F455952

General Info

Members Datasets Scaffolds Average Seq Length
503 360 454 169

Family's Representative Sequence

Representative Sequence 3300002738|JGI25154J39366_1000025|JGI25154J39366_100002511
Length 197
Sequence MSEPFLAMLILFGGNFAIRGWAMAWGQILSIAQNTALFSLLGTTYGGNGQTTFALPDLRGRAPIGWGQGPGLSNYSLGQIGGTENTTLLITNMPAHNHTGVISGGTSTISASTGAGTTNTPGPTMVPAVLPTIGSGPGATQIKGYKVQDNTTTLAPGTVSGNVTIGIAGGSQPFSIQNPYLALTYLIALEGIFPSRN

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2643221611 Acidovorax sp. Root219 Isolate Unclassified
4 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
5 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
6 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
7 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
8 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
9 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
10 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
11 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
12 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
13 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
14 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
15 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
16 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
17 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
18 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
19 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
20 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
21 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
22 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
23 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
24 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
25 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
26 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
27 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
28 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
29 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
30 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
31 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
32 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
33 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
34 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
35 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
36 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
37 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
38 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
39 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
40 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
41 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
42 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
43 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
44 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
45 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
46 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
47 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
48 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
49 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
50 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
51 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
53 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
54 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
55 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
56 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
57 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
59 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
60 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
61 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
62 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
63 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
64 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
65 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
66 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
67 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
68 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
69 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
70 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
71 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
72 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
73 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
74 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
75 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
76 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
77 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
78 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
79 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
80 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
81 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
82 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
83 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
84 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
85 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
86 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
87 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
88 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
89 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
90 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
91 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
92 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
93 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
94 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
95 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
96 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
97 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
98 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
99 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
102 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
103 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
104 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
105 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
106 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
107 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
110 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
111 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
112 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
113 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
114 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
115 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
116 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
117 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
118 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
119 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
120 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
121 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
122 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
123 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
124 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
125 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
127 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
128 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
129 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
130 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
131 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
132 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
134 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
135 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
136 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
137 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
138 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
141 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
142 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
143 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
147 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
148 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
149 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
150 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
151 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
152 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
153 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
154 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
155 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
156 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
157 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
158 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
159 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
160 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
161 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
162 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
163 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
164 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
166 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
167 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
169 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
170 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
171 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
221 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
222 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
225 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
226 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
227 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
228 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
231 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
232 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
233 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
236 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
237 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
238 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
239 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
240 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
241 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
242 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
243 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
249 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
250 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
251 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
252 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
253 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
254 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
255 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
256 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
257 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
258 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
259 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
260 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
263 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
264 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
267 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
268 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
269 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
270 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
271 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
272 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
273 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
274 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
275 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
276 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
277 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
278 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
279 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
280 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
281 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
282 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
283 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
284 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
285 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
286 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
287 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
300 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
303 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
304 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
305 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
314 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
315 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
318 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
319 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
320 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
321 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
324 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
328 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
329 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
330 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
331 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
332 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
333 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
334 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
338 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
339 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
340 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
341 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
342 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
343 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
344 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
345 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
346 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
347 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
348 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
349 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
350 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
358 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
359 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
360 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.87
Metatranscriptomes 1.99
Isolates 9.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.36
Nodule 6.76
Rhizoplane 3.38
Rhizosphere 75.94
Stem 0
Stem Tuber 0
Unclassified 7.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_3585791 2162886011 Bacteria 941
2 LJQas_1010480 3300000549 Bacteria 1110
3 JGI24736J21556_1021942 3300001904 Bacteria 1000
4 JGI24740J21852_10010677 3300001979 Bacteria 3525
5 JGI24743J22301_10069433 3300001991 Bacteria 734
6 JGI25156J39149_1008579 3300002705 Bacteria 2557
7 JGI25154J39366_1000025 3300002738 Bacteria 211189
8 JGI25157J39369_1000700 3300002741 Bacteria 18085
9 JGI25157J39369_1002640 3300002741 Unclassified 4209
10 JGI25406J46586_10118235 3300003203 Bacteria 781
11 JGI25153J46596_10002276 3300003215 Bacteria 11185
12 rootH1_10041215 3300003323 Bacteria 2479
13 rootH1_10067345 3300003323 Bacteria 3056
14 rootH1_10303365 3300003323 Bacteria 2866
15 JGI25160J50197_1006075 3300003354 Bacteria 4929
16 Ga0055535_1001614 3300003761 Bacteria 10567
17 Ga0055542_1013046 3300003762 Bacteria 1413
18 Ga0058863_10026864 3300004799 Unclassified 965
19 Ga0065165_1013992 3300005262 Bacteria 3143
20 Ga0065714_10037453 3300005288 Bacteria 959
21 Ga0065714_10146305 3300005288 Bacteria 1136
22 Ga0065714_10153743 3300005288 Bacteria 1090
23 Ga0065704_10142336 3300005289 Bacteria 1459
24 Ga0065712_10080023 3300005290 Bacteria 3153
25 Ga0065712_10149860 3300005290 Bacteria 1378
26 Ga0070676_10243677 3300005328 Bacteria 1197
27 Ga0070690_100005999 3300005330 Bacteria 6863
28 Ga0070690_100051113 3300005330 Bacteria 2637
29 Ga0070670_100004949 3300005331 Bacteria 11211
30 Ga0070670_100381828 3300005331 Bacteria 1241
31 Ga0068869_100001770 3300005334 Bacteria 12931
32 Ga0068869_100103319 3300005334 Bacteria 2159
33 Ga0068869_100901227 3300005334 Bacteria 765
34 Ga0070666_10006804 3300005335 Bacteria 7044
35 Ga0070680_100024813 3300005336 Bacteria 4792
36 Ga0068868_100000513 3300005338 Bacteria 25868
37 Ga0068868_100099612 3300005338 Bacteria 2351
38 Ga0070660_100011649 3300005339 Bacteria 6259
39 Ga0070689_100023208 3300005340 Bacteria 4642
40 Ga0070689_100061486 3300005340 Bacteria 2922
41 Ga0070691_10528455 3300005341 Bacteria 686
42 Ga0070687_100137167 3300005343 Bacteria 1420
43 Ga0070687_100739015 3300005343 Unclassified 691
44 Ga0070661_100081367 3300005344 Bacteria 2391
45 Ga0070692_10011135 3300005345 Bacteria 4121
46 Ga0070692_10018199 3300005345 Bacteria 3373
47 Ga0070692_10048312 3300005345 Unclassified 2204
48 Ga0070668_100012747 3300005347 Bacteria 6257
49 Ga0070669_100024053 3300005353 Unclassified 4365
50 Ga0070669_100069679 3300005353 Bacteria 2598
51 Ga0070669_100362676 3300005353 Bacteria 1179
52 Ga0070671_100095480 3300005355 Bacteria 2492
53 Ga0070671_100166668 3300005355 Bacteria 1863
54 Ga0070674_100618437 3300005356 Unclassified 917
55 Ga0070673_100022523 3300005364 Bacteria 4587
56 Ga0070673_101198068 3300005364 Unclassified 711
57 Ga0070659_100000437 3300005366 Bacteria 31405
58 Ga0070667_100075014 3300005367 Bacteria 2887
59 Ga0070667_100460872 3300005367 Bacteria 1162
60 Ga0070709_10075324 3300005434 Bacteria 2189
61 Ga0070713_101225766 3300005436 Bacteria 726
62 Ga0070710_10498593 3300005437 Bacteria 833
63 Ga0070711_100018416 3300005439 Bacteria 4458
64 Ga0070705_100595508 3300005440 Unclassified 854
65 Ga0070705_100972921 3300005440 Unclassified 687
66 Ga0070700_100001026 3300005441 Bacteria 13798
67 Ga0070700_100092403 3300005441 Unclassified 1977
68 Ga0070694_100036907 3300005444 Unclassified 3239
69 Ga0070663_100767764 3300005455 Unclassified 824
70 Ga0070662_100095471 3300005457 Bacteria 2241
71 Ga0070662_100155982 3300005457 Unclassified 1782
72 Ga0070685_10045374 3300005466 Bacteria 2520
73 Ga0070685_10456124 3300005466 Bacteria 896
74 Ga0070706_100906577 3300005467 Bacteria 814
75 Ga0070707_100037936 3300005468 Bacteria 4601
76 Ga0070697_100076984 3300005536 Bacteria 2744
77 Ga0068853_100017586 3300005539 Bacteria 5900
78 Ga0070686_100093282 3300005544 Bacteria 2018
79 Ga0070695_100000714 3300005545 Bacteria 17670
80 Ga0070695_100256098 3300005545 Bacteria 1276
81 Ga0070696_100100244 3300005546 Bacteria 2074
82 Ga0070693_100003595 3300005547 Bacteria 7236
83 Ga0070693_100008236 3300005547 Bacteria 5127
84 Ga0070665_100137064 3300005548 Bacteria 2450
85 Ga0070704_100035895 3300005549 Unclassified 3373
86 Ga0070704_100670284 3300005549 Unclassified 917
87 Ga0070704_100686014 3300005549 Bacteria 907
88 Ga0068855_100345358 3300005563 Bacteria 1640
89 Ga0070664_100416443 3300005564 Bacteria 1230
90 Ga0070664_100684623 3300005564 Bacteria 954
91 Ga0068857_100711342 3300005577 Bacteria 955
92 Ga0068854_100298763 3300005578 Bacteria 1302
93 Ga0068854_100885214 3300005578 Bacteria 784
94 Ga0068856_100019362 3300005614 Bacteria 6607
95 Ga0070702_100209994 3300005615 Bacteria 1295
96 Ga0068852_100015113 3300005616 Bacteria 5972
97 Ga0068852_100052227 3300005616 Bacteria 3512
98 Ga0068859_100079652 3300005617 Bacteria 3316
99 Ga0068859_100099968 3300005617 Bacteria 2956
100 Ga0068864_100055319 3300005618 Bacteria 3425
101 Ga0068864_100469478 3300005618 Bacteria 1206
102 Ga0068866_10059105 3300005718 Bacteria 1982
103 Ga0068861_100027087 3300005719 Bacteria 4172
104 Ga0068863_100095124 3300005841 Bacteria 2827
105 Ga0068858_100091082 3300005842 Bacteria 2838
106 Ga0068860_100078015 3300005843 Bacteria 3150
107 Ga0068862_100021413 3300005844 Bacteria 5402
108 Ga0068862_101022061 3300005844 Bacteria 818
109 Ga0081538_10044625 3300005981 Unclassified 2762
110 Ga0081539_10055841 3300005985 Bacteria 2194
111 Ga0081539_10197210 3300005985 Unclassified 933
112 Ga0075365_10039414 3300006038 Bacteria 3076
113 Ga0075364_10000219 3300006051 Bacteria 27057
114 Ga0075364_10025156 3300006051 Bacteria 3787
115 Ga0075364_10054039 3300006051 Bacteria 2626
116 Ga0070715_10000068 3300006163 Bacteria 33105
117 Ga0070715_10238856 3300006163 Bacteria 944
118 Ga0070716_100368775 3300006173 Unclassified 1022
119 Ga0070716_100437164 3300006173 Bacteria 950
120 Ga0070712_100088880 3300006175 Bacteria 2258
121 Ga0070712_100596128 3300006175 Bacteria 935
122 Ga0075367_10099756 3300006178 Bacteria 1774
123 Ga0097621_100010379 3300006237 Bacteria 6812
124 Ga0075428_100152424 3300006844 Bacteria 2511
125 Ga0075430_100023918 3300006846 Bacteria 5202
126 Ga0075430_100032014 3300006846 Bacteria 4463
127 Ga0075430_100137547 3300006846 Bacteria 2035
128 Ga0075431_100002439 3300006847 Bacteria 17891
129 Ga0075431_100089044 3300006847 Bacteria 3186
130 Ga0075431_100305824 3300006847 Bacteria 1606
131 Ga0075433_10203048 3300006852 Bacteria 1762
132 Ga0075434_100056963 3300006871 Bacteria 3884
133 Ga0068865_100050201 3300006881 Bacteria 2880
134 Ga0097620_100079652 3300006931 Bacteria 3316
135 Ga0097620_100099964 3300006931 Bacteria 2956
136 Ga0075435_100263784 3300007076 Bacteria 1468
137 Ga0105251_10043885 3300009011 Bacteria 2163
138 Ga0105244_10081516 3300009036 Bacteria 1601
139 Ga0105245_10067605 3300009098 Bacteria 3236
140 Ga0105247_10065465 3300009101 Bacteria 2261
141 Ga0105247_11191589 3300009101 Bacteria 606
142 Ga0114129_10017606 3300009147 Bacteria 10171
143 Ga0114129_10210844 3300009147 Bacteria 2626
144 Ga0114129_10263576 3300009147 Bacteria 2308
145 Ga0114129_10846272 3300009147 Bacteria 1163
146 Ga0114129_11400649 3300009147 Bacteria 863
147 Ga0114129_11651391 3300009147 Bacteria 783
148 Ga0105243_10315082 3300009148 Bacteria 1423
149 Ga0105243_10828415 3300009148 Bacteria 914
150 Ga0105243_11838428 3300009148 Bacteria 637
151 Ga0105241_10512710 3300009174 Bacteria 1071
152 Ga0105242_10001700 3300009176 Bacteria 17415
153 Ga0105242_10005282 3300009176 Bacteria 9971
154 Ga0105242_10110519 3300009176 Bacteria 2342
155 Ga0105242_10227206 3300009176 Bacteria 1671
156 Ga0105248_10247208 3300009177 Bacteria 2008
157 Ga0105237_10316691 3300009545 Bacteria 1563
158 Ga0105249_10000092 3300009553 Bacteria 125188
159 Ga0105249_10210249 3300009553 Bacteria 1909
160 Ga0105249_10282643 3300009553 Bacteria 1658
161 Ga0105249_10353338 3300009553 Bacteria 1489
162 Ga0105249_10714379 3300009553 Bacteria 1063
163 Ga0105239_10794674 3300010375 Bacteria 1084
164 Ga0105246_10351345 3300011119 Bacteria 1208
165 Ga0157371_10341777 3300013102 Bacteria 1089
166 Ga0157369_10483639 3300013105 Bacteria 1281
167 Ga0157369_10850923 3300013105 Unclassified 936
168 Ga0157374_10077447 3300013296 Bacteria 3147
169 Ga0157374_10090146 3300013296 Bacteria 2922
170 Ga0157378_10050897 3300013297 Bacteria 3685
171 Ga0157378_10081313 3300013297 Bacteria 2928
172 Ga0163162_10000002 3300013306 Bacteria 717331
173 Ga0163162_10048688 3300013306 Bacteria 4247
174 Ga0163162_10111213 3300013306 Bacteria 2837
175 Ga0157372_11513665 3300013307 Unclassified 773
176 Ga0157375_10086695 3300013308 Bacteria 3182
177 Ga0163163_10099403 3300014325 Bacteria 2931
178 Ga0157380_10009008 3300014326 Bacteria 7129
179 Ga0157380_10016696 3300014326 Bacteria 5420
180 Ga0157380_10173413 3300014326 Unclassified 1887
181 Ga0157380_10442146 3300014326 Bacteria 1246
182 Ga0182008_10000032 3300014497 Bacteria 162985
183 Ga0157377_10093747 3300014745 Bacteria 1778
184 Ga0157379_10049298 3300014968 Bacteria 3759
185 Ga0157376_10133138 3300014969 Bacteria 2221
186 Ga0157376_11272498 3300014969 Bacteria 765
187 Ga0163161_10050447 3300017792 Bacteria 3012
188 Ga0163161_10215541 3300017792 Bacteria 1484
189 Ga0163161_10632850 3300017792 Bacteria 885
190 Ga0213872_10045997 3300021361 Bacteria 1986
191 Ga0213876_10000935 3300021384 Bacteria 19266
192 Ga0213875_10227601 3300021388 Bacteria 878
193 Ga0209258_100252 3300025242 Bacteria 97179
194 Ga0209646_1000037 3300025246 Bacteria 355116
195 Ga0209026_1000050 3300025250 Bacteria 254994
196 Ga0209026_1000290 3300025250 Bacteria 56927
197 Ga0209148_1000217 3300025254 Bacteria 98076
198 Ga0209759_1000229 3300025256 Bacteria 83575
199 Ga0209758_1007454 3300025297 Bacteria 7440
200 Ga0207426_1000371 3300025302 Bacteria 79084
201 Ga0209257_1033040 3300025304 Bacteria 1632
202 Ga0207713_1113747 3300025735 Bacteria 916
203 Ga0207682_10125532 3300025893 Bacteria 1142
204 Ga0207642_10284038 3300025899 Bacteria 953
205 Ga0207710_10016665 3300025900 Bacteria 3110
206 Ga0207710_10116558 3300025900 Bacteria 1272
207 Ga0207680_10050854 3300025903 Bacteria 2475
208 Ga0207685_10000059 3300025905 Bacteria 33076
209 Ga0207699_10588361 3300025906 Bacteria 810
210 Ga0207699_10667961 3300025906 Bacteria 760
211 Ga0207684_11009377 3300025910 Unclassified 696
212 Ga0207695_11394358 3300025913 Bacteria 581
213 Ga0207671_10169395 3300025914 Bacteria 1695
214 Ga0207693_10075453 3300025915 Bacteria 2640
215 Ga0207693_10111695 3300025915 Bacteria 2144
216 Ga0207660_10112525 3300025917 Bacteria 2050
217 Ga0207662_10101789 3300025918 Bacteria 1781
218 Ga0207657_10007640 3300025919 Bacteria 11064
219 Ga0207649_10098144 3300025920 Bacteria 1933
220 Ga0207681_10100805 3300025923 Bacteria 2082
221 Ga0207650_10036271 3300025925 Bacteria 3586
222 Ga0207659_10096964 3300025926 Bacteria 2214
223 Ga0207687_11116222 3300025927 Bacteria 677
224 Ga0207700_10229675 3300025928 Bacteria 1577
225 Ga0207700_10441137 3300025928 Bacteria 1146
226 Ga0207644_10047647 3300025931 Bacteria 3059
227 Ga0207644_10125202 3300025931 Bacteria 1961
228 Ga0207690_10000535 3300025932 Bacteria 24774
229 Ga0207706_10121990 3300025933 Unclassified 2292
230 Ga0207706_10127371 3300025933 Bacteria 2239
231 Ga0207686_10001331 3300025934 Bacteria 14069
232 Ga0207686_10011983 3300025934 Bacteria 4759
233 Ga0207686_10081792 3300025934 Bacteria 2109
234 Ga0207686_10296884 3300025934 Bacteria 1199
235 Ga0207670_10024018 3300025936 Bacteria 3805
236 Ga0207704_10024455 3300025938 Bacteria 3276
237 Ga0207704_10499082 3300025938 Bacteria 980
238 Ga0207665_10086921 3300025939 Bacteria 2161
239 Ga0207665_10426977 3300025939 Unclassified 1013
240 Ga0207691_10020607 3300025940 Bacteria 6234
241 Ga0207711_10041631 3300025941 Bacteria 3912
242 Ga0207689_10011112 3300025942 Bacteria 7731
243 Ga0207689_10170532 3300025942 Bacteria 1794
244 Ga0207689_10237434 3300025942 Bacteria 1507
245 Ga0207679_10313722 3300025945 Bacteria 1356
246 Ga0207679_10554546 3300025945 Bacteria 1031
247 Ga0207679_11136946 3300025945 Bacteria 716
248 Ga0207667_10781721 3300025949 Bacteria 952
249 Ga0207712_10000135 3300025961 Bacteria 77342
250 Ga0207712_11567390 3300025961 Unclassified 590
251 Ga0207668_10003342 3300025972 Bacteria 9398
252 Ga0207640_10201376 3300025981 Bacteria 1509
253 Ga0207640_10375268 3300025981 Bacteria 1151
254 Ga0207658_10039642 3300025986 Bacteria 3399
255 Ga0207677_10000065 3300026023 Bacteria 88193
256 Ga0207677_10119925 3300026023 Bacteria 1976
257 Ga0207703_10043031 3300026035 Bacteria 3623
258 Ga0207639_10472393 3300026041 Bacteria 1142
259 Ga0207708_10001475 3300026075 Bacteria 17580
260 Ga0207708_10235062 3300026075 Bacteria 1472
261 Ga0207702_10030748 3300026078 Bacteria 4473
262 Ga0207641_10089104 3300026088 Bacteria 2695
263 Ga0207676_10073518 3300026095 Bacteria 2751
264 Ga0207675_100012195 3300026118 Bacteria 8028
265 Ga0207683_10379328 3300026121 Bacteria 1299
266 Ga0207698_10061202 3300026142 Bacteria 2932
267 Ga0207698_10356573 3300026142 Bacteria 1383
268 Ga0268265_10029443 3300028380 Unclassified 3941
269 Ga0268265_11204697 3300028380 Bacteria 755
270 Ga0268264_10080783 3300028381 Bacteria 2777
271 Ga0265338_10029923 3300028800 Bacteria 5384
272 Ga0316176_1123934 3300030732 Bacteria 1011
273 Ga0265762_1035543 3300030760 Bacteria 959
274 Ga0265767_100429 3300030836 Bacteria 1768
275 Ga0265325_10040260 3300031241 Bacteria 2455
276 Ga0265339_10000205 3300031249 Bacteria 48438
277 Ga0307408_100154382 3300031548 Bacteria 1816
278 Ga0265313_10000353 3300031595 Bacteria 50100
279 Ga0307508_10013297 3300031616 Bacteria 7528
280 Ga0265342_10103102 3300031712 Bacteria 1622
281 Ga0307516_10031784 3300031730 Bacteria 5320
282 Ga0307405_10496620 3300031731 Bacteria 977
283 Ga0307413_10001087 3300031824 Bacteria 9944
284 Ga0307413_10003345 3300031824 Bacteria 6736
285 Ga0307410_10735499 3300031852 Bacteria 834
286 Ga0307406_10123128 3300031901 Bacteria 1807
287 Ga0307412_10105003 3300031911 Bacteria 2006
288 Ga0307412_10934668 3300031911 Bacteria 762
289 Ga0307409_100059689 3300031995 Bacteria 2970
290 Ga0307409_101039770 3300031995 Bacteria 838
291 Ga0307416_100045428 3300032002 Bacteria 3459
292 Ga0307416_100104981 3300032002 Bacteria 2472
293 Ga0307416_102874930 3300032002 Unclassified 576
294 Ga0307414_10009476 3300032004 Bacteria 5596
295 Ga0307414_10599642 3300032004 Bacteria 987
296 Ga0307411_10000001 3300032005 Bacteria 931810
297 Ga0307411_10040107 3300032005 Bacteria 2968
298 Ga0307415_100016347 3300032126 Bacteria 4421
299 Ga0307415_100213486 3300032126 Bacteria 1541
300 Ga0307415_100657238 3300032126 Bacteria 940
301 Ga0373940_0168393 3300035088 Bacteria 707
302 Ga0373945_0073210 3300035116 Bacteria 1301
303 Ga0373961_0217662 3300035241 Bacteria 680
304 Ga0373927_0144169 3300035695 Bacteria 1559
305 Ga0395900_1162217 3300037418 Bacteria 688
306 Ga0395900_1878692 3300037418 Unclassified 509
307 Ga0436364_1180439 3300037853 Bacteria 1849
308 Ga0436365_1526301 3300039437 Bacteria 136420
309 Ga0436361_0400086 3300039447 Bacteria 7525
310 Ga0436363_0118154 3300039450 Bacteria 946
311 Ga0439465_0036843 3300041413 Bacteria 1572
312 Ga0451797_1019589 3300041453 Bacteria 786
313 Ga0439431_0005150 3300041997 Bacteria 2883
314 Ga0439448_0022006 3300042005 Bacteria 1978
315 Ga0439449_0144239 3300042007 Bacteria 887
316 Ga0450896_005192 3300042133 Bacteria 1775
317 Ga0439446_0054471 3300042156 Bacteria 1200
318 Ga0439459_0022508 3300042438 Bacteria 1220
319 Ga0450893_0113209 3300042532 Bacteria 561
320 Ga0451577_0173725 3300042876 Bacteria 1942
321 Ga0451577_0566924 3300042876 Bacteria 1031
322 Ga0451577_0603856 3300042876 Bacteria 996
323 Ga0453683_0221162 3300044673 Bacteria 1204
324 Ga0453683_0259218 3300044673 Bacteria 1109
325 Ga0466963_0047368 3300044694 Bacteria 2837
326 Ga0466964_0646058 3300044706 Bacteria 585
327 Ga0466971_0073418 3300044719 Bacteria 1555
328 Ga0466971_0147766 3300044719 Bacteria 1096
329 Ga0466970_0077973 3300044765 Bacteria 1787
330 Ga0466957_0073494 3300044842 Bacteria 2119
331 Ga0466957_0119400 3300044842 Bacteria 1679
332 Ga0451576_0853319 3300045051 Bacteria 956
333 Ga0451576_0876293 3300045051 Bacteria 942
334 Ga0466958_0009055 3300045836 Bacteria 5529
335 Ga0466967_0157127 3300045976 Bacteria 2131
336 Ga0466967_0836030 3300045976 Bacteria 915
337 Ga0495607_0218435 3300046501 Bacteria 934
338 Ga0495583_0013117 3300046506 Bacteria 4643
339 Ga0495606_0001529 3300046507 Bacteria 30601
340 Ga0495628_0601846 3300046516 Unclassified 785
341 Ga0495631_0006658 3300046518 Bacteria 5940
342 Ga0495631_0064602 3300046518 Bacteria 1584
343 Ga0495644_0241212 3300046523 Bacteria 701
344 Ga0495663_0046652 3300046525 Bacteria 1331
345 Ga0495652_0362137 3300046529 Bacteria 1036
346 Ga0495609_0022213 3300046538 Bacteria 2924
347 Ga0495645_0061373 3300046543 Bacteria 2724
348 Ga0495633_0000776 3300046558 Bacteria 28552
349 Ga0495633_0112705 3300046558 Bacteria 1261
350 Ga0495667_0230520 3300046559 Bacteria 1181
351 Ga0495611_0107523 3300046648 Bacteria 1297
352 Ga0495625_0017249 3300046660 Bacteria 5653
353 Ga0495625_0152292 3300046660 Bacteria 1554
354 Ga0495635_0604462 3300046663 Bacteria 716
355 Ga0495669_0000011 3300046684 Bacteria 158720
356 Ga0495672_0083334 3300047320 Bacteria 1776
357 Ga0495687_000077 3300047443 Bacteria 148889
358 Ga0495686_0285464 3300047472 Bacteria 916
359 Ga0496100_0315525 3300048903 Bacteria 1173
360 Ga0496100_0557143 3300048903 Bacteria 887
361 Ga0496103_0405780 3300048906 Bacteria 875
362 Ga0496104_0205197 3300048907 Bacteria 1883
363 Ga0496104_1145732 3300048907 Bacteria 681
364 Ga0496105_0177059 3300048908 Bacteria 1747
365 Ga0496108_1618907 3300048911 Bacteria 535
366 Ga0496110_0473479 3300048913 Unclassified 1141
367 Ga0496110_0804851 3300048913 Bacteria 844
368 Ga0496111_0726237 3300048914 Bacteria 721
369 Ga0496112_0196472 3300048915 Bacteria 1978
370 Ga0496113_0028422 3300048916 Bacteria 4022
371 Ga0496113_0145418 3300048916 Bacteria 1867
372 Ga0496114_0054330 3300048917 Bacteria 3340
373 Ga0496114_0072232 3300048917 Bacteria 2902
374 Ga0496115_0247608 3300048918 Bacteria 1468
375 Ga0496117_0001287 3300048920 Bacteria 36971
376 Ga0496118_0001350 3300048921 Bacteria 37040
377 Ga0496121_0003107 3300048924 Bacteria 24004
378 Ga0496122_0003368 3300048925 Bacteria 21040
379 Ga0496123_0002880 3300048926 Bacteria 20186
380 Ga0496124_0005075 3300048927 Bacteria 15016
381 Ga0496125_0004515 3300048928 Bacteria 15998
382 Ga0496125_0403429 3300048928 Bacteria 798
383 Ga0496126_0022071 3300048929 Bacteria 6202
384 Ga0496126_0031130 3300048929 Bacteria 5046
385 Ga0501032_0073744 3300049569 Bacteria 2274
386 Ga0501034_0000462 3300049571 Bacteria 67291
387 Ga0501034_0346971 3300049571 Bacteria 1413
388 Ga0501037_0207704 3300049573 Bacteria 1382
389 Ga0501043_0264624 3300049579 Bacteria 1321
390 Ga0501046_0031293 3300049580 Bacteria 4315
391 Ga0501047_0038356 3300049581 Bacteria 4636
392 Ga0501047_0203853 3300049581 Bacteria 1838
393 Ga0501047_0311574 3300049581 Bacteria 1414
394 Ga0501067_0422011 3300049583 Bacteria 744
395 Ga0501068_0120906 3300049584 Bacteria 1632
396 Ga0501068_0149200 3300049584 Unclassified 1469
397 Ga0501069_0050086 3300049585 Bacteria 2322
398 Ga0501070_0013611 3300049586 Bacteria 6856
399 Ga0501070_1464006 3300049586 Unclassified 517
400 Ga0501073_0211197 3300049589 Bacteria 1341
401 Ga0501074_0069229 3300049590 Bacteria 2537
402 Ga0501235_027726 3300049669 Bacteria 1271
403 Ga0501249_009717 3300049679 Bacteria 2001
404 Ga0501079_0077104 3300049741 Bacteria 2578
405 Ga0501080_0042679 3300049742 Bacteria 4222
406 Ga0501080_0279012 3300049742 Bacteria 1519
407 Ga0501241_026082 3300049758 Bacteria 1090
408 Ga0501266_000023 3300049763 Bacteria 82396
409 Ga0501035_1159949 3300049822 Bacteria 601
410 Ga0501044_0344954 3300049823 Bacteria 1410
411 Ga0501044_0636249 3300049823 Bacteria 957
412 nmdc:mga03683_102317_c1 3300050489 Bacteria 1260
413 nmdc:mga03n38_26765_c1 3300050490 Bacteria 2385
414 nmdc:mga00v17_44324_c1 3300050491 Bacteria 2682
415 nmdc:mga0yw44_29501_c1 3300050492 Bacteria 3167
416 nmdc:mga0yw44_32864_c1 3300050492 Bacteria 3026
417 nmdc:mga05p37_1091298_c1 3300050507 Bacteria 837
418 nmdc:mga05p37_1342_c1 3300050507 Bacteria 28603
419 nmdc:mga05p37_1427824_c1 3300050507 Bacteria 695
420 nmdc:mga05p37_812235_c1 3300050507 Bacteria 1021
421 nmdc:mga09592_143450_c1 3300050508 Bacteria 2059
422 nmdc:mga0qj67_11676_c1 3300050509 Bacteria 6589
423 nmdc:mga06r32_126897_c1 3300050510 Bacteria 2521
424 nmdc:mga06r32_14293_c1 3300050510 Bacteria 7200
425 nmdc:mga06r32_551835_c1 3300050510 Bacteria 1126
426 nmdc:mga08y16_1687210_c1 3300050511 Unclassified 589
427 nmdc:mga08y16_722286_c1 3300050511 Bacteria 994
428 nmdc:mga0n895_579034_c1 3300050512 Bacteria 1126
429 nmdc:mga0rr50_207993_c2 3300050513 Bacteria 1162
430 nmdc:mga0a205_1458812_c1 3300050515 Bacteria 532
431 nmdc:mga0a205_243466_c1 3300050515 Bacteria 1679
432 nmdc:mga0a205_635635_c1 3300050515 Bacteria 919
433 Ga0500610_0000028 3300053079 Bacteria 52793
434 Ga0495655_0001346 3300053083 Bacteria 3779
435 Ga0500644_0000203 3300053088 Bacteria 35985
436 Ga0500644_0291550 3300053088 Bacteria 696
437 Ga0500641_0000417 3300053096 Bacteria 15703
438 Ga0500652_005122 3300053131 Bacteria 4102
439 Ga0500658_0000003 3300053134 Bacteria 512506
440 Ga0500568_0003948 3300053139 Bacteria 8071
441 Ga0500568_0011991 3300053139 Bacteria 4000
442 Ga0500568_0032027 3300053139 Unclassified 2164
443 Ga0500589_078035 3300053147 Bacteria 1483
444 Ga0500627_0209109 3300053158 Bacteria 873
445 Ga0500645_000001 3300053730 Bacteria 455558
446 Ga0501084_0064835 3300054114 Bacteria 3056
447 Ga0587083_0063080 3300059505 Bacteria 841
448 Ga0587086_042205 3300059507 Unclassified 710
449 Ga0587109_023302 3300059624 Bacteria 1121
450 Ga0587076_020642 3300059645 Bacteria 1083
451 Ga0587107_064510 3300059652 Bacteria 654
452 Ga0587071_063967 3300060344 Bacteria 787
453 Ga0587111_0028617 3300060346 Bacteria 1123
454 Ga0501082_0019281 3300060353 Bacteria 5880

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10039414 Ga0075365_100394142 135
2 3300048913 Ga0496110_0804851 Ga0496110_0804851_210_632 135
3 3300048914 Ga0496111_0726237 Ga0496111_0726237_257_679 135
4 3300048916 Ga0496113_0145418 Ga0496113_0145418_913_1335 135
5 3300048920 Ga0496117_0001287 Ga0496117_0001287_29612_30034 135
6 3300048921 Ga0496118_0001350 Ga0496118_0001350_6995_7417 135
7 3300048924 Ga0496121_0003107 Ga0496121_0003107_9523_9945 135
8 3300048925 Ga0496122_0003368 Ga0496122_0003368_10416_10838 135
9 3300048926 Ga0496123_0002880 Ga0496123_0002880_13612_14034 135
10 3300048927 Ga0496124_0005075 Ga0496124_0005075_1418_1840 135
11 3300048929 Ga0496126_0022071 Ga0496126_0022071_2488_2910 135
12 3300050492 nmdc:mga0yw44_32864_c1 nmdc:mga0yw44_32864_c1_2354_2776 135
13 3300042532 Ga0450893_0113209 Ga0450893_0113209_101_541 139
14 3300005330 Ga0070690_100005999 Ga0070690_1000059999 140
15 3300005345 Ga0070692_10048312 Ga0070692_100483122 140
16 3300005353 Ga0070669_100024053 Ga0070669_1000240533 140
17 3300005441 Ga0070700_100092403 Ga0070700_1000924033 140
18 3300005444 Ga0070694_100036907 Ga0070694_1000369072 140
19 3300005457 Ga0070662_100155982 Ga0070662_1001559822 140
20 3300005549 Ga0070704_100035895 Ga0070704_1000358954 140
21 3300005844 Ga0068862_100021413 Ga0068862_1000214135 140
22 3300014326 Ga0157380_10009008 Ga0157380_100090084 140
23 3300025933 Ga0207706_10121990 Ga0207706_101219903 140
24 3300026075 Ga0207708_10235062 Ga0207708_102350621 140
25 3300028380 Ga0268265_10029443 Ga0268265_100294434 140
26 3300050489 nmdc:mga03683_102317_c1 nmdc:mga03683_102317_c1_54_524 141
27 3300013105 Ga0157369_10483639 Ga0157369_104836392 142
28 3300037418 Ga0395900_1878692 Ga0395900_1878692_66_494 142
29 iso_pu_bacteria 2965110997 2965116921 143
30 3300009147 Ga0114129_11400649 Ga0114129_114006492 145
31 3300049669 Ga0501235_027726 Ga0501235_027726_586_1089 145
32 3300050515 nmdc:mga0a205_1458812_c1 nmdc:mga0a205_1458812_c1_32_511 145
33 3300005578 Ga0068854_100298763 Ga0068854_1002987632 146
34 3300009147 Ga0114129_10263576 Ga0114129_102635763 146
35 3300044673 Ga0453683_0221162 Ga0453683_0221162_405_944 146
36 3300050507 nmdc:mga05p37_812235_c1 nmdc:mga05p37_812235_c1_442_951 146
37 iso_pu_bacteria 3004239961 3004241419 146
38 3300006847 Ga0075431_100002439 Ga0075431_10000243912 147
39 3300050509 nmdc:mga0qj67_11676_c1 nmdc:mga0qj67_11676_c1_3986_4489 147
40 3300050510 nmdc:mga06r32_14293_c1 nmdc:mga06r32_14293_c1_5262_5765 147
41 3300006846 Ga0075430_100032014 Ga0075430_1000320143 148
42 3300006844 Ga0075428_100152424 Ga0075428_1001524242 149
43 3300035088 Ga0373940_0168393 Ga0373940_0168393_208_687 150
44 3300049571 Ga0501034_0346971 Ga0501034_0346971_27_500 150
45 3300049573 Ga0501037_0207704 Ga0501037_0207704_52_525 150
46 3300049579 Ga0501043_0264624 Ga0501043_0264624_51_524 150
47 3300049580 Ga0501046_0031293 Ga0501046_0031293_3067_3540 150
48 3300049581 Ga0501047_0311574 Ga0501047_0311574_53_526 150
49 3300049583 Ga0501067_0422011 Ga0501067_0422011_190_663 150
50 3300049585 Ga0501069_0050086 Ga0501069_0050086_504_977 150
51 3300049586 Ga0501070_0013611 Ga0501070_0013611_2605_3078 150
52 3300049586 Ga0501070_1464006 Ga0501070_1464006_31_504 150
53 3300049589 Ga0501073_0211197 Ga0501073_0211197_783_1256 150
54 3300049590 Ga0501074_0069229 Ga0501074_0069229_1147_1620 150
55 3300049741 Ga0501079_0077104 Ga0501079_0077104_1384_1857 150
56 3300049742 Ga0501080_0279012 Ga0501080_0279012_53_526 150
57 3300054114 Ga0501084_0064835 Ga0501084_0064835_682_1155 150
58 3300060353 Ga0501082_0019281 Ga0501082_0019281_1563_2036 150
59 3300031616 Ga0307508_10013297 Ga0307508_100132973 151
60 3300031901 Ga0307406_10123128 Ga0307406_101231281 151
61 3300032005 Ga0307411_10000001 Ga0307411_1000000133 151
62 3300049758 Ga0501241_026082 Ga0501241_026082_217_804 151
63 3300049763 Ga0501266_000023 Ga0501266_000023_9898_10485 151
64 3300046507 Ga0495606_0001529 Ga0495606_0001529_4702_5205 152
65 3300005549 Ga0070704_100670284 Ga0070704_1006702842 153
66 3300006051 Ga0075364_10000219 Ga0075364_1000021911 153
67 3300048907 Ga0496104_1145732 Ga0496104_1145732_48_539 153
68 3300005436 Ga0070713_101225766 Ga0070713_1012257661 154
69 3300006163 Ga0070715_10000068 Ga0070715_100000686 154
70 3300009174 Ga0105241_10512710 Ga0105241_105127102 154
71 3300009176 Ga0105242_10001700 Ga0105242_100017003 154
72 3300009176 Ga0105242_10005282 Ga0105242_100052829 154
73 3300017792 Ga0163161_10215541 Ga0163161_102155412 154
74 3300025905 Ga0207685_10000059 Ga0207685_1000005920 154
75 3300025928 Ga0207700_10441137 Ga0207700_104411372 154
76 3300030760 Ga0265762_1035543 Ga0265762_10355431 154
77 3300005334 Ga0068869_100901227 Ga0068869_1009012271 155
78 3300049679 Ga0501249_009717 Ga0501249_009717_366_953 155
79 iso_pu_bacteria 2818991318 2819428860 155
80 3300001979 JGI24740J21852_10010677 JGI24740J21852_100106772 156
81 3300005564 Ga0070664_100684623 Ga0070664_1006846231 156
82 3300009147 Ga0114129_10210844 Ga0114129_102108441 156
83 3300009553 Ga0105249_10353338 Ga0105249_103533382 156
84 3300025900 Ga0207710_10116558 Ga0207710_101165582 156
85 3300025945 Ga0207679_10313722 Ga0207679_103137222 156
86 3300025981 Ga0207640_10375268 Ga0207640_103752682 156
87 3300035241 Ga0373961_0217662 Ga0373961_0217662_50_550 156
88 3300046538 Ga0495609_0022213 Ga0495609_0022213_1611_2120 156
89 3300050507 nmdc:mga05p37_1427824_c1 nmdc:mga05p37_1427824_c1_149_670 156
90 3300050511 nmdc:mga08y16_1687210_c1 nmdc:mga08y16_1687210_c1_72_566 156
91 3300050515 nmdc:mga0a205_635635_c1 nmdc:mga0a205_635635_c1_273_773 156
92 iso_pu_bacteria 3004334049 3004337009 156
93 3300009147 Ga0114129_10017606 Ga0114129_100176069 157
94 3300044765 Ga0466970_0077973 Ga0466970_0077973_139_675 157
95 3300050507 nmdc:mga05p37_1342_c1 nmdc:mga05p37_1342_c1_10024_10515 157
96 3300005340 Ga0070689_100023208 Ga0070689_1000232085 158
97 3300005353 Ga0070669_100362676 Ga0070669_1003626762 158
98 3300005355 Ga0070671_100166668 Ga0070671_1001666684 158
99 3300009553 Ga0105249_10282643 Ga0105249_102826432 158
100 3300025893 Ga0207682_10125532 Ga0207682_101255322 158
101 3300025926 Ga0207659_10096964 Ga0207659_100969642 158
102 3300025931 Ga0207644_10125202 Ga0207644_101252022 158
103 3300031824 Ga0307413_10001087 Ga0307413_100010873 158
104 3300050512 nmdc:mga0n895_579034_c1 nmdc:mga0n895_579034_c1_432_935 158
105 iso_pu_bacteria 2939622612 2939623077 158
106 3300005290 Ga0065712_10080023 Ga0065712_100800234 159
107 3300005339 Ga0070660_100011649 Ga0070660_1000116497 159
108 3300005345 Ga0070692_10018199 Ga0070692_100181993 159
109 3300005364 Ga0070673_100022523 Ga0070673_1000225236 159
110 3300005366 Ga0070659_100000437 Ga0070659_10000043722 159
111 3300005367 Ga0070667_100460872 Ga0070667_1004608722 159
112 3300005466 Ga0070685_10045374 Ga0070685_100453744 159
113 3300005547 Ga0070693_100008236 Ga0070693_1000082366 159
114 3300021384 Ga0213876_10000935 Ga0213876_1000093517 159
115 3300021388 Ga0213875_10227601 Ga0213875_102276012 159
116 3300025919 Ga0207657_10007640 Ga0207657_100076407 159
117 3300025928 Ga0207700_10229675 Ga0207700_102296751 159
118 3300025932 Ga0207690_10000535 Ga0207690_1000053516 159
119 3300037853 Ga0436364_1180439 Ga0436364_1180439_605_1114 159
120 3300039437 Ga0436365_1526301 Ga0436365_1526301_119647_120150 159
121 3300048917 Ga0496114_0072232 Ga0496114_0072232_1696_2208 159
122 3300053083 Ga0495655_0001346 Ga0495655_0001346_3211_3711 159
123 3300001904 JGI24736J21556_1021942 JGI24736J21556_10219422 160
124 3300001991 JGI24743J22301_10069433 JGI24743J22301_100694331 160
125 3300002705 JGI25156J39149_1008579 JGI25156J39149_10085793 160
126 3300002741 JGI25157J39369_1000700 JGI25157J39369_10007003 160
127 3300005331 Ga0070670_100004949 Ga0070670_1000049493 160
128 3300005334 Ga0068869_100001770 Ga0068869_1000017707 160
129 3300005338 Ga0068868_100000513 Ga0068868_10000051315 160
130 3300005345 Ga0070692_10011135 Ga0070692_100111353 160
131 3300005536 Ga0070697_100076984 Ga0070697_1000769841 160
132 3300005539 Ga0068853_100017586 Ga0068853_1000175862 160
133 3300005545 Ga0070695_100000714 Ga0070695_1000007149 160
134 3300005545 Ga0070695_100256098 Ga0070695_1002560983 160
135 3300005563 Ga0068855_100345358 Ga0068855_1003453582 160
136 3300005577 Ga0068857_100711342 Ga0068857_1007113422 160
137 3300005578 Ga0068854_100885214 Ga0068854_1008852141 160
138 3300005614 Ga0068856_100019362 Ga0068856_1000193623 160
139 3300005615 Ga0070702_100209994 Ga0070702_1002099941 160
140 3300005616 Ga0068852_100015113 Ga0068852_1000151133 160
141 3300005618 Ga0068864_100469478 Ga0068864_1004694782 160
142 3300006173 Ga0070716_100437164 Ga0070716_1004371642 160
143 3300006846 Ga0075430_100023918 Ga0075430_1000239183 160
144 3300006871 Ga0075434_100056963 Ga0075434_1000569633 160
145 3300009101 Ga0105247_11191589 Ga0105247_111915891 160
146 3300009147 Ga0114129_10846272 Ga0114129_108462721 160
147 3300009148 Ga0105243_11838428 Ga0105243_118384282 160
148 3300009545 Ga0105237_10316691 Ga0105237_103166912 160
149 3300013296 Ga0157374_10077447 Ga0157374_100774471 160
150 3300021361 Ga0213872_10045997 Ga0213872_100459973 160
151 3300025250 Ga0209026_1000050 Ga0209026_100005060 160
152 3300025256 Ga0209759_1000229 Ga0209759_100022947 160
153 3300025304 Ga0209257_1033040 Ga0209257_10330402 160
154 3300025906 Ga0207699_10667961 Ga0207699_106679611 160
155 3300025913 Ga0207695_11394358 Ga0207695_113943581 160
156 3300025914 Ga0207671_10169395 Ga0207671_101693952 160
157 3300025917 Ga0207660_10112525 Ga0207660_101125253 160
158 3300025925 Ga0207650_10036271 Ga0207650_100362713 160
159 3300025942 Ga0207689_10011112 Ga0207689_100111123 160
160 3300025945 Ga0207679_10554546 Ga0207679_105545461 160
161 3300025949 Ga0207667_10781721 Ga0207667_107817212 160
162 3300025981 Ga0207640_10201376 Ga0207640_102013763 160
163 3300026023 Ga0207677_10000065 Ga0207677_1000006526 160
164 3300026041 Ga0207639_10472393 Ga0207639_104723932 160
165 3300026078 Ga0207702_10030748 Ga0207702_100307484 160
166 3300026142 Ga0207698_10356573 Ga0207698_103565731 160
167 3300031548 Ga0307408_100154382 Ga0307408_1001543822 160
168 3300031730 Ga0307516_10031784 Ga0307516_100317843 160
169 3300031731 Ga0307405_10496620 Ga0307405_104966202 160
170 3300031824 Ga0307413_10003345 Ga0307413_100033453 160
171 3300031852 Ga0307410_10735499 Ga0307410_107354992 160
172 3300031911 Ga0307412_10105003 Ga0307412_101050032 160
173 3300031911 Ga0307412_10934668 Ga0307412_109346681 160
174 3300031995 Ga0307409_100059689 Ga0307409_1000596892 160
175 3300031995 Ga0307409_101039770 Ga0307409_1010397702 160
176 3300032002 Ga0307416_100045428 Ga0307416_1000454282 160
177 3300032126 Ga0307415_100016347 Ga0307415_1000163475 160
178 3300032126 Ga0307415_100213486 Ga0307415_1002134862 160
179 3300035695 Ga0373927_0144169 Ga0373927_0144169_235_738 160
180 3300037418 Ga0395900_1162217 Ga0395900_1162217_60_563 160
181 3300039447 Ga0436361_0400086 Ga0436361_0400086_676_1215 160
182 3300042005 Ga0439448_0022006 Ga0439448_0022006_98_601 160
183 3300042438 Ga0439459_0022508 Ga0439459_0022508_617_1120 160
184 3300042876 Ga0451577_0603856 Ga0451577_0603856_243_746 160
185 3300044706 Ga0466964_0646058 Ga0466964_0646058_49_555 160
186 3300044719 Ga0466971_0073418 Ga0466971_0073418_180_686 160
187 3300044842 Ga0466957_0073494 Ga0466957_0073494_870_1376 160
188 3300045976 Ga0466967_0157127 Ga0466967_0157127_81_584 160
189 3300046523 Ga0495644_0241212 Ga0495644_0241212_80_583 160
190 3300046558 Ga0495633_0112705 Ga0495633_0112705_534_1121 160
191 3300047320 Ga0495672_0083334 Ga0495672_0083334_634_1143 160
192 3300048906 Ga0496103_0405780 Ga0496103_0405780_299_802 160
193 3300048928 Ga0496125_0403429 Ga0496125_0403429_96_599 160
194 3300049569 Ga0501032_0073744 Ga0501032_0073744_1379_1882 160
195 3300049571 Ga0501034_0000462 Ga0501034_0000462_65946_66449 160
196 3300049581 Ga0501047_0038356 Ga0501047_0038356_3259_3762 160
197 3300049742 Ga0501080_0042679 Ga0501080_0042679_1486_1989 160
198 3300049823 Ga0501044_0344954 Ga0501044_0344954_855_1358 160
199 3300050507 nmdc:mga05p37_1091298_c1 nmdc:mga05p37_1091298_c1_289_795 160
200 3300053139 Ga0500568_0003948 Ga0500568_0003948_6220_6729 160
201 3300059624 Ga0587109_023302 Ga0587109_023302_546_1055 160
202 iso_pu_bacteria 2865002811 2865003017 160
203 3300007076 Ga0075435_100263784 Ga0075435_1002637842 161
204 3300014326 Ga0157380_10442146 Ga0157380_104421462 161
205 3300032004 Ga0307414_10009476 Ga0307414_100094764 161
206 3300050513 nmdc:mga0rr50_207993_c2 nmdc:mga0rr50_207993_c2_143_649 161
207 iso_pu_bacteria 2775506987 2776612199 161
208 3300005441 Ga0070700_100001026 Ga0070700_10000102610 162
209 3300006163 Ga0070715_10238856 Ga0070715_102388561 162
210 3300006173 Ga0070716_100368775 Ga0070716_1003687751 162
211 3300006175 Ga0070712_100596128 Ga0070712_1005961282 162
212 3300006847 Ga0075431_100089044 Ga0075431_1000890442 162
213 3300009147 Ga0114129_11651391 Ga0114129_116513912 162
214 3300014497 Ga0182008_10000032 Ga0182008_1000003231 162
215 3300014969 Ga0157376_11272498 Ga0157376_112724982 162
216 3300025915 Ga0207693_10075453 Ga0207693_100754532 162
217 3300025927 Ga0207687_11116222 Ga0207687_111162222 162
218 3300025939 Ga0207665_10426977 Ga0207665_104269771 162
219 3300026075 Ga0207708_10001475 Ga0207708_1000147512 162
220 3300030732 Ga0316176_1123934 Ga0316176_11239342 162
221 3300032002 Ga0307416_100104981 Ga0307416_1001049813 162
222 3300032004 Ga0307414_10599642 Ga0307414_105996421 162
223 3300032126 Ga0307415_100657238 Ga0307415_1006572382 162
224 3300041453 Ga0451797_1019589 Ga0451797_1019589_143_661 162
225 3300042876 Ga0451577_0173725 Ga0451577_0173725_1148_1648 162
226 3300048911 Ga0496108_1618907 Ga0496108_1618907_22_522 162
227 3300050508 nmdc:mga09592_143450_c1 nmdc:mga09592_143450_c1_516_1016 162
228 3300050510 nmdc:mga06r32_126897_c1 nmdc:mga06r32_126897_c1_1679_2179 162
229 3300003203 JGI25406J46586_10118235 JGI25406J46586_101182352 163
230 3300005289 Ga0065704_10142336 Ga0065704_101423363 163
231 3300005336 Ga0070680_100024813 Ga0070680_1000248133 163
232 3300005985 Ga0081539_10055841 Ga0081539_100558413 163
233 3300009176 Ga0105242_10227206 Ga0105242_102272062 163
234 3300013297 Ga0157378_10081313 Ga0157378_100813132 163
235 3300048915 Ga0496112_0196472 Ga0496112_0196472_634_1128 163
236 3300048916 Ga0496113_0028422 Ga0496113_0028422_3513_4007 163
237 3300049584 Ga0501068_0149200 Ga0501068_0149200_465_956 163
238 3300053088 Ga0500644_0291550 Ga0500644_0291550_18_536 163
239 iso_pu_bacteria 2643221611 2644072712 163
240 iso_pu_bacteria 2687453392 2688596215 163
241 iso_pu_bacteria 2856328259 2856329496 163
242 iso_pu_bacteria 2856334872 2856339825 163
243 iso_pu_bacteria 2857367948 2857369149 163
244 iso_pu_bacteria 2869271264 2869271903 163
245 iso_pu_bacteria 2874162495 2874168169 163
246 iso_pu_bacteria 2876399893 2876404587 163
247 iso_pu_bacteria 2876406927 2876410497 163
248 iso_pu_bacteria 2878774303 2878778349 163
249 iso_pu_bacteria 2878781027 2878781130 163
250 iso_pu_bacteria 2906386501 2906388115 163
251 iso_pu_bacteria 2906408224 2906408934 163
252 iso_pu_bacteria 2922151315 2922152413 163
253 iso_pu_bacteria 2922172374 2922173206 163
254 iso_pu_bacteria 2922178524 2922184776 163
255 iso_pu_bacteria 2924748358 2924754060 163
256 iso_pu_bacteria 2958122699 2958126814 163
257 iso_pu_bacteria 2958137437 2958140183 163
258 iso_pu_bacteria 2958158011 2958162500 163
259 iso_pu_bacteria 2961136820 2961140880 163
260 iso_pu_bacteria 2965025482 2965026750 163
261 iso_pu_bacteria 2965032056 2965038160 163
262 iso_pu_bacteria 2965047637 2965051005 163
263 iso_pu_bacteria 2965102966 2965107260 163
264 iso_pu_bacteria 2970547951 2970550845 163
265 iso_pu_bacteria 2977872689 2977875844 163
266 iso_pu_bacteria 2977935797 2977938013 163
267 iso_pu_bacteria 2977957713 2977964322 163
268 iso_pu_bacteria 2979793036 2979796832 163
269 iso_pu_bacteria 2987673487 2987673848 163
270 iso_pu_bacteria 649633066 649870773 163
271 iso_pu_bacteria 8004300914 8004306863 163
272 3300005331 Ga0070670_100381828 Ga0070670_1003818282 164
273 3300005343 Ga0070687_100739015 Ga0070687_1007390151 164
274 3300005434 Ga0070709_10075324 Ga0070709_100753243 164
275 3300005440 Ga0070705_100972921 Ga0070705_1009729211 164
276 3300005467 Ga0070706_100906577 Ga0070706_1009065772 164
277 3300005468 Ga0070707_100037936 Ga0070707_1000379366 164
278 3300005547 Ga0070693_100003595 Ga0070693_1000035955 164
279 3300005549 Ga0070704_100686014 Ga0070704_1006860141 164
280 3300005985 Ga0081539_10197210 Ga0081539_101972101 164
281 3300006051 Ga0075364_10054039 Ga0075364_100540393 164
282 3300006846 Ga0075430_100137547 Ga0075430_1001375472 164
283 3300006847 Ga0075431_100305824 Ga0075431_1003058243 164
284 3300025910 Ga0207684_11009377 Ga0207684_110093771 164
285 3300025934 Ga0207686_10001331 Ga0207686_100013313 164
286 3300025934 Ga0207686_10011983 Ga0207686_100119835 164
287 3300025938 Ga0207704_10499082 Ga0207704_104990822 164
288 3300028800 Ga0265338_10029923 Ga0265338_100299235 164
289 3300030836 Ga0265767_100429 Ga0265767_1004293 164
290 3300031241 Ga0265325_10040260 Ga0265325_100402604 164
291 3300031249 Ga0265339_10000205 Ga0265339_100002056 164
292 3300031595 Ga0265313_10000353 Ga0265313_100003536 164
293 3300031712 Ga0265342_10103102 Ga0265342_101031023 164
294 3300050490 nmdc:mga03n38_26765_c1 nmdc:mga03n38_26765_c1_1556_2074 164
295 3300050491 nmdc:mga00v17_44324_c1 nmdc:mga00v17_44324_c1_1856_2374 164
296 3300050510 nmdc:mga06r32_551835_c1 nmdc:mga06r32_551835_c1_54_572 164
297 3300053139 Ga0500568_0011991 Ga0500568_0011991_2820_3332 164
298 3300059507 Ga0587086_042205 Ga0587086_042205_23_541 164
299 3300060344 Ga0587071_063967 Ga0587071_063967_40_558 164
300 3300060346 Ga0587111_0028617 Ga0587111_0028617_183_701 164
301 iso_pu_bacteria 2643221611 2644072710 164
302 3300005288 Ga0065714_10146305 Ga0065714_101463051 165
303 3300005288 Ga0065714_10153743 Ga0065714_101537431 165
304 3300005341 Ga0070691_10528455 Ga0070691_105284551 165
305 3300005437 Ga0070710_10498593 Ga0070710_104985932 165
306 3300005439 Ga0070711_100018416 Ga0070711_1000184162 165
307 3300005546 Ga0070696_100100244 Ga0070696_1001002443 165
308 3300006175 Ga0070712_100088880 Ga0070712_1000888802 165
309 3300009553 Ga0105249_10714379 Ga0105249_107143791 165
310 3300010375 Ga0105239_10794674 Ga0105239_107946741 165
311 3300013306 Ga0163162_10111213 Ga0163162_101112131 165
312 3300017792 Ga0163161_10632850 Ga0163161_106328502 165
313 3300025906 Ga0207699_10588361 Ga0207699_105883612 165
314 3300025915 Ga0207693_10111695 Ga0207693_101116952 165
315 3300025934 Ga0207686_10296884 Ga0207686_102968842 165
316 3300025939 Ga0207665_10086921 Ga0207665_100869212 165
317 3300032004 Ga0307414_10009476 Ga0307414_100094762 165
318 3300032004 Ga0307414_10009476 Ga0307414_100094763 165
319 3300046525 Ga0495663_0046652 Ga0495663_0046652_41_589 165
320 3300046660 Ga0495625_0152292 Ga0495625_0152292_826_1374 165
321 3300048903 Ga0496100_0557143 Ga0496100_0557143_350_850 165
322 3300000549 LJQas_1010480 LJQas_10104801 166
323 3300003761 Ga0055535_1001614 Ga0055535_10016143 166
324 3300003762 Ga0055542_1013046 Ga0055542_10130462 166
325 3300035116 Ga0373945_0073210 Ga0373945_0073210_654_1154 166
326 3300042156 Ga0439446_0054471 Ga0439446_0054471_34_549 166
327 3300042876 Ga0451577_0566924 Ga0451577_0566924_507_1007 166
328 3300045051 Ga0451576_0876293 Ga0451576_0876293_163_678 166
329 3300045976 Ga0466967_0836030 Ga0466967_0836030_170_688 166
330 3300046516 Ga0495628_0601846 Ga0495628_0601846_241_753 166
331 3300046543 Ga0495645_0061373 Ga0495645_0061373_1580_2092 166
332 3300046559 Ga0495667_0230520 Ga0495667_0230520_167_679 166
333 3300046663 Ga0495635_0604462 Ga0495635_0604462_78_590 166
334 3300053088 Ga0500644_0000203 Ga0500644_0000203_12051_12569 166
335 iso_pu_bacteria 2513020052 2513235864 166
336 iso_pu_bacteria 2929921140 2929925730 166
337 iso_pu_bacteria 8003151029 8003153300 166
338 3300005343 Ga0070687_100137167 Ga0070687_1001371672 167
339 3300005353 Ga0070669_100069679 Ga0070669_1000696792 167
340 3300005617 Ga0068859_100099968 Ga0068859_1000999682 167
341 3300005719 Ga0068861_100027087 Ga0068861_1000270874 167
342 3300005844 Ga0068862_101022061 Ga0068862_1010220611 167
343 3300006931 Ga0097620_100099964 Ga0097620_1000999642 167
344 3300011119 Ga0105246_10351345 Ga0105246_103513452 167
345 3300014326 Ga0157380_10173413 Ga0157380_101734131 167
346 3300014745 Ga0157377_10093747 Ga0157377_100937471 167
347 3300025918 Ga0207662_10101789 Ga0207662_101017893 167
348 3300025923 Ga0207681_10100805 Ga0207681_101008052 167
349 3300025940 Ga0207691_10020607 Ga0207691_100206075 167
350 3300025942 Ga0207689_10237434 Ga0207689_102374341 167
351 3300026118 Ga0207675_100012195 Ga0207675_1000121952 167
352 3300028380 Ga0268265_11204697 Ga0268265_112046972 167
353 3300041413 Ga0439465_0036843 Ga0439465_0036843_21_539 167
354 3300041997 Ga0439431_0005150 Ga0439431_0005150_1825_2343 167
355 3300042007 Ga0439449_0144239 Ga0439449_0144239_99_617 167
356 3300042133 Ga0450896_005192 Ga0450896_005192_349_867 167
357 3300046529 Ga0495652_0362137 Ga0495652_0362137_17_520 167
358 3300049581 Ga0501047_0203853 Ga0501047_0203853_391_924 167
359 3300049584 Ga0501068_0120906 Ga0501068_0120906_71_577 167
360 3300049822 Ga0501035_1159949 Ga0501035_1159949_12_545 167
361 3300050511 nmdc:mga08y16_722286_c1 nmdc:mga08y16_722286_c1_278_796 167
362 iso_pu_bacteria 2987645492 2987651501 167
363 3300005288 Ga0065714_10037453 Ga0065714_100374531 168
364 3300005548 Ga0070665_100137064 Ga0070665_1001370642 168
365 3300009036 Ga0105244_10081516 Ga0105244_100815162 168
366 3300026121 Ga0207683_10379328 Ga0207683_103793282 168
367 3300047472 Ga0495686_0285464 Ga0495686_0285464_362_892 168
368 3300050492 nmdc:mga0yw44_29501_c1 nmdc:mga0yw44_29501_c1_1606_2136 168
369 3300053134 Ga0500658_0000003 Ga0500658_0000003_416502_417089 168
370 3300004799 Ga0058863_10026864 Ga0058863_100268642 169
371 3300013105 Ga0157369_10850923 Ga0157369_108509232 169
372 3300039450 Ga0436363_0118154 Ga0436363_0118154_162_695 169
373 3300044694 Ga0466963_0047368 Ga0466963_0047368_126_635 169
374 3300044719 Ga0466971_0147766 Ga0466971_0147766_154_663 169
375 3300044842 Ga0466957_0119400 Ga0466957_0119400_722_1231 169
376 3300045836 Ga0466958_0009055 Ga0466958_0009055_2012_2521 169
377 3300053096 Ga0500641_0000417 Ga0500641_0000417_3657_4214 169
378 3300053147 Ga0500589_078035 Ga0500589_078035_606_1163 169
379 3300053158 Ga0500627_0209109 Ga0500627_0209109_114_671 169
380 3300059505 Ga0587083_0063080 Ga0587083_0063080_25_534 169
381 3300059645 Ga0587076_020642 Ga0587076_020642_104_613 169
382 3300059652 Ga0587107_064510 Ga0587107_064510_18_527 169
383 3300003215 JGI25153J46596_10002276 JGI25153J46596_100022764 170
384 3300003323 rootH1_10041215 rootH1_100412153 170
385 3300003323 rootH1_10067345 rootH1_100673452 170
386 3300003354 JGI25160J50197_1006075 JGI25160J50197_10060752 170
387 3300005262 Ga0065165_1013992 Ga0065165_10139922 170
388 3300025242 Ga0209258_100252 Ga0209258_10025275 170
389 3300025254 Ga0209148_1000217 Ga0209148_100021775 170
390 3300025297 Ga0209758_1007454 Ga0209758_10074544 170
391 3300025302 Ga0207426_1000371 Ga0207426_10003715 170
392 3300048903 Ga0496100_0315525 Ga0496100_0315525_203_718 170
393 3300049823 Ga0501044_0636249 Ga0501044_0636249_349_939 170
394 iso_pu_bacteria 2857618242 2857618879 170
395 3300002738 JGI25154J39366_1000025 JGI25154J39366_100002511 171
396 3300002741 JGI25157J39369_1002640 JGI25157J39369_10026403 171
397 3300006852 Ga0075433_10203048 Ga0075433_102030483 171
398 3300025246 Ga0209646_1000037 Ga0209646_100003712 171
399 3300025250 Ga0209026_1000290 Ga0209026_100029034 171
400 3300032002 Ga0307416_102874930 Ga0307416_1028749301 171
401 3300032005 Ga0307411_10040107 Ga0307411_100401075 171
402 3300045051 Ga0451576_0853319 Ga0451576_0853319_301_861 171
403 3300050515 nmdc:mga0a205_243466_c1 nmdc:mga0a205_243466_c1_950_1471 171
404 3300053131 Ga0500652_005122 Ga0500652_005122_2752_3345 171
405 3300053139 Ga0500568_0032027 Ga0500568_0032027_509_1102 171
406 3300003323 rootH1_10303365 rootH1_103033652 172
407 3300005981 Ga0081538_10044625 Ga0081538_100446252 172
408 3300048918 Ga0496115_0247608 Ga0496115_0247608_181_774 172
409 3300048928 Ga0496125_0004515 Ga0496125_0004515_10018_10611 172
410 3300048929 Ga0496126_0031130 Ga0496126_0031130_2040_2633 172
411 3300005347 Ga0070668_100012747 Ga0070668_1000127476 173
412 3300005347 Ga0070668_100012747 Ga0070668_1000127477 173
413 3300009553 Ga0105249_10000092 Ga0105249_1000009259 173
414 3300013306 Ga0163162_10000002 Ga0163162_10000002429 173
415 3300014326 Ga0157380_10016696 Ga0157380_100166963 173
416 3300025961 Ga0207712_10000135 Ga0207712_1000013542 173
417 3300025972 Ga0207668_10003342 Ga0207668_1000334211 173
418 3300005328 Ga0070676_10243677 Ga0070676_102436772 174
419 3300046501 Ga0495607_0218435 Ga0495607_0218435_13_546 174
420 3300046506 Ga0495583_0013117 Ga0495583_0013117_843_1376 174
421 3300046518 Ga0495631_0006658 Ga0495631_0006658_1628_2161 174
422 3300046518 Ga0495631_0064602 Ga0495631_0064602_159_692 174
423 3300046558 Ga0495633_0000776 Ga0495633_0000776_6586_7119 174
424 3300046648 Ga0495611_0107523 Ga0495611_0107523_686_1219 174
425 3300046660 Ga0495625_0017249 Ga0495625_0017249_3072_3605 174
426 3300046684 Ga0495669_0000011 Ga0495669_0000011_55959_56492 174
427 3300047443 Ga0495687_000077 Ga0495687_000077_92498_93031 174
428 3300053079 Ga0500610_0000028 Ga0500610_0000028_697_1230 174
429 3300053730 Ga0500645_000001 Ga0500645_000001_166080_166613 174
430 2162886011 MRS1b_contig_3585791 MRS1b_0061.00001330 175
431 3300005290 Ga0065712_10149860 Ga0065712_101498602 175
432 3300005330 Ga0070690_100051113 Ga0070690_1000511132 175
433 3300005334 Ga0068869_100103319 Ga0068869_1001033192 175
434 3300005335 Ga0070666_10006804 Ga0070666_100068042 175
435 3300005338 Ga0068868_100099612 Ga0068868_1000996122 175
436 3300005340 Ga0070689_100061486 Ga0070689_1000614862 175
437 3300005344 Ga0070661_100081367 Ga0070661_1000813674 175
438 3300005355 Ga0070671_100095480 Ga0070671_1000954802 175
439 3300005356 Ga0070674_100618437 Ga0070674_1006184371 175
440 3300005364 Ga0070673_101198068 Ga0070673_1011980681 175
441 3300005367 Ga0070667_100075014 Ga0070667_1000750145 175
442 3300005440 Ga0070705_100595508 Ga0070705_1005955081 175
443 3300005455 Ga0070663_100767764 Ga0070663_1007677641 175
444 3300005457 Ga0070662_100095471 Ga0070662_1000954712 175
445 3300005466 Ga0070685_10456124 Ga0070685_104561242 175
446 3300005544 Ga0070686_100093282 Ga0070686_1000932824 175
447 3300005564 Ga0070664_100416443 Ga0070664_1004164432 175
448 3300005616 Ga0068852_100052227 Ga0068852_1000522272 175
449 3300005617 Ga0068859_100079652 Ga0068859_1000796522 175
450 3300005618 Ga0068864_100055319 Ga0068864_1000553194 175
451 3300005718 Ga0068866_10059105 Ga0068866_100591052 175
452 3300005841 Ga0068863_100095124 Ga0068863_1000951242 175
453 3300005842 Ga0068858_100091082 Ga0068858_1000910822 175
454 3300005843 Ga0068860_100078015 Ga0068860_1000780154 175
455 3300006051 Ga0075364_10025156 Ga0075364_100251564 175
456 3300006178 Ga0075367_10099756 Ga0075367_100997563 175
457 3300006237 Ga0097621_100010379 Ga0097621_1000103796 175
458 3300006881 Ga0068865_100050201 Ga0068865_1000502015 175
459 3300006931 Ga0097620_100079652 Ga0097620_1000796525 175
460 3300009011 Ga0105251_10043885 Ga0105251_100438853 175
461 3300009098 Ga0105245_10067605 Ga0105245_100676053 175
462 3300009101 Ga0105247_10065465 Ga0105247_100654652 175
463 3300009148 Ga0105243_10315082 Ga0105243_103150822 175
464 3300009148 Ga0105243_10828415 Ga0105243_108284151 175
465 3300009176 Ga0105242_10110519 Ga0105242_101105193 175
466 3300009177 Ga0105248_10247208 Ga0105248_102472082 175
467 3300009553 Ga0105249_10210249 Ga0105249_102102492 175
468 3300013102 Ga0157371_10341777 Ga0157371_103417771 175
469 3300013296 Ga0157374_10090146 Ga0157374_100901464 175
470 3300013297 Ga0157378_10050897 Ga0157378_100508972 175
471 3300013306 Ga0163162_10048688 Ga0163162_100486884 175
472 3300013307 Ga0157372_11513665 Ga0157372_115136651 175
473 3300013308 Ga0157375_10086695 Ga0157375_100866952 175
474 3300014325 Ga0163163_10099403 Ga0163163_100994034 175
475 3300014968 Ga0157379_10049298 Ga0157379_100492982 175
476 3300014969 Ga0157376_10133138 Ga0157376_101331382 175
477 3300017792 Ga0163161_10050447 Ga0163161_100504473 175
478 3300025735 Ga0207713_1113747 Ga0207713_11137471 175
479 3300025899 Ga0207642_10284038 Ga0207642_102840382 175
480 3300025900 Ga0207710_10016665 Ga0207710_100166652 175
481 3300025903 Ga0207680_10050854 Ga0207680_100508542 175
482 3300025920 Ga0207649_10098144 Ga0207649_100981442 175
483 3300025931 Ga0207644_10047647 Ga0207644_100476472 175
484 3300025933 Ga0207706_10127371 Ga0207706_101273713 175
485 3300025934 Ga0207686_10081792 Ga0207686_100817921 175
486 3300025936 Ga0207670_10024018 Ga0207670_100240183 175
487 3300025938 Ga0207704_10024455 Ga0207704_100244552 175
488 3300025941 Ga0207711_10041631 Ga0207711_100416314 175
489 3300025942 Ga0207689_10170532 Ga0207689_101705322 175
490 3300025945 Ga0207679_11136946 Ga0207679_111369461 175
491 3300025961 Ga0207712_11567390 Ga0207712_115673901 175
492 3300025986 Ga0207658_10039642 Ga0207658_100396422 175
493 3300026023 Ga0207677_10119925 Ga0207677_101199252 175
494 3300026035 Ga0207703_10043031 Ga0207703_100430312 175
495 3300026088 Ga0207641_10089104 Ga0207641_100891042 175
496 3300026095 Ga0207676_10073518 Ga0207676_100735183 175
497 3300026142 Ga0207698_10061202 Ga0207698_100612024 175
498 3300028381 Ga0268264_10080783 Ga0268264_100807832 175
499 3300044673 Ga0453683_0259218 Ga0453683_0259218_171_698 175
500 3300048907 Ga0496104_0205197 Ga0496104_0205197_769_1296 175
501 3300048908 Ga0496105_0177059 Ga0496105_0177059_1010_1537 175
502 3300048913 Ga0496110_0473479 Ga0496110_0473479_104_631 175
503 3300048917 Ga0496114_0054330 Ga0496114_0054330_1167_1694 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

7

63

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lye-assembly1.cif.gz_A-3 re-refined structure of the bacteriophage t4 short tail fibre pdb entry 1h6w containing 71 additionally identified residues 0.8566 6 59
2xgf-assembly1.cif.gz_C structure of the bacteriophage t4 long tail fibre needle-shaped receptor-binding tip 0.6806 4 106
5iv5-assembly1.cif.gz_O cryo-electron microscopy structure of the hexagonal pre-attachment t4 baseplate-tail tube complex 0.549 6 169
1ocy-assembly1.cif.gz_A structure of the receptor-binding domain of the bacteriophage t4 short tail fibre 0.5464 6 169
1pdi-assembly1.cif.gz_A fitting of the c-terminal part of the short tail fibers into the cryo-em reconstruction of t4 baseplate 0.5334 6 169
ID Description Score Start End Superfamily
1ocyA01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.8397 6 59 3.90.1340.10
2xgfC01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.8376 4 57 3.90.1340.10
1h6wA03 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.7872 12 58 3.90.1340.10
2xgfC01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.686 4 57 3.90.1340.10
1ocyA01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.6093 6 59 3.90.1340.10
ID Description Score Start End GO Terms
AF-A0A7Y2FQZ0-F1-model_v4 Phage tail protein 0.9375 2 175
AF-A4U469-F1-model_v4 Microcystin dependent protein 0.8746 1 175
AF-A0A1T5BT98-F1-model_v4 Phage Tail Collar Domain 0.8744 1 175
AF-A0A1M6CTK4-F1-model_v4 Phage Tail Collar Domain 0.8718 1 175
AF-A0A1T5BT98-F1-model_v4 Phage Tail Collar Domain 0.8661 1 175

Feature Viewer

pLDDT pTM Quality
76.01 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map