.9375 | 2 | 175 |
|
| AF-A4U469-F1-model_v4 | Microcystin dependent protein | 0.8746 | 1 | 175 |
|
| AF-A0A1T5BT98-F1-model_v4 | Phage Tail Collar Domain | 0.8744 | 1 | 175 |
|
| AF-A0A1M6CTK4-F1-model_v4 | Phage Tail Collar Domain | 0.8718 | 1 | 175 |
|
| AF-A0A1T5BT98-F1-model_v4 | Phage Tail Collar Domain | 0.8661 | 1 | 175 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar