F455913

General Info

Members Datasets Scaffolds Average Seq Length
502 310 1004 254

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0001502|Ga0496104_0001502_11689_12672
Length 306
Sequence MRRTILKARNCRNSPPQISPAVLRYPHELLQKCIEWCQHEPRRRLLCATLATTGTTGQAKSLEARKLPADGGNMGLFDLKGRVAVVTGGNGRNVAKSEEAAAALAKLGVKTAVLEVDVIDEAACHKMVADTVKQLGRLDILVNNAGINIRKPAHEMSLAEWRQVIDVNLTSTFVCSQAAYPVMRDAGGGKIINIGSMLSIFGAAFAPAYGASKGGVVQLTKSLATAWAKDNIQVNAVLPGWIDTELTQKARVEVSGLNSLVLMRTPAKRWGVPDDMSGVAVFLAAPASDFVTGTAIPVDGGYSVQV

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
149 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
175 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
176 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
177 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
178 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
179 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
226 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
267 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
283 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
284 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
285 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
286 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
287 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
288 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
289 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
290 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
291 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
292 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
293 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
294 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
295 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
296 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
297 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
300 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
301 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
302 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
303 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
304 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
305 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
306 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
307 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
308 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
309 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
310 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.01
Metatranscriptomes 0
Isolates 1.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.57
Nodule 0.8
Rhizoplane 5.78
Rhizosphere 81.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0001502 3300048907 Bacteria 20115
2 JGI25159J45721_1024855 3300002987 Bacteria 1058
3 JGI25406J46586_10002697 3300003203 Bacteria 8367
4 rootH1_10040939 3300003323 Bacteria 3085
5 JGI25160J50197_1045677 3300003354 Bacteria 967
6 JGI25404J52841_10004082 3300003659 Bacteria 2935
7 JGI25404J52841_10036379 3300003659 Bacteria 1048
8 Ga0055526_1022357 3300003771 Bacteria 2154
9 Ga0070658_10027215 3300005327 Bacteria 4591
10 Ga0070683_100007568 3300005329 Bacteria 9183
11 Ga0070683_100085127 3300005329 Bacteria 2963
12 Ga0070683_100119486 3300005329 Bacteria 2489
13 Ga0070677_10111046 3300005333 Bacteria 1224
14 Ga0068869_100004615 3300005334 Bacteria 8590
15 Ga0070680_100011569 3300005336 Bacteria 6832
16 Ga0070680_100091270 3300005336 Bacteria 2522
17 Ga0070680_100168703 3300005336 Bacteria 1841
18 Ga0070680_100232395 3300005336 Bacteria 1558
19 Ga0068868_100000830 3300005338 Bacteria 20935
20 Ga0070660_100053771 3300005339 Bacteria 3106
21 Ga0070691_10015442 3300005341 Bacteria 3510
22 Ga0070691_10049957 3300005341 Bacteria 1994
23 Ga0070661_100003044 3300005344 Bacteria 11533
24 Ga0070661_100028358 3300005344 Bacteria 4038
25 Ga0070661_100208239 3300005344 Bacteria 1496
26 Ga0070668_100118147 3300005347 Bacteria 2116
27 Ga0070675_100006987 3300005354 Bacteria 8673
28 Ga0070659_100001896 3300005366 Bacteria 14963
29 Ga0070659_100050312 3300005366 Bacteria 3276
30 Ga0070709_10033976 3300005434 Bacteria 3089
31 Ga0070714_100016634 3300005435 Bacteria 5946
32 Ga0070713_100031903 3300005436 Bacteria 4202
33 Ga0070694_100004608 3300005444 Bacteria 8294
34 Ga0070694_100004922 3300005444 Bacteria 8051
35 Ga0070708_100571732 3300005445 Bacteria 1066
36 Ga0070663_100003089 3300005455 Bacteria 9521
37 Ga0070663_100003622 3300005455 Bacteria 8931
38 Ga0070662_100020382 3300005457 Bacteria 4514
39 Ga0070681_10017210 3300005458 Bacteria 7227
40 Ga0070681_10059639 3300005458 Bacteria 3796
41 Ga0070681_10082962 3300005458 Bacteria 3159
42 Ga0070681_10095293 3300005458 Bacteria 2925
43 Ga0070681_10105860 3300005458 Bacteria 2755
44 Ga0070681_10198700 3300005458 Bacteria 1923
45 Ga0070706_100065749 3300005467 Bacteria 3354
46 Ga0070707_100064003 3300005468 Bacteria 3530
47 Ga0070698_100006031 3300005471 Bacteria 13201
48 Ga0070698_100158420 3300005471 Bacteria 2209
49 Ga0070699_100103897 3300005518 Bacteria 2492
50 Ga0070699_100267837 3300005518 Bacteria 1528
51 Ga0070679_100036342 3300005530 Bacteria 4887
52 Ga0070684_100007914 3300005535 Bacteria 8294
53 Ga0070684_100008101 3300005535 Bacteria 8203
54 Ga0070684_100233529 3300005535 Bacteria 1679
55 Ga0068853_100031139 3300005539 Bacteria 4511
56 Ga0068853_100181523 3300005539 Bacteria 1909
57 Ga0068853_100334947 3300005539 Bacteria 1405
58 Ga0070695_100002953 3300005545 Bacteria 9911
59 Ga0070695_100004398 3300005545 Bacteria 8271
60 Ga0070695_100029076 3300005545 Bacteria 3432
61 Ga0070695_100112080 3300005545 Bacteria 1853
62 Ga0070696_100044089 3300005546 Bacteria 3088
63 Ga0070693_100008092 3300005547 Bacteria 5163
64 Ga0070704_100029782 3300005549 Bacteria 3650
65 Ga0070704_100051937 3300005549 Bacteria 2889
66 Ga0070704_100244931 3300005549 Bacteria 1469
67 Ga0070704_100286303 3300005549 Bacteria 1367
68 Ga0068855_100015190 3300005563 Bacteria 9273
69 Ga0070664_100063050 3300005564 Bacteria 3160
70 Ga0070664_100284950 3300005564 Bacteria 1490
71 Ga0068857_100006858 3300005577 Bacteria 9800
72 Ga0068857_100445688 3300005577 Bacteria 1210
73 Ga0068854_100031623 3300005578 Bacteria 3679
74 Ga0068856_100013142 3300005614 Bacteria 8021
75 Ga0068856_100039695 3300005614 Bacteria 4622
76 Ga0068852_100002689 3300005616 Bacteria 12283
77 Ga0068852_100149331 3300005616 Bacteria 2172
78 Ga0068859_100130723 3300005617 Bacteria 2582
79 Ga0068859_100215001 3300005617 Bacteria 2010
80 Ga0068864_100009752 3300005618 Bacteria 7921
81 Ga0068861_100003462 3300005719 Bacteria 10476
82 Ga0068851_10007268 3300005834 Bacteria 5078
83 Ga0068851_10084909 3300005834 Bacteria 1659
84 Ga0068863_100073076 3300005841 Bacteria 3244
85 Ga0068858_100069808 3300005842 Bacteria 3257
86 Ga0068860_100102926 3300005843 Bacteria 2725
87 Ga0068860_100112627 3300005843 Bacteria 2601
88 Ga0068862_100017687 3300005844 Bacteria 5934
89 Ga0068862_100166453 3300005844 Bacteria 1971
90 Ga0081455_10041041 3300005937 Bacteria 4075
91 Ga0081455_10107219 3300005937 Bacteria 2227
92 Ga0081538_10016357 3300005981 Bacteria 5692
93 Ga0081540_1000081 3300005983 Bacteria 102423
94 Ga0081540_1009295 3300005983 Bacteria 6782
95 Ga0081540_1020146 3300005983 Bacteria 4023
96 Ga0081539_10000498 3300005985 Bacteria 82216
97 Ga0075365_10118454 3300006038 Bacteria 1825
98 Ga0075365_10410442 3300006038 Bacteria 956
99 Ga0075363_100046645 3300006048 Bacteria 2299
100 Ga0075362_10045376 3300006177 Bacteria 1952
101 Ga0075367_10213167 3300006178 Bacteria 1208
102 Ga0097621_100001142 3300006237 Bacteria 18431
103 Ga0097621_100088414 3300006237 Bacteria 2589
104 Ga0075370_10166109 3300006353 Bacteria 1296
105 Ga0068871_100054498 3300006358 Bacteria 3244
106 Ga0068871_100088709 3300006358 Bacteria 2574
107 Ga0068871_100483835 3300006358 Bacteria 1114
108 Ga0075430_100000135 3300006846 Bacteria 47186
109 Ga0075430_100014118 3300006846 Bacteria 6811
110 Ga0075431_100000762 3300006847 Bacteria 27869
111 Ga0075431_100001986 3300006847 Bacteria 19518
112 Ga0075431_100011006 3300006847 Bacteria 9107
113 Ga0075431_100029251 3300006847 Bacteria 5669
114 Ga0075431_100163816 3300006847 Bacteria 2286
115 Ga0075433_10020512 3300006852 Bacteria 5529
116 Ga0075434_100013662 3300006871 Bacteria 7740
117 Ga0075434_100044368 3300006871 Bacteria 4411
118 Ga0075429_100000813 3300006880 Bacteria 24499
119 Ga0075429_100032593 3300006880 Bacteria 4529
120 Ga0075429_100229767 3300006880 Bacteria 1625
121 Ga0097620_100130722 3300006931 Bacteria 2582
122 Ga0097620_100214976 3300006931 Bacteria 2010
123 Ga0075435_100507219 3300007076 Bacteria 1043
124 Ga0111539_10001385 3300009094 Bacteria 32227
125 Ga0111539_10388600 3300009094 Bacteria 1625
126 Ga0111539_10468842 3300009094 Bacteria 1466
127 Ga0105245_10007828 3300009098 Bacteria 9361
128 Ga0105247_10065926 3300009101 Bacteria 2253
129 Ga0105247_10183531 3300009101 Bacteria 1397
130 Ga0114129_10024506 3300009147 Bacteria 8549
131 Ga0114129_10082811 3300009147 Bacteria 4458
132 Ga0114129_10786081 3300009147 Bacteria 1215
133 Ga0114129_10870668 3300009147 Bacteria 1144
134 Ga0114129_10943440 3300009147 Bacteria 1090
135 Ga0105243_10012001 3300009148 Bacteria 6549
136 Ga0105243_10041508 3300009148 Bacteria 3598
137 Ga0105243_10055814 3300009148 Bacteria 3139
138 Ga0105242_10075217 3300009176 Bacteria 2811
139 Ga0105248_10016613 3300009177 Bacteria 8104
140 Ga0105237_10053878 3300009545 Bacteria 4033
141 Ga0105237_10067702 3300009545 Bacteria 3565
142 Ga0105237_10102220 3300009545 Bacteria 2858
143 Ga0105238_10002915 3300009551 Bacteria 17083
144 Ga0105238_10015123 3300009551 Bacteria 7816
145 Ga0105249_10088492 3300009553 Bacteria 2892
146 Ga0105249_10105115 3300009553 Bacteria 2661
147 Ga0105249_10129929 3300009553 Bacteria 2403
148 Ga0105239_10036438 3300010375 Bacteria 5401
149 Ga0105239_10147238 3300010375 Bacteria 2627
150 Ga0105239_10536364 3300010375 Bacteria 1332
151 Ga0105246_10024806 3300011119 Bacteria 3902
152 Ga0105246_10230443 3300011119 Bacteria 1458
153 Ga0157373_10004318 3300013100 Bacteria 10700
154 Ga0157373_10435208 3300013100 Bacteria 942
155 Ga0157371_10045254 3300013102 Bacteria 3132
156 Ga0157369_10003699 3300013105 Bacteria 18177
157 Ga0157369_10020490 3300013105 Bacteria 7392
158 Ga0157369_10034106 3300013105 Bacteria 5588
159 Ga0157374_10150754 3300013296 Bacteria 2261
160 Ga0157374_10377225 3300013296 Bacteria 1412
161 Ga0163162_10068612 3300013306 Bacteria 3597
162 Ga0157372_10004355 3300013307 Bacteria 15120
163 Ga0157372_10005529 3300013307 Bacteria 13435
164 Ga0157372_10274872 3300013307 Bacteria 1958
165 Ga0157375_10047306 3300013308 Bacteria 4200
166 Ga0157375_10066688 3300013308 Bacteria 3594
167 Ga0157375_10082047 3300013308 Bacteria 3265
168 Ga0157377_10024076 3300014745 Bacteria 3233
169 Ga0157379_10008581 3300014968 Bacteria 8891
170 Ga0157376_10002173 3300014969 Bacteria 13212
171 Ga0163161_10002433 3300017792 Bacteria 13306
172 Ga0213876_10002842 3300021384 Bacteria 10070
173 Ga0209564_1000974 3300025295 Bacteria 36203
174 Ga0207656_10008670 3300025321 Bacteria 3751
175 Ga0207688_10042447 3300025901 Bacteria 2532
176 Ga0207647_10021284 3300025904 Bacteria 4332
177 Ga0207699_10163713 3300025906 Bacteria 1483
178 Ga0207645_10009139 3300025907 Bacteria 6873
179 Ga0207645_10201266 3300025907 Bacteria 1310
180 Ga0207643_10017267 3300025908 Bacteria 3944
181 Ga0207705_10072647 3300025909 Bacteria 2496
182 Ga0207684_10001609 3300025910 Bacteria 23989
183 Ga0207707_10009718 3300025912 Bacteria 8343
184 Ga0207707_10040316 3300025912 Bacteria 4078
185 Ga0207707_10067899 3300025912 Bacteria 3106
186 Ga0207707_10561820 3300025912 Bacteria 969
187 Ga0207695_10493411 3300025913 Bacteria 1107
188 Ga0207671_10053485 3300025914 Bacteria 2992
189 Ga0207671_10482652 3300025914 Bacteria 988
190 Ga0207660_10046240 3300025917 Bacteria 3070
191 Ga0207660_10053492 3300025917 Bacteria 2878
192 Ga0207660_10087888 3300025917 Bacteria 2297
193 Ga0207660_10095683 3300025917 Bacteria 2210
194 Ga0207660_10186748 3300025917 Bacteria 1612
195 Ga0207657_10028478 3300025919 Bacteria 5096
196 Ga0207649_10009678 3300025920 Bacteria 5278
197 Ga0207649_10036906 3300025920 Bacteria 2947
198 Ga0207649_10239564 3300025920 Bacteria 1301
199 Ga0207652_10506014 3300025921 Bacteria 1087
200 Ga0207646_10001224 3300025922 Bacteria 32267
201 Ga0207646_10014851 3300025922 Bacteria 7377
202 Ga0207646_10309441 3300025922 Bacteria 1427
203 Ga0207694_10021091 3300025924 Bacteria 4934
204 Ga0207694_10047604 3300025924 Bacteria 3316
205 Ga0207694_10525226 3300025924 Bacteria 992
206 Ga0207659_10378425 3300025926 Bacteria 1180
207 Ga0207687_10013561 3300025927 Bacteria 5320
208 Ga0207700_10006997 3300025928 Bacteria 6861
209 Ga0207700_10010081 3300025928 Bacteria 5940
210 Ga0207644_10016543 3300025931 Bacteria 4962
211 Ga0207690_10012384 3300025932 Bacteria 5101
212 Ga0207690_10060299 3300025932 Bacteria 2574
213 Ga0207706_10004863 3300025933 Bacteria 12579
214 Ga0207706_10070260 3300025933 Bacteria 3080
215 Ga0207686_10125013 3300025934 Bacteria 1756
216 Ga0207709_10015721 3300025935 Bacteria 4200
217 Ga0207665_10279279 3300025939 Bacteria 1242
218 Ga0207691_10186006 3300025940 Bacteria 1813
219 Ga0207711_10020302 3300025941 Bacteria 5537
220 Ga0207689_10002334 3300025942 Bacteria 17766
221 Ga0207689_10019083 3300025942 Bacteria 5782
222 Ga0207661_10008130 3300025944 Bacteria 7485
223 Ga0207661_10083570 3300025944 Bacteria 2642
224 Ga0207661_10087200 3300025944 Bacteria 2591
225 Ga0207661_10208535 3300025944 Bacteria 1721
226 Ga0207679_10019180 3300025945 Bacteria 4592
227 Ga0207679_10150664 3300025945 Bacteria 1892
228 Ga0207679_10718020 3300025945 Bacteria 908
229 Ga0207667_10025812 3300025949 Bacteria 6427
230 Ga0207667_10144896 3300025949 Bacteria 2445
231 Ga0207712_10048322 3300025961 Bacteria 2959
232 Ga0207640_10046280 3300025981 Bacteria 2798
233 Ga0207677_10032253 3300026023 Bacteria 3365
234 Ga0207703_10088258 3300026035 Bacteria 2602
235 Ga0207703_10093492 3300026035 Bacteria 2533
236 Ga0207703_10103657 3300026035 Bacteria 2415
237 Ga0207703_10169680 3300026035 Bacteria 1918
238 Ga0207639_10056335 3300026041 Bacteria 3013
239 Ga0207639_10282772 3300026041 Bacteria 1460
240 Ga0207639_10289252 3300026041 Bacteria 1444
241 Ga0207678_10001027 3300026067 Bacteria 25460
242 Ga0207708_10053245 3300026075 Bacteria 3083
243 Ga0207708_10064904 3300026075 Bacteria 2790
244 Ga0207702_10047399 3300026078 Bacteria 3621
245 Ga0207702_10200976 3300026078 Bacteria 1847
246 Ga0207702_10267887 3300026078 Bacteria 1610
247 Ga0207641_10018311 3300026088 Bacteria 5741
248 Ga0207676_10103450 3300026095 Bacteria 2366
249 Ga0207674_10024593 3300026116 Bacteria 6432
250 Ga0207674_10295803 3300026116 Bacteria 1568
251 Ga0207675_100000267 3300026118 Bacteria 49570
252 Ga0207675_100357740 3300026118 Bacteria 1432
253 Ga0207698_10028141 3300026142 Bacteria 4003
254 Ga0207698_10232935 3300026142 Bacteria 1673
255 Ga0209970_1002724 3300027614 Bacteria 2984
256 Ga0209983_1000789 3300027665 Bacteria 6881
257 Ga0209966_1000072 3300027695 Bacteria 44895
258 Ga0209998_10000001 3300027717 Bacteria 203589
259 Ga0207428_10000199 3300027907 Bacteria 83918
260 Ga0207428_10089384 3300027907 Bacteria 2394
261 Ga0268265_10030618 3300028380 Bacteria 3878
262 Ga0268265_10134331 3300028380 Bacteria 2061
263 Ga0268264_10072683 3300028381 Bacteria 2917
264 Ga0307517_10000042 3300028786 Bacteria 166943
265 Ga0307517_10065362 3300028786 Bacteria 3366
266 Ga0316575_10004370 3300031665 Bacteria 4972
267 Ga0307411_10573232 3300032005 Bacteria 966
268 Ga0373930_0006428 3300034816 Bacteria 1987
269 Ga0373923_0003635 3300035111 Bacteria 4981
270 Ga0373932_0044757 3300035112 Bacteria 1292
271 Ga0373936_0020848 3300035113 Bacteria 2548
272 Ga0373939_0033781 3300035114 Bacteria 1497
273 Ga0373945_0030119 3300035116 Bacteria 1911
274 Ga0373954_0000006 3300035118 Bacteria 98573
275 Ga0373954_0094098 3300035118 Bacteria 1441
276 Ga0373943_0020249 3300035170 Bacteria 3065
277 Ga0373943_0125922 3300035170 Bacteria 1366
278 Ga0373946_0013452 3300035171 Bacteria 3078
279 Ga0316574_0104858 3300035398 Bacteria 1810
280 Ga0373924_0023365 3300035410 Bacteria 2424
281 Ga0373931_0014334 3300035691 Bacteria 3872
282 Ga0373935_0035420 3300035692 Bacteria 3115
283 Ga0373927_0008437 3300035695 Bacteria 6928
284 Ga0373927_0053768 3300035695 Bacteria 2605
285 Ga0373933_0023362 3300035724 Bacteria 3531
286 Ga0373933_0050965 3300035724 Bacteria 2472
287 Ga0373933_0305056 3300035724 Bacteria 1031
288 Ga0373947_0006351 3300035725 Bacteria 6869
289 Ga0373937_0000595 3300036401 Bacteria 32029
290 Ga0373937_0711166 3300036401 Bacteria 951
291 Ga0373925_0012978 3300037068 Bacteria 6032
292 Ga0395899_0072685 3300037312 Bacteria 2516
293 Ga0436364_0522811 3300037853 Bacteria 1275
294 Ga0395901_0168884 3300038443 Bacteria 2295
295 Ga0436365_0989805 3300039437 Bacteria 23698
296 Ga0436365_1647459 3300039437 Bacteria 3988
297 Ga0436363_0747842 3300039450 Bacteria 5119
298 Ga0439465_0036099 3300041413 Bacteria 1587
299 Ga0439448_0007341 3300042005 Bacteria 3191
300 Ga0439450_011773 3300042008 Bacteria 1721
301 Ga0439455_0017902 3300042012 Bacteria 1656
302 Ga0439463_027361 3300042016 Bacteria 1435
303 Ga0439460_0006824 3300042461 Bacteria 2842
304 Ga0451577_0001636 3300042876 Bacteria 29026
305 Ga0451577_0042793 3300042876 Bacteria 4059
306 Ga0453683_0022595 3300044673 Bacteria 4012
307 Ga0453683_0035288 3300044673 Bacteria 3151
308 Ga0453683_0165394 3300044673 Bacteria 1400
309 Ga0466961_0050437 3300044693 Bacteria 2658
310 Ga0453684_0012249 3300044712 Bacteria 14202
311 Ga0453684_0345012 3300044712 Bacteria 1680
312 Ga0466971_0041620 3300044719 Bacteria 2064
313 Ga0466968_0069216 3300044735 Bacteria 1534
314 Ga0451576_0015918 3300045051 Bacteria 8314
315 Ga0451576_0102344 3300045051 Bacteria 2979
316 Ga0451576_0249105 3300045051 Bacteria 1856
317 Ga0451576_0532416 3300045051 Bacteria 1234
318 Ga0495592_0040014 3300046454 Bacteria 3519
319 Ga0495603_0038121 3300046455 Bacteria 2883
320 Ga0495629_0229344 3300046459 Bacteria 1280
321 Ga0495638_0019678 3300046460 Bacteria 4464
322 Ga0495653_0211477 3300046463 Bacteria 1310
323 Ga0495580_0051863 3300046472 Bacteria 2899
324 Ga0495582_0002244 3300046473 Bacteria 10828
325 Ga0495605_0137235 3300046474 Bacteria 1099
326 Ga0495662_0021223 3300046476 Bacteria 3140
327 Ga0495664_0019087 3300046477 Bacteria 3937
328 Ga0495585_0171392 3300046492 Bacteria 1121
329 Ga0495606_0083481 3300046507 Bacteria 1981
330 Ga0495608_0012109 3300046511 Bacteria 5995
331 Ga0495618_0115723 3300046514 Bacteria 1717
332 Ga0495630_0073581 3300046517 Bacteria 2573
333 Ga0495665_0035356 3300046531 Bacteria 2669
334 Ga0495640_0204158 3300046533 Bacteria 1251
335 Ga0495586_0197977 3300046535 Bacteria 1138
336 Ga0495645_0036855 3300046543 Bacteria 3565
337 Ga0495622_0045336 3300046557 Bacteria 2043
338 Ga0495622_0060802 3300046557 Bacteria 1750
339 Ga0495656_0001687 3300046615 Bacteria 7225
340 Ga0495634_0059988 3300046642 Bacteria 2532
341 Ga0495625_0233115 3300046660 Bacteria 1201
342 Ga0495635_0029499 3300046663 Bacteria 3815
343 Ga0495599_0118727 3300046678 Bacteria 1644
344 Ga0495623_0052279 3300046679 Bacteria 2582
345 Ga0495647_0016970 3300046681 Bacteria 2571
346 Ga0495658_0002672 3300046683 Bacteria 8973
347 Ga0495658_0003482 3300046683 Bacteria 7787
348 Ga0495669_0006361 3300046684 Bacteria 4934
349 Ga0495670_0143117 3300046691 Bacteria 1251
350 Ga0495600_0008569 3300046809 Bacteria 6288
351 Ga0495600_0266567 3300046809 Bacteria 1087
352 Ga0495581_0070396 3300047315 Bacteria 2023
353 Ga0495636_0037114 3300047318 Bacteria 2012
354 Ga0495674_0017285 3300047319 Bacteria 6710
355 Ga0495672_0090995 3300047320 Bacteria 1675
356 Ga0495676_0091488 3300047321 Bacteria 2274
357 Ga0495684_0005645 3300047471 Bacteria 9747
358 Ga0495593_0020721 3300047673 Bacteria 3677
359 Ga0495593_0162342 3300047673 Bacteria 1128
360 Ga0495614_0132425 3300048089 Bacteria 1104
361 Ga0495626_0038897 3300048091 Bacteria 2253
362 Ga0496100_0099683 3300048903 Bacteria 1999
363 Ga0496101_0027462 3300048904 Bacteria 3966
364 Ga0496101_0099916 3300048904 Bacteria 2170
365 Ga0496101_0148807 3300048904 Bacteria 1790
366 Ga0496102_0330271 3300048905 Bacteria 1436
367 Ga0496104_0036519 3300048907 Bacteria 4594
368 Ga0496104_0085675 3300048907 Bacteria 3007
369 Ga0496106_0077843 3300048909 Bacteria 2543
370 Ga0496106_0091124 3300048909 Bacteria 2353
371 Ga0496106_0141368 3300048909 Bacteria 1893
372 Ga0496106_0274833 3300048909 Bacteria 1349
373 Ga0496107_0061053 3300048910 Bacteria 2729
374 Ga0496108_0006468 3300048911 Bacteria 9501
375 Ga0496108_0017210 3300048911 Bacteria 5914
376 Ga0496108_0131308 3300048911 Bacteria 2153
377 Ga0496108_0320428 3300048911 Bacteria 1352
378 Ga0496109_0011313 3300048912 Bacteria 7665
379 Ga0496109_0027605 3300048912 Bacteria 5070
380 Ga0496109_0104485 3300048912 Bacteria 2630
381 Ga0496110_0118688 3300048913 Bacteria 2382
382 Ga0496111_0020678 3300048914 Bacteria 4586
383 Ga0496111_0286258 3300048914 Bacteria 1222
384 Ga0496112_0005981 3300048915 Bacteria 10616
385 Ga0496112_0072181 3300048915 Bacteria 3412
386 Ga0496114_0272279 3300048917 Bacteria 1492
387 Ga0496115_0057856 3300048918 Bacteria 3119
388 Ga0496115_0086340 3300048918 Bacteria 2560
389 Ga0496117_0096531 3300048920 Bacteria 1885
390 Ga0496118_0068318 3300048921 Bacteria 2582
391 Ga0496118_0099840 3300048921 Bacteria 1965
392 Ga0496121_0018591 3300048924 Bacteria 6998
393 Ga0496121_0026517 3300048924 Bacteria 5458
394 Ga0496121_0095488 3300048924 Bacteria 2310
395 Ga0496122_0044915 3300048925 Bacteria 3441
396 Ga0496122_0147009 3300048925 Bacteria 1462
397 Ga0496123_0047171 3300048926 Bacteria 2914
398 Ga0496123_0148232 3300048926 Bacteria 1270
399 Ga0496125_0000090 3300048928 Bacteria 214433
400 Ga0496125_0006156 3300048928 Bacteria 13080
401 Ga0496125_0025676 3300048928 Bacteria 5388
402 Ga0496126_0012807 3300048929 Bacteria 8572
403 Ga0496126_0065531 3300048929 Bacteria 3250
404 Ga0496126_0274674 3300048929 Bacteria 1397
405 Ga0501033_0114917 3300049570 Bacteria 1956
406 Ga0501033_0189733 3300049570 Bacteria 1471
407 Ga0501034_0291739 3300049571 Bacteria 1569
408 Ga0501036_0072794 3300049572 Bacteria 2905
409 Ga0501037_0148872 3300049573 Bacteria 1674
410 Ga0501038_0026974 3300049574 Bacteria 5113
411 Ga0501039_0034694 3300049575 Bacteria 3892
412 Ga0501039_0375641 3300049575 Bacteria 1117
413 Ga0501041_0006109 3300049577 Bacteria 7040
414 Ga0501042_0000949 3300049578 Bacteria 16341
415 Ga0501047_0129571 3300049581 Bacteria 2403
416 Ga0501048_0034501 3300049582 Bacteria 3649
417 Ga0501048_0412465 3300049582 Bacteria 966
418 Ga0501068_0057014 3300049584 Bacteria 2368
419 Ga0501070_0160223 3300049586 Bacteria 1855
420 Ga0501071_0184148 3300049587 Bacteria 1565
421 Ga0501072_0012506 3300049588 Bacteria 6489
422 Ga0501072_0584799 3300049588 Bacteria 881
423 Ga0501075_0013676 3300049591 Bacteria 5797
424 Ga0501076_0022715 3300049592 Bacteria 4823
425 Ga0501079_0005656 3300049741 Bacteria 9329
426 Ga0501079_0103254 3300049741 Bacteria 2211
427 Ga0501080_0013960 3300049742 Bacteria 7393
428 Ga0501080_0123198 3300049742 Bacteria 2402
429 Ga0501080_0343593 3300049742 Bacteria 1348
430 Ga0501081_0028529 3300049743 Bacteria 3767
431 Ga0501044_0065195 3300049823 Bacteria 3715
432 Ga0501044_0141000 3300049823 Bacteria 2399
433 Ga0501044_0393947 3300049823 Bacteria 1298
434 Ga0501045_0014321 3300049824 Bacteria 5619
435 Ga0501045_0631252 3300049824 Bacteria 792
436 nmdc:mga03683_52122_c1 3300050489 Bacteria 1710
437 nmdc:mga0k408_9779_c1 3300050493 Bacteria 5177
438 nmdc:mga06z11_313811_c1 3300050494 Bacteria 934
439 nmdc:mga07m45_263441_c1 3300050496 Bacteria 1003
440 nmdc:mga05p37_11038_c1 3300050507 Bacteria 10732
441 nmdc:mga05p37_622761_c1 3300050507 Bacteria 1214
442 nmdc:mga05p37_640102_c1 3300050507 Bacteria 1193
443 nmdc:mga05p37_69613_c2 3300050507 Bacteria 3252
444 nmdc:mga09592_292_c1 3300050508 Bacteria 36361
445 nmdc:mga09592_6484_c1 3300050508 Bacteria 9532
446 nmdc:mga0qj67_691_c1 3300050509 Bacteria 17437
447 nmdc:mga0qj67_86025_c1 3300050509 Bacteria 2522
448 nmdc:mga06r32_154877_c1 3300050510 Bacteria 2272
449 nmdc:mga06r32_2471_c1 3300050510 Bacteria 16543
450 nmdc:mga06r32_28997_c1 3300050510 Bacteria 5183
451 nmdc:mga06r32_2903_c1 3300050510 Bacteria 15385
452 nmdc:mga06r32_562916_c1 3300050510 Bacteria 1113
453 nmdc:mga08y16_14362_c1 3300050511 Bacteria 8336
454 nmdc:mga08y16_187993_c1 3300050511 Bacteria 2143
455 nmdc:mga08y16_300047_c1 3300050511 Bacteria 1656
456 nmdc:mga08y16_34200_c1 3300050511 Bacteria 5339
457 nmdc:mga0n895_191827_c1 3300050512 Bacteria 2074
458 nmdc:mga0n895_47544_c1 3300050512 Bacteria 4195
459 nmdc:mga0n895_479828_c1 3300050512 Bacteria 1254
460 nmdc:mga0rr50_384097_c1 3300050513 Bacteria 1184
461 nmdc:mga0rr50_47903_c1 3300050513 Bacteria 3156
462 nmdc:mga08x19_26506_c1 3300050514 Bacteria 3617
463 nmdc:mga0a205_1240_c1 3300050515 Bacteria 21376
464 nmdc:mga0a205_3260_c1 3300050515 Bacteria 14438
465 nmdc:mga0a205_625_c1 3300050515 Bacteria 28107
466 Ga0495612_0114364 3300053078 Bacteria 1157
467 Ga0495619_0204233 3300053085 Bacteria 1368
468 Ga0500651_0029560 3300053093 Bacteria 3447
469 Ga0500651_0279896 3300053093 Bacteria 962
470 Ga0500566_0005576 3300053094 Bacteria 7480
471 Ga0500569_036978 3300053109 Bacteria 1408
472 Ga0500569_076946 3300053109 Bacteria 1061
473 Ga0500597_016001 3300053120 Bacteria 2849
474 Ga0500607_067315 3300053121 Bacteria 1856
475 Ga0500618_002472 3300053125 Bacteria 6950
476 Ga0500618_043405 3300053125 Bacteria 1028
477 Ga0500559_0000321 3300053136 Bacteria 36410
478 Ga0500568_0006901 3300053139 Bacteria 5641
479 Ga0500586_000646 3300053145 Bacteria 7101
480 Ga0500622_0086701 3300053156 Bacteria 1560
481 Ga0500634_0054526 3300053161 Bacteria 2142
482 Ga0500638_211656 3300053162 Bacteria 811
483 Ga0500636_0000479 3300053177 Bacteria 21763
484 Ga0500636_0094405 3300053177 Bacteria 1709
485 Ga0500637_0025231 3300053178 Bacteria 3265
486 Ga0500567_070300 3300053723 Bacteria 1541
487 Ga0501084_0026699 3300054114 Bacteria 4821
488 Ga0501084_0054346 3300054114 Bacteria 3350
489 Ga0501084_0346532 3300054114 Bacteria 1255
490 Ga0501082_0012828 3300060353 Bacteria 7202
491 Ga0466962_0027549 3300061719 Bacteria 2727
492 Ga0530510_0001515 3300061734 Bacteria 15640
493 2603859331 2602042107 Bacteria 6226103
494 2643755225 2643221547 Bacteria 4740017
495 2723845210 2721755755 Bacteria 8322773
496 2857529255 2857524615 Bacteria 6615449
497 2874605077 2874604998 Bacteria 7834745
498 2893071369 2893066018 Bacteria 6158120
499 2919076763 2919073203 Bacteria 6531949
500 2922365239 2922361189 Bacteria 7436256
501 2922390863 2922386360 Bacteria 7017218
502 8006993434 8006984368 Bacteria 9651211
503 Ga0496104_0001502
504 JGI25159J45721_1024855
505 JGI25406J46586_10002697
506 rootH1_10040939
507 JGI25160J50197_1045677
508 JGI25404J52841_10004082
509 JGI25404J52841_10036379
510 Ga0055526_1022357
511 Ga0070658_10027215
512 Ga0070683_100007568
513 Ga0070683_100085127
514 Ga0070683_100119486
515 Ga0070677_10111046
516 Ga0068869_100004615
517 Ga0070680_100011569
518 Ga0070680_100091270
519 Ga0070680_100168703
520 Ga0070680_100232395
521 Ga0068868_100000830
522 Ga0070660_100053771
523 Ga0070691_10015442
524 Ga0070691_10049957
525 Ga0070661_100003044
526 Ga0070661_100028358
527 Ga0070661_100208239
528 Ga0070668_100118147
529 Ga0070675_100006987
530 Ga0070659_100001896
531 Ga0070659_100050312
532 Ga0070709_10033976
533 Ga0070714_100016634
534 Ga0070713_100031903
535 Ga0070694_100004608
536 Ga0070694_100004922
537 Ga0070708_100571732
538 Ga0070663_100003089
539 Ga0070663_100003622
540 Ga0070662_100020382
541 Ga0070681_10017210
542 Ga0070681_10059639
543 Ga0070681_10082962
544 Ga0070681_10095293
545 Ga0070681_10105860
546 Ga0070681_10198700
547 Ga0070706_100065749
548 Ga0070707_100064003
549 Ga0070698_100006031
550 Ga0070698_100158420
551 Ga0070699_100103897
552 Ga0070699_100267837
553 Ga0070679_100036342
554 Ga0070684_100007914
555 Ga0070684_100008101
556 Ga0070684_100233529
557 Ga0068853_100031139
558 Ga0068853_100181523
559 Ga0068853_100334947
560 Ga0070695_100002953
561 Ga0070695_100004398
562 Ga0070695_100029076
563 Ga0070695_100112080
564 Ga0070696_100044089
565 Ga0070693_100008092
566 Ga0070704_100029782
567 Ga0070704_100051937
568 Ga0070704_100244931
569 Ga0070704_100286303
570 Ga0068855_100015190
571 Ga0070664_100063050
572 Ga0070664_100284950
573 Ga0068857_100006858
574 Ga0068857_100445688
575 Ga0068854_100031623
576 Ga0068856_100013142
577 Ga0068856_100039695
578 Ga0068852_100002689
579 Ga0068852_100149331
580 Ga0068859_100130723
581 Ga0068859_100215001
582 Ga0068864_100009752
583 Ga0068861_100003462
584 Ga0068851_10007268
585 Ga0068851_10084909
586 Ga0068863_100073076
587 Ga0068858_100069808
588 Ga0068860_100102926
589 Ga0068860_100112627
590 Ga0068862_100017687
591 Ga0068862_100166453
592 Ga0081455_10041041
593 Ga0081455_10107219
594 Ga0081538_10016357
595 Ga0081540_1000081
596 Ga0081540_1009295
597 Ga0081540_1020146
598 Ga0081539_10000498
599 Ga0075365_10118454
600 Ga0075365_10410442
601 Ga0075363_100046645
602 Ga0075362_10045376
603 Ga0075367_10213167
604 Ga0097621_100001142
605 Ga0097621_100088414
606 Ga0075370_10166109
607 Ga0068871_100054498
608 Ga0068871_100088709
609 Ga0068871_100483835
610 Ga0075430_100000135
611 Ga0075430_100014118
612 Ga0075431_100000762
613 Ga0075431_100001986
614 Ga0075431_100011006
615 Ga0075431_100029251
616 Ga0075431_100163816
617 Ga0075433_10020512
618 Ga0075434_100013662
619 Ga0075434_100044368
620 Ga0075429_100000813
621 Ga0075429_100032593
622 Ga0075429_100229767
623 Ga0097620_100130722
624 Ga0097620_100214976
625 Ga0075435_100507219
626 Ga0111539_10001385
627 Ga0111539_10388600
628 Ga0111539_10468842
629 Ga0105245_10007828
630 Ga0105247_10065926
631 Ga0105247_10183531
632 Ga0114129_10024506
633 Ga0114129_10082811
634 Ga0114129_10786081
635 Ga0114129_10870668
636 Ga0114129_10943440
637 Ga0105243_10012001
638 Ga0105243_10041508
639 Ga0105243_10055814
640 Ga0105242_10075217
641 Ga0105248_10016613
642 Ga0105237_10053878
643 Ga0105237_10067702
644 Ga0105237_10102220
645 Ga0105238_10002915
646 Ga0105238_10015123
647 Ga0105249_10088492
648 Ga0105249_10105115
649 Ga0105249_10129929
650 Ga0105239_10036438
651 Ga0105239_10147238
652 Ga0105239_10536364
653 Ga0105246_10024806
654 Ga0105246_10230443
655 Ga0157373_10004318
656 Ga0157373_10435208
657 Ga0157371_10045254
658 Ga0157369_10003699
659 Ga0157369_10020490
660 Ga0157369_10034106
661 Ga0157374_10150754
662 Ga0157374_10377225
663 Ga0163162_10068612
664 Ga0157372_10004355
665 Ga0157372_10005529
666 Ga0157372_10274872
667 Ga0157375_10047306
668 Ga0157375_10066688
669 Ga0157375_10082047
670 Ga0157377_10024076
671 Ga0157379_10008581
672 Ga0157376_10002173
673 Ga0163161_10002433
674 Ga0213876_10002842
675 Ga0209564_1000974
676 Ga0207656_10008670
677 Ga0207688_10042447
678 Ga0207647_10021284
679 Ga0207699_10163713
680 Ga0207645_10009139
681 Ga0207645_10201266
682 Ga0207643_10017267
683 Ga0207705_10072647
684 Ga0207684_10001609
685 Ga0207707_10009718
686 Ga0207707_10040316
687 Ga0207707_10067899
688 Ga0207707_10561820
689 Ga0207695_10493411
690 Ga0207671_10053485
691 Ga0207671_10482652
692 Ga0207660_10046240
693 Ga0207660_10053492
694 Ga0207660_10087888
695 Ga0207660_10095683
696 Ga0207660_10186748
697 Ga0207657_10028478
698 Ga0207649_10009678
699 Ga0207649_10036906
700 Ga0207649_10239564
701 Ga0207652_10506014
702 Ga0207646_10001224
703 Ga0207646_10014851
704 Ga0207646_10309441
705 Ga0207694_10021091
706 Ga0207694_10047604
707 Ga0207694_10525226
708 Ga0207659_10378425
709 Ga0207687_10013561
710 Ga0207700_10006997
711 Ga0207700_10010081
712 Ga0207644_10016543
713 Ga0207690_10012384
714 Ga0207690_10060299
715 Ga0207706_10004863
716 Ga0207706_10070260
717 Ga0207686_10125013
718 Ga0207709_10015721
719 Ga0207665_10279279
720 Ga0207691_10186006
721 Ga0207711_10020302
722 Ga0207689_10002334
723 Ga0207689_10019083
724 Ga0207661_10008130
725 Ga0207661_10083570
726 Ga0207661_10087200
727 Ga0207661_10208535
728 Ga0207679_10019180
729 Ga0207679_10150664
730 Ga0207679_10718020
731 Ga0207667_10025812
732 Ga0207667_10144896
733 Ga0207712_10048322
734 Ga0207640_10046280
735 Ga0207677_10032253
736 Ga0207703_10088258
737 Ga0207703_10093492
738 Ga0207703_10103657
739 Ga0207703_10169680
740 Ga0207639_10056335
741 Ga0207639_10282772
742 Ga0207639_10289252
743 Ga0207678_10001027
744 Ga0207708_10053245
745 Ga0207708_10064904
746 Ga0207702_10047399
747 Ga0207702_10200976
748 Ga0207702_10267887
749 Ga0207641_10018311
750 Ga0207676_10103450
751 Ga0207674_10024593
752 Ga0207674_10295803
753 Ga0207675_100000267
754 Ga0207675_100357740
755 Ga0207698_10028141
756 Ga0207698_10232935
757 Ga0209970_1002724
758 Ga0209983_1000789
759 Ga0209966_1000072
760 Ga0209998_10000001
761 Ga0207428_10000199
762 Ga0207428_10089384
763 Ga0268265_10030618
764 Ga0268265_10134331
765 Ga0268264_10072683
766 Ga0307517_10000042
767 Ga0307517_10065362
768 Ga0316575_10004370
769 Ga0307411_10573232
770 Ga0373930_0006428
771 Ga0373923_0003635
772 Ga0373932_0044757
773 Ga0373936_0020848
774 Ga0373939_0033781
775 Ga0373945_0030119
776 Ga0373954_0000006
777 Ga0373954_0094098
778 Ga0373943_0020249
779 Ga0373943_0125922
780 Ga0373946_0013452
781 Ga0316574_0104858
782 Ga0373924_0023365
783 Ga0373931_0014334
784 Ga0373935_0035420
785 Ga0373927_0008437
786 Ga0373927_0053768
787 Ga0373933_0023362
788 Ga0373933_0050965
789 Ga0373933_0305056
790 Ga0373947_0006351
791 Ga0373937_0000595
792 Ga0373937_0711166
793 Ga0373925_0012978
794 Ga0395899_0072685
795 Ga0436364_0522811
796 Ga0395901_0168884
797 Ga0436365_0989805
798 Ga0436365_1647459
799 Ga0436363_0747842
800 Ga0439465_0036099
801 Ga0439448_0007341
802 Ga0439450_011773
803 Ga0439455_0017902
804 Ga0439463_027361
805 Ga0439460_0006824
806 Ga0451577_0001636
807 Ga0451577_0042793
808 Ga0453683_0022595
809 Ga0453683_0035288
810 Ga0453683_0165394
811 Ga0466961_0050437
812 Ga0453684_0012249
813 Ga0453684_0345012
814 Ga0466971_0041620
815 Ga0466968_0069216
816 Ga0451576_0015918
817 Ga0451576_0102344
818 Ga0451576_0249105
819 Ga0451576_0532416
820 Ga0495592_0040014
821 Ga0495603_0038121
822 Ga0495629_0229344
823 Ga0495638_0019678
824 Ga0495653_0211477
825 Ga0495580_0051863
826 Ga0495582_0002244
827 Ga0495605_0137235
828 Ga0495662_0021223
829 Ga0495664_0019087
830 Ga0495585_0171392
831 Ga0495606_0083481
832 Ga0495608_0012109
833 Ga0495618_0115723
834 Ga0495630_0073581
835 Ga0495665_0035356
836 Ga0495640_0204158
837 Ga0495586_0197977
838 Ga0495645_0036855
839 Ga0495622_0045336
840 Ga0495622_0060802
841 Ga0495656_0001687
842 Ga0495634_0059988
843 Ga0495625_0233115
844 Ga0495635_0029499
845 Ga0495599_0118727
846 Ga0495623_0052279
847 Ga0495647_0016970
848 Ga0495658_0002672
849 Ga0495658_0003482
850 Ga0495669_0006361
851 Ga0495670_0143117
852 Ga0495600_0008569
853 Ga0495600_0266567
854 Ga0495581_0070396
855 Ga0495636_0037114
856 Ga0495674_0017285
857 Ga0495672_0090995
858 Ga0495676_0091488
859 Ga0495684_0005645
860 Ga0495593_0020721
861 Ga0495593_0162342
862 Ga0495614_0132425
863 Ga0495626_0038897
864 Ga0496100_0099683
865 Ga0496101_0027462
866 Ga0496101_0099916
867 Ga0496101_0148807
868 Ga0496102_0330271
869 Ga0496104_0036519
870 Ga0496104_0085675
871 Ga0496106_0077843
872 Ga0496106_0091124
873 Ga0496106_0141368
874 Ga0496106_0274833
875 Ga0496107_0061053
876 Ga0496108_0006468
877 Ga0496108_0017210
878 Ga0496108_0131308
879 Ga0496108_0320428
880 Ga0496109_0011313
881 Ga0496109_0027605
882 Ga0496109_0104485
883 Ga0496110_0118688
884 Ga0496111_0020678
885 Ga0496111_0286258
886 Ga0496112_0005981
887 Ga0496112_0072181
888 Ga0496114_0272279
889 Ga0496115_0057856
890 Ga0496115_0086340
891 Ga0496117_0096531
892 Ga0496118_0068318
893 Ga0496118_0099840
894 Ga0496121_0018591
895 Ga0496121_0026517
896 Ga0496121_0095488
897 Ga0496122_0044915
898 Ga0496122_0147009
899 Ga0496123_0047171
900 Ga0496123_0148232
901 Ga0496125_0000090
902 Ga0496125_0006156
903 Ga0496125_0025676
904 Ga0496126_0012807
905 Ga0496126_0065531
906 Ga0496126_0274674
907 Ga0501033_0114917
908 Ga0501033_0189733
909 Ga0501034_0291739
910 Ga0501036_0072794
911 Ga0501037_0148872
912 Ga0501038_0026974
913 Ga0501039_0034694
914 Ga0501039_0375641
915 Ga0501041_0006109
916 Ga0501042_0000949
917 Ga0501047_0129571
918 Ga0501048_0034501
919 Ga0501048_0412465
920 Ga0501068_0057014
921 Ga0501070_0160223
922 Ga0501071_0184148
923 Ga0501072_0012506
924 Ga0501072_0584799
925 Ga0501075_0013676
926 Ga0501076_0022715
927 Ga0501079_0005656
928 Ga0501079_0103254
929 Ga0501080_0013960
930 Ga0501080_0123198
931 Ga0501080_0343593
932 Ga0501081_0028529
933 Ga0501044_0065195
934 Ga0501044_0141000
935 Ga0501044_0393947
936 Ga0501045_0014321
937 Ga0501045_0631252
938 nmdc:mga03683_52122_c1
939 nmdc:mga0k408_9779_c1
940 nmdc:mga06z11_313811_c1
941 nmdc:mga07m45_263441_c1
942 nmdc:mga05p37_11038_c1
943 nmdc:mga05p37_622761_c1
944 nmdc:mga05p37_640102_c1
945 nmdc:mga05p37_69613_c2
946 nmdc:mga09592_292_c1
947 nmdc:mga09592_6484_c1
948 nmdc:mga0qj67_691_c1
949 nmdc:mga0qj67_86025_c1
950 nmdc:mga06r32_154877_c1
951 nmdc:mga06r32_2471_c1
952 nmdc:mga06r32_28997_c1
953 nmdc:mga06r32_2903_c1
954 nmdc:mga06r32_562916_c1
955 nmdc:mga08y16_14362_c1
956 nmdc:mga08y16_187993_c1
957 nmdc:mga08y16_300047_c1
958 nmdc:mga08y16_34200_c1
959 nmdc:mga0n895_191827_c1
960 nmdc:mga0n895_47544_c1
961 nmdc:mga0n895_479828_c1
962 nmdc:mga0rr50_384097_c1
963 nmdc:mga0rr50_47903_c1
964 nmdc:mga08x19_26506_c1
965 nmdc:mga0a205_1240_c1
966 nmdc:mga0a205_3260_c1
967 nmdc:mga0a205_625_c1
968 Ga0495612_0114364
969 Ga0495619_0204233
970 Ga0500651_0029560
971 Ga0500651_0279896
972 Ga0500566_0005576
973 Ga0500569_036978
974 Ga0500569_076946
975 Ga0500597_016001
976 Ga0500607_067315
977 Ga0500618_002472
978 Ga0500618_043405
979 Ga0500559_0000321
980 Ga0500568_0006901
981 Ga0500586_000646
982 Ga0500622_0086701
983 Ga0500634_0054526
984 Ga0500638_211656
985 Ga0500636_0000479
986 Ga0500636_0094405
987 Ga0500637_0025231
988 Ga0500567_070300
989 Ga0501084_0026699
990 Ga0501084_0054346
991 Ga0501084_0346532
992 Ga0501082_0012828
993 Ga0466962_0027549
994 Ga0530510_0001515
995 2603859331
996 2643755225
997 2723845210
998 2857529255
999 2874605077
1000 2893071369
1001 2919076763
1002 2922365239
1003 2922390863
1004 8006993434

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

80

254

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

81

303

0.91

PF08659

KR

KR domain

76

237

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ewm-assembly1.cif.gz_A-2 crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9645 11 254
4y98-assembly1.cif.gz_A crystal structure of ligd-apo form from sphingobium sp. strain syk-6 0.9643 10 192
1vl8-assembly1.cif.gz_B crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution 0.9622 9 253
4za2-assembly1.cif.gz_B crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d-gluconate dehydrogenase complexed with nad+ 0.9613 8 253
4j2h-assembly1.cif.gz_A crystal structure of a putative short-chain alcohol dehydrogenase from sinorhizobium meliloti 1021 (target nysgrc-011708) 0.9607 8 253
ID Description Score Start End Superfamily
4y98A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9643 10 192 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9642 9 203 3.40.50.720
1vl8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9622 9 253 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9605 11 253 3.40.50.720
4j2hA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9581 8 253 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V6TDN1-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.991 8 214 GO:0016616
GO:0030497
AF-A0A7K1CQN7-F1-model_v4 deleted 0.9867 7 255
AF-A0A2D7SLN4-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9805 7 259 GO:0016616
AF-A0A2D6LGP1-F1-model_v4 deleted 0.9752 10 253
AF-A0A2V9RAL4-F1-model_v4 Short-chain dehydrogenase 0.9744 10 253

Map