F455871

General Info

Members Datasets Scaffolds Average Seq Length
502 259 1004 200

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100074431|Ga0307409_1000744312
Length 201
Sequence VAWSIEGTYFENCSCDLGADYDRCNAVLVFQIESGEIEGVDVSGLTVAAVADTPQVMSEGNWRLGVLMDEEATDEQAEKLGAVFGGLLGGPMAALGPLVGENLGMEKVAMELSHENGTHSIRFGDGGGVTVQDVVPFGKENGEPVRFEGAFHPASETLTIARSTESQLRARGQVRVLEPVLLGCLIRGGRGPQARSADAAG

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.59
Nodule 0
Rhizoplane 12.95
Rhizosphere 83.47
Stem 0
Stem Tuber 0
Unclassified 6.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100074431 3300031995 Bacteria 2714
2 JGI24739J22299_10062257 3300001989 Bacteria 1177
3 JGI24748J21848_1010766 3300002074 Bacteria 1076
4 JGI24744J21845_10001125 3300002077 Bacteria 5209
5 JGI24744J21845_10008669 3300002077 Bacteria 2090
6 Ga0058861_11366977 3300004800 Bacteria 804
7 Ga0058862_12535896 3300004803 Bacteria 1719
8 Ga0070676_10008299 3300005328 Bacteria 5595
9 Ga0070683_100166614 3300005329 Bacteria 2091
10 Ga0070690_100698108 3300005330 Bacteria 779
11 Ga0068869_100195951 3300005334 Bacteria 1591
12 Ga0070680_100008354 3300005336 Bacteria 7924
13 Ga0070680_100266181 3300005336 Bacteria 1451
14 Ga0070682_100068429 3300005337 Bacteria 2265
15 Ga0068868_100000794 3300005338 Bacteria 21371
16 Ga0068868_100024695 3300005338 Bacteria 4562
17 Ga0070660_100007781 3300005339 Bacteria 7472
18 Ga0070660_100229701 3300005339 Bacteria 1510
19 Ga0070689_100076051 3300005340 Bacteria 2630
20 Ga0070689_100323243 3300005340 Bacteria 1289
21 Ga0070691_10008971 3300005341 Bacteria 4575
22 Ga0070692_10212509 3300005345 Bacteria 1139
23 Ga0070668_100009613 3300005347 Bacteria 7174
24 Ga0070668_100341756 3300005347 Bacteria 1264
25 Ga0070669_100010699 3300005353 Bacteria 6512
26 Ga0070669_100536792 3300005353 Bacteria 974
27 Ga0070675_100469173 3300005354 Bacteria 1131
28 Ga0070675_100780815 3300005354 Unclassified 873
29 Ga0070674_100016486 3300005356 Bacteria 4632
30 Ga0070674_100285679 3300005356 Bacteria 1309
31 Ga0070674_100456630 3300005356 Bacteria 1056
32 Ga0070674_100488202 3300005356 Bacteria 1024
33 Ga0070673_100188720 3300005364 Bacteria 1769
34 Ga0070688_100031904 3300005365 Bacteria 3173
35 Ga0070667_100032605 3300005367 Bacteria 4345
36 Ga0070667_100036675 3300005367 Bacteria 4111
37 Ga0070709_10000516 3300005434 Bacteria 22840
38 Ga0070709_10094992 3300005434 Bacteria 1974
39 Ga0070714_100402508 3300005435 Bacteria 1294
40 Ga0070714_101165002 3300005435 Bacteria 752
41 Ga0070713_100000308 3300005436 Bacteria 32297
42 Ga0070713_100021283 3300005436 Bacteria 4986
43 Ga0070710_10251973 3300005437 Bacteria 1135
44 Ga0070711_100410730 3300005439 Bacteria 1101
45 Ga0070711_100640039 3300005439 Unclassified 890
46 Ga0070705_100062850 3300005440 Bacteria 2212
47 Ga0070705_100561087 3300005440 Unclassified 877
48 Ga0070700_100015592 3300005441 Bacteria 4313
49 Ga0070700_100142012 3300005441 Bacteria 1633
50 Ga0070700_100219283 3300005441 Bacteria 1347
51 Ga0070700_100894225 3300005441 Bacteria 722
52 Ga0070694_100067953 3300005444 Bacteria 2448
53 Ga0070663_100002609 3300005455 Bacteria 10189
54 Ga0070663_100003303 3300005455 Bacteria 9290
55 Ga0070663_100149202 3300005455 Bacteria 1791
56 Ga0070663_100156836 3300005455 Bacteria 1749
57 Ga0070678_100010714 3300005456 Bacteria 5614
58 Ga0070678_100043159 3300005456 Bacteria 3210
59 Ga0070662_100106361 3300005457 Bacteria 2131
60 Ga0070662_100276952 3300005457 Bacteria 1357
61 Ga0070681_10146504 3300005458 Bacteria 2290
62 Ga0068867_100000281 3300005459 Bacteria 33623
63 Ga0068867_100006126 3300005459 Bacteria 8514
64 Ga0068867_100341092 3300005459 Bacteria 1247
65 Ga0070685_10060233 3300005466 Bacteria 2219
66 Ga0070707_100118746 3300005468 Bacteria 2567
67 Ga0070679_100002961 3300005530 Bacteria 15486
68 Ga0070679_100007879 3300005530 Bacteria 9991
69 Ga0070679_100333699 3300005530 Bacteria 1465
70 Ga0070684_100155067 3300005535 Bacteria 2076
71 Ga0070684_100799147 3300005535 Bacteria 882
72 Ga0068853_100569011 3300005539 Bacteria 1074
73 Ga0070672_100089534 3300005543 Bacteria 2480
74 Ga0070672_100193987 3300005543 Bacteria 1697
75 Ga0070686_100235978 3300005544 Bacteria 1329
76 Ga0070686_100502553 3300005544 Bacteria 941
77 Ga0070695_100000347 3300005545 Bacteria 23666
78 Ga0070695_100075025 3300005545 Bacteria 2223
79 Ga0070695_100131897 3300005545 Bacteria 1723
80 Ga0070695_100449691 3300005545 Bacteria 987
81 Ga0070695_100478162 3300005545 Unclassified 959
82 Ga0070696_100054908 3300005546 Bacteria 2777
83 Ga0070665_100013749 3300005548 Bacteria 8145
84 Ga0070665_100020362 3300005548 Bacteria 6662
85 Ga0070704_100006582 3300005549 Bacteria 6854
86 Ga0070704_100099617 3300005549 Bacteria 2186
87 Ga0068855_100743209 3300005563 Unclassified 1047
88 Ga0070664_100053798 3300005564 Bacteria 3414
89 Ga0070664_100259748 3300005564 Bacteria 1563
90 Ga0068854_100028182 3300005578 Bacteria 3878
91 Ga0068854_100150149 3300005578 Bacteria 1796
92 Ga0068854_100203700 3300005578 Bacteria 1557
93 Ga0068854_100311079 3300005578 Bacteria 1277
94 Ga0070702_100006826 3300005615 Bacteria 5429
95 Ga0070702_100120490 3300005615 Bacteria 1642
96 Ga0070702_100460976 3300005615 Bacteria 924
97 Ga0068852_100010322 3300005616 Bacteria 6974
98 Ga0068852_100562058 3300005616 Bacteria 1142
99 Ga0068859_100085634 3300005617 Bacteria 3197
100 Ga0068859_100109369 3300005617 Bacteria 2825
101 Ga0068864_100113812 3300005618 Bacteria 2412
102 Ga0068864_100766889 3300005618 Bacteria 946
103 Ga0068866_10007817 3300005718 Bacteria 4486
104 Ga0068866_10046836 3300005718 Bacteria 2177
105 Ga0068866_10077955 3300005718 Bacteria 1771
106 Ga0068861_100017327 3300005719 Bacteria 5112
107 Ga0068861_100086706 3300005719 Bacteria 2462
108 Ga0068861_100634791 3300005719 Bacteria 985
109 Ga0068851_10065322 3300005834 Bacteria 1872
110 Ga0068863_100051857 3300005841 Bacteria 3888
111 Ga0068858_100024129 3300005842 Bacteria 5667
112 Ga0068858_100045074 3300005842 Bacteria 4087
113 Ga0068858_100352798 3300005842 Unclassified 1409
114 Ga0068858_100482326 3300005842 Bacteria 1197
115 Ga0068858_101370404 3300005842 Unclassified 696
116 Ga0068860_100218045 3300005843 Bacteria 1852
117 Ga0068860_100247892 3300005843 Bacteria 1734
118 Ga0068862_100031740 3300005844 Bacteria 4462
119 Ga0068862_100055454 3300005844 Bacteria 3394
120 Ga0068862_100105452 3300005844 Bacteria 2470
121 Ga0068862_100573801 3300005844 Bacteria 1080
122 Ga0081455_10132800 3300005937 Bacteria 1944
123 Ga0081538_10112858 3300005981 Unclassified 1329
124 Ga0081538_10119210 3300005981 Bacteria 1272
125 Ga0081539_10000952 3300005985 Bacteria 54279
126 Ga0070717_10044014 3300006028 Bacteria 3645
127 Ga0070717_10140207 3300006028 Bacteria 2085
128 Ga0075365_10001091 3300006038 Bacteria 11794
129 Ga0075363_100010965 3300006048 Bacteria 4324
130 Ga0075363_100023178 3300006048 Bacteria 3144
131 Ga0075364_10007111 3300006051 Bacteria 6617
132 Ga0075364_10017196 3300006051 Bacteria 4514
133 Ga0075364_10027794 3300006051 Bacteria 3616
134 Ga0075364_10150941 3300006051 Bacteria 1566
135 Ga0070715_10000001 3300006163 Bacteria 693690
136 Ga0070715_10002164 3300006163 Bacteria 5958
137 Ga0070716_100086654 3300006173 Bacteria 1884
138 Ga0070716_100511110 3300006173 Unclassified 888
139 Ga0070712_100016254 3300006175 Bacteria 4805
140 Ga0070712_100027964 3300006175 Bacteria 3768
141 Ga0070712_100052058 3300006175 Bacteria 2854
142 Ga0070712_100256746 3300006175 Bacteria 1399
143 Ga0070712_100780552 3300006175 Unclassified 819
144 Ga0070712_100881545 3300006175 Bacteria 771
145 Ga0075362_10036714 3300006177 Bacteria 2145
146 Ga0075367_10025118 3300006178 Bacteria 3367
147 Ga0075367_10075429 3300006178 Bacteria 2034
148 Ga0075369_10003323 3300006186 Bacteria 5841
149 Ga0075369_10012827 3300006186 Bacteria 3314
150 Ga0097621_100095974 3300006237 Bacteria 2488
151 Ga0068871_100018234 3300006358 Bacteria 5330
152 Ga0075430_100157527 3300006846 Bacteria 1890
153 Ga0075430_100271518 3300006846 Bacteria 1403
154 Ga0075434_100613079 3300006871 Unclassified 1107
155 Ga0068865_100012907 3300006881 Bacteria 5269
156 Ga0068865_100064632 3300006881 Bacteria 2576
157 Ga0068865_100109481 3300006881 Bacteria 2036
158 Ga0068865_100203726 3300006881 Bacteria 1537
159 Ga0097620_100085630 3300006931 Bacteria 3197
160 Ga0097620_100109366 3300006931 Bacteria 2825
161 Ga0099795_10002359 3300007788 Bacteria 4420
162 Ga0105240_10973447 3300009093 Bacteria 909
163 Ga0111539_10051303 3300009094 Bacteria 4914
164 Ga0105245_10011408 3300009098 Bacteria 7737
165 Ga0105245_10062303 3300009098 Bacteria 3365
166 Ga0105245_10200114 3300009098 Bacteria 1918
167 Ga0105245_10232447 3300009098 Bacteria 1784
168 Ga0105245_10737577 3300009098 Bacteria 1020
169 Ga0105245_10793951 3300009098 Bacteria 984
170 Ga0105245_11165805 3300009098 Bacteria 818
171 Ga0105247_10106070 3300009101 Bacteria 1802
172 Ga0105247_10252708 3300009101 Bacteria 1206
173 Ga0105247_10368012 3300009101 Unclassified 1016
174 Ga0105243_10059413 3300009148 Bacteria 3051
175 Ga0105243_10117997 3300009148 Unclassified 2232
176 Ga0105243_10236779 3300009148 Bacteria 1622
177 Ga0105241_10010593 3300009174 Bacteria 6764
178 Ga0105242_10038018 3300009176 Bacteria 3868
179 Ga0105242_10896789 3300009176 Bacteria 886
180 Ga0105248_10282576 3300009177 Bacteria 1868
181 Ga0105248_10410171 3300009177 Bacteria 1525
182 Ga0105248_10852762 3300009177 Bacteria 1028
183 Ga0105237_10049878 3300009545 Bacteria 4206
184 Ga0105237_10163103 3300009545 Bacteria 2227
185 Ga0105238_10194650 3300009551 Bacteria 2003
186 Ga0105249_10085738 3300009553 Bacteria 2936
187 Ga0105249_10187247 3300009553 Bacteria 2018
188 Ga0105249_10225636 3300009553 Bacteria 1845
189 Ga0105249_10531935 3300009553 Bacteria 1224
190 Ga0105239_10166507 3300010375 Bacteria 2465
191 Ga0105239_10409858 3300010375 Bacteria 1534
192 Ga0105246_10470617 3300011119 Bacteria 1061
193 Ga0157373_10197698 3300013100 Bacteria 1417
194 Ga0157371_10577631 3300013102 Bacteria 835
195 Ga0157369_10442094 3300013105 Bacteria 1347
196 Ga0157374_10554272 3300013296 Bacteria 1157
197 Ga0157378_10152038 3300013297 Bacteria 2157
198 Ga0163162_10021515 3300013306 Bacteria 6353
199 Ga0163162_10129812 3300013306 Bacteria 2628
200 Ga0163162_10214782 3300013306 Bacteria 2054
201 Ga0163162_10356639 3300013306 Bacteria 1595
202 Ga0163162_10663015 3300013306 Bacteria 1166
203 Ga0157372_10055190 3300013307 Bacteria 4436
204 Ga0157372_10345938 3300013307 Bacteria 1732
205 Ga0157375_10018778 3300013308 Bacteria 6274
206 Ga0157375_10111182 3300013308 Bacteria 2838
207 Ga0157375_10208178 3300013308 Bacteria 2113
208 Ga0163163_10443572 3300014325 Bacteria 1358
209 Ga0163163_10612570 3300014325 Bacteria 1152
210 Ga0157380_10044062 3300014326 Bacteria 3494
211 Ga0182008_10060429 3300014497 Bacteria 1868
212 Ga0157377_10021442 3300014745 Bacteria 3399
213 Ga0157379_10151061 3300014968 Bacteria 2095
214 Ga0157379_10533363 3300014968 Bacteria 1091
215 Ga0157376_10001068 3300014969 Bacteria 17938
216 Ga0157376_10052693 3300014969 Bacteria 3384
217 Ga0157376_10704437 3300014969 Bacteria 1015
218 Ga0182005_1032652 3300015265 Bacteria 1416
219 Ga0163161_10032562 3300017792 Bacteria 3723
220 Ga0163161_10220531 3300017792 Bacteria 1468
221 Ga0206356_10348829 3300020070 Bacteria 665
222 Ga0224712_10424847 3300022467 Bacteria 636
223 Ga0207656_10062251 3300025321 Bacteria 1640
224 Ga0207642_10034981 3300025899 Bacteria 2141
225 Ga0207710_10008702 3300025900 Bacteria 4280
226 Ga0207688_10001000 3300025901 Bacteria 14400
227 Ga0207688_10038639 3300025901 Bacteria 2650
228 Ga0207688_10045316 3300025901 Bacteria 2453
229 Ga0207688_10139221 3300025901 Bacteria 1427
230 Ga0207647_10023589 3300025904 Bacteria 4068
231 Ga0207647_10161273 3300025904 Bacteria 1308
232 Ga0207685_10000036 3300025905 Bacteria 65666
233 Ga0207685_10205831 3300025905 Unclassified 927
234 Ga0207699_10000024 3300025906 Bacteria 169105
235 Ga0207699_10841079 3300025906 Bacteria 676
236 Ga0207645_10178883 3300025907 Bacteria 1391
237 Ga0207705_10182346 3300025909 Bacteria 1585
238 Ga0207705_10541903 3300025909 Bacteria 904
239 Ga0207707_10158584 3300025912 Bacteria 1978
240 Ga0207695_10042804 3300025913 Bacteria 4832
241 Ga0207695_10686942 3300025913 Bacteria 904
242 Ga0207693_10041694 3300025915 Bacteria 3613
243 Ga0207693_10295829 3300025915 Bacteria 1268
244 Ga0207693_10296446 3300025915 Bacteria 1267
245 Ga0207693_10424665 3300025915 Bacteria 1039
246 Ga0207663_10088640 3300025916 Bacteria 2047
247 Ga0207663_10175442 3300025916 Bacteria 1526
248 Ga0207657_10075511 3300025919 Bacteria 2844
249 Ga0207657_10398960 3300025919 Bacteria 1082
250 Ga0207657_10457645 3300025919 Bacteria 1001
251 Ga0207649_10297756 3300025920 Bacteria 1178
252 Ga0207652_10005866 3300025921 Bacteria 9939
253 Ga0207652_10026772 3300025921 Bacteria 4806
254 Ga0207652_10080143 3300025921 Bacteria 2854
255 Ga0207652_10900085 3300025921 Bacteria 782
256 Ga0207646_10034257 3300025922 Bacteria 4590
257 Ga0207681_10134862 3300025923 Bacteria 1831
258 Ga0207681_10156300 3300025923 Bacteria 1714
259 Ga0207694_10123487 3300025924 Bacteria 2069
260 Ga0207694_10453177 3300025924 Bacteria 1071
261 Ga0207659_10036992 3300025926 Bacteria 3386
262 Ga0207659_10332958 3300025926 Bacteria 1256
263 Ga0207659_10405353 3300025926 Bacteria 1141
264 Ga0207687_10014170 3300025927 Bacteria 5216
265 Ga0207687_10019951 3300025927 Bacteria 4446
266 Ga0207700_10594742 3300025928 Bacteria 984
267 Ga0207664_10186346 3300025929 Bacteria 1784
268 Ga0207664_10246599 3300025929 Bacteria 1557
269 Ga0207644_10391684 3300025931 Bacteria 1134
270 Ga0207690_10097647 3300025932 Bacteria 2091
271 Ga0207690_10227178 3300025932 Bacteria 1431
272 Ga0207706_10108669 3300025933 Bacteria 2440
273 Ga0207706_10291619 3300025933 Bacteria 1422
274 Ga0207686_10039493 3300025934 Bacteria 2864
275 Ga0207709_10143234 3300025935 Bacteria 1646
276 Ga0207709_10143322 3300025935 Bacteria 1645
277 Ga0207670_10027300 3300025936 Bacteria 3607
278 Ga0207669_10000932 3300025937 Bacteria 12361
279 Ga0207669_10331861 3300025937 Bacteria 1168
280 Ga0207704_10028414 3300025938 Bacteria 3103
281 Ga0207704_10068849 3300025938 Bacteria 2233
282 Ga0207704_10446025 3300025938 Bacteria 1032
283 Ga0207665_10699744 3300025939 Bacteria 797
284 Ga0207691_10068716 3300025940 Bacteria 3201
285 Ga0207691_10703760 3300025940 Bacteria 852
286 Ga0207689_10164551 3300025942 Bacteria 1828
287 Ga0207661_10052805 3300025944 Bacteria 3249
288 Ga0207661_10193006 3300025944 Bacteria 1786
289 Ga0207661_10241447 3300025944 Bacteria 1603
290 Ga0207661_10605381 3300025944 Bacteria 1006
291 Ga0207661_11130022 3300025944 Bacteria 721
292 Ga0207679_10067793 3300025945 Bacteria 2678
293 Ga0207667_10614744 3300025949 Bacteria 1095
294 Ga0207651_10025914 3300025960 Bacteria 3653
295 Ga0207712_10520106 3300025961 Unclassified 1020
296 Ga0207668_10018189 3300025972 Bacteria 4416
297 Ga0207668_10096401 3300025972 Bacteria 2186
298 Ga0207640_10017936 3300025981 Bacteria 4149
299 Ga0207640_10285322 3300025981 Bacteria 1299
300 Ga0207640_10554050 3300025981 Bacteria 966
301 Ga0207658_10010397 3300025986 Bacteria 6321
302 Ga0207658_10224831 3300025986 Bacteria 1581
303 Ga0207677_10005609 3300026023 Bacteria 6818
304 Ga0207677_10150120 3300026023 Bacteria 1797
305 Ga0207677_10435902 3300026023 Bacteria 1120
306 Ga0207677_10456172 3300026023 Bacteria 1096
307 Ga0207703_10448456 3300026035 Bacteria 1205
308 Ga0207703_11149201 3300026035 Unclassified 746
309 Ga0207639_10060588 3300026041 Bacteria 2920
310 Ga0207678_10007104 3300026067 Bacteria 9931
311 Ga0207678_10007749 3300026067 Bacteria 9487
312 Ga0207678_10014607 3300026067 Bacteria 6910
313 Ga0207708_10021432 3300026075 Bacteria 4873
314 Ga0207708_10124586 3300026075 Bacteria 2010
315 Ga0207708_10256464 3300026075 Bacteria 1410
316 Ga0207708_10283668 3300026075 Bacteria 1343
317 Ga0207702_10033885 3300026078 Bacteria 4268
318 Ga0207648_10000872 3300026089 Bacteria 33984
319 Ga0207648_10018677 3300026089 Bacteria 6271
320 Ga0207648_10035576 3300026089 Bacteria 4388
321 Ga0207676_10659813 3300026095 Bacteria 1010
322 Ga0207676_10984753 3300026095 Bacteria 830
323 Ga0207675_100006109 3300026118 Bacteria 11455
324 Ga0207675_100020245 3300026118 Bacteria 6203
325 Ga0207675_100126376 3300026118 Bacteria 2422
326 Ga0207683_10018563 3300026121 Bacteria 5935
327 Ga0207683_10305034 3300026121 Bacteria 1457
328 Ga0207683_10373374 3300026121 Bacteria 1310
329 Ga0207683_10502106 3300026121 Bacteria 1120
330 Ga0207683_10619261 3300026121 Bacteria 1002
331 Ga0207698_10033449 3300026142 Bacteria 3736
332 Ga0268266_10391802 3300028379 Unclassified 1312
333 Ga0268266_10400832 3300028379 Bacteria 1297
334 Ga0268265_10228934 3300028380 Bacteria 1632
335 Ga0268265_10274300 3300028380 Bacteria 1506
336 Ga0268264_10034191 3300028381 Bacteria 4180
337 Ga0268264_10058330 3300028381 Bacteria 3232
338 Ga0265338_10036185 3300028800 Bacteria 4730
339 Ga0265330_10076651 3300031235 Bacteria 1443
340 Ga0265325_10052975 3300031241 Bacteria 2082
341 Ga0265339_10030781 3300031249 Bacteria 3036
342 Ga0307408_100271583 3300031548 Unclassified 1408
343 Ga0265313_10053841 3300031595 Bacteria 1914
344 Ga0265314_10054126 3300031711 Bacteria 2778
345 Ga0307405_10023076 3300031731 Bacteria 3530
346 Ga0307413_10655576 3300031824 Bacteria 866
347 Ga0307410_10065094 3300031852 Bacteria 2507
348 Ga0307410_10774170 3300031852 Bacteria 814
349 Ga0307406_10679964 3300031901 Bacteria 857
350 Ga0307407_10660592 3300031903 Bacteria 784
351 Ga0307409_100641834 3300031995 Bacteria 1054
352 Ga0307416_100032735 3300032002 Bacteria 3933
353 Ga0307416_100396075 3300032002 Bacteria 1417
354 Ga0307416_100523258 3300032002 Bacteria 1255
355 Ga0373931_0308496 3300035691 Unclassified 979
356 Ga0373947_0221520 3300035725 Bacteria 1244
357 Ga0395898_0597894 3300037466 Unclassified 1046
358 Ga0395898_0898544 3300037466 Unclassified 824
359 Ga0395905_0908855 3300037471 Unclassified 783
360 Ga0395901_0253766 3300038443 Bacteria 1832
361 Ga0395901_0858917 3300038443 Bacteria 892
362 Ga0242420_023853 3300038996 Bacteria 1106
363 Ga0439465_0003270 3300041413 Bacteria 5295
364 Ga0466961_0030111 3300044693 Bacteria 3488
365 Ga0466961_0073522 3300044693 Bacteria 2168
366 Ga0466961_0125325 3300044693 Bacteria 1612
367 Ga0466963_0040024 3300044694 Bacteria 3071
368 Ga0466963_0199568 3300044694 Bacteria 1399
369 Ga0466964_0059692 3300044706 Bacteria 1584
370 Ga0466968_0040362 3300044735 Bacteria 1968
371 Ga0466957_0025666 3300044842 Bacteria 3493
372 Ga0466957_0029798 3300044842 Bacteria 3256
373 Ga0466959_0009920 3300045049 Bacteria 6789
374 Ga0466959_0138494 3300045049 Bacteria 1721
375 Ga0466959_0256462 3300045049 Bacteria 1205
376 Ga0466958_0003776 3300045836 Bacteria 7910
377 Ga0466958_0043272 3300045836 Bacteria 2712
378 Ga0466967_0228555 3300045976 Bacteria 1770
379 Ga0495603_0000354 3300046455 Bacteria 24685
380 Ga0495629_0043336 3300046459 Bacteria 3160
381 Ga0495580_0366312 3300046472 Bacteria 975
382 Ga0495582_0000005 3300046473 Bacteria 156170
383 Ga0495582_0043712 3300046473 Unclassified 2467
384 Ga0495582_0273839 3300046473 Bacteria 969
385 Ga0495662_0018886 3300046476 Bacteria 3336
386 Ga0495662_0019194 3300046476 Bacteria 3307
387 Ga0495584_0214208 3300046491 Bacteria 979
388 Ga0495594_0063214 3300046499 Bacteria 2051
389 Ga0495618_0154685 3300046514 Bacteria 1464
390 Ga0495628_0155519 3300046516 Bacteria 1740
391 Ga0495630_0000714 3300046517 Bacteria 23478
392 Ga0495644_0125804 3300046523 Unclassified 976
393 Ga0495665_0093993 3300046531 Unclassified 1575
394 Ga0495665_0242221 3300046531 Bacteria 929
395 Ga0495634_0092897 3300046642 Bacteria 1957
396 Ga0495657_0094566 3300046675 Bacteria 1911
397 Ga0495647_0000508 3300046681 Bacteria 11338
398 Ga0495658_0000113 3300046683 Bacteria 42967
399 Ga0495658_0228242 3300046683 Bacteria 1167
400 Ga0495658_0400119 3300046683 Unclassified 875
401 Ga0495613_0290313 3300046689 Bacteria 1134
402 Ga0495624_0052088 3300046690 Bacteria 2588
403 Ga0495624_0132199 3300046690 Bacteria 1530
404 Ga0495649_0204458 3300046694 Bacteria 1025
405 Ga0495589_0122452 3300046794 Bacteria 1252
406 Ga0495600_0333778 3300046809 Bacteria 952
407 Ga0495581_0017627 3300047315 Bacteria 4148
408 Ga0495581_0209742 3300047315 Bacteria 1139
409 Ga0495674_0469819 3300047319 Unclassified 1009
410 Ga0495676_0024351 3300047321 Bacteria 5242
411 Ga0495684_0250686 3300047471 Unclassified 1288
412 Ga0495593_0025081 3300047673 Bacteria 3299
413 Ga0496100_0035726 3300048903 Bacteria 3128
414 Ga0496100_0591828 3300048903 Bacteria 861
415 Ga0496101_0052319 3300048904 Bacteria 2944
416 Ga0496101_0590810 3300048904 Bacteria 878
417 Ga0496102_0000002 3300048905 Bacteria 814588
418 Ga0496102_0123192 3300048905 Bacteria 2422
419 Ga0496102_0198585 3300048905 Bacteria 1890
420 Ga0496102_0304890 3300048905 Bacteria 1501
421 Ga0496102_0579638 3300048905 Bacteria 1045
422 Ga0496102_0836934 3300048905 Bacteria 842
423 Ga0496103_0000303 3300048906 Bacteria 45367
424 Ga0496103_0044951 3300048906 Bacteria 2723
425 Ga0496103_0118066 3300048906 Bacteria 1689
426 Ga0496103_0130933 3300048906 Bacteria 1602
427 Ga0496103_0236882 3300048906 Bacteria 1174
428 Ga0496103_0285532 3300048906 Unclassified 1061
429 Ga0496104_0116821 3300048907 Bacteria 2560
430 Ga0496104_0124768 3300048907 Bacteria 2472
431 Ga0496104_0216309 3300048907 Bacteria 1828
432 Ga0496104_0283475 3300048907 Bacteria 1569
433 Ga0496105_0020582 3300048908 Bacteria 5332
434 Ga0496105_0158237 3300048908 Bacteria 1860
435 Ga0496105_0297730 3300048908 Unclassified 1297
436 Ga0496106_0043611 3300048909 Bacteria 3365
437 Ga0496106_0135870 3300048909 Bacteria 1931
438 Ga0496106_0143932 3300048909 Bacteria 1876
439 Ga0496107_0000477 3300048910 Bacteria 22008
440 Ga0496107_0073103 3300048910 Bacteria 2494
441 Ga0496107_0181365 3300048910 Bacteria 1563
442 Ga0496107_0304308 3300048910 Bacteria 1187
443 Ga0496107_0827938 3300048910 Unclassified 677
444 Ga0496108_0005422 3300048911 Bacteria 10311
445 Ga0496108_0087362 3300048911 Bacteria 2648
446 Ga0496109_0001398 3300048912 Bacteria 19996
447 Ga0496109_0041219 3300048912 Bacteria 4183
448 Ga0496109_0043516 3300048912 Bacteria 4070
449 Ga0496109_0049636 3300048912 Bacteria 3821
450 Ga0496109_0195495 3300048912 Bacteria 1901
451 Ga0496109_0205078 3300048912 Bacteria 1854
452 Ga0496109_0487428 3300048912 Bacteria 1164
453 Ga0496109_0837475 3300048912 Bacteria 858
454 Ga0496109_1179516 3300048912 Bacteria 702
455 Ga0496110_0121178 3300048913 Bacteria 2356
456 Ga0496110_0628944 3300048913 Unclassified 972
457 Ga0496111_0031621 3300048914 Bacteria 3771
458 Ga0496111_0115398 3300048914 Bacteria 1980
459 Ga0496111_0281458 3300048914 Bacteria 1233
460 Ga0496111_0512374 3300048914 Bacteria 882
461 Ga0496112_0000006 3300048915 Bacteria 365227
462 Ga0496112_0012948 3300048915 Bacteria 7686
463 Ga0496112_0039401 3300048915 Bacteria 4618
464 Ga0496112_0256962 3300048915 Bacteria 1697
465 Ga0496112_0277332 3300048915 Bacteria 1624
466 Ga0496112_0306842 3300048915 Bacteria 1532
467 Ga0496113_0081553 3300048916 Bacteria 2480
468 Ga0496113_0112738 3300048916 Bacteria 2119
469 Ga0496113_0189580 3300048916 Bacteria 1632
470 Ga0496113_0391427 3300048916 Bacteria 1116
471 Ga0496113_0624417 3300048916 Bacteria 862
472 Ga0496114_0065285 3300048917 Bacteria 3049
473 Ga0496115_0020020 3300048918 Bacteria 5155
474 Ga0496115_0064841 3300048918 Bacteria 2950
475 Ga0496115_0160527 3300048918 Bacteria 1857
476 Ga0496115_0165139 3300048918 Bacteria 1831
477 Ga0496115_0656496 3300048918 Bacteria 828
478 Ga0501040_0142961 3300049576 Bacteria 1686
479 Ga0501040_0215969 3300049576 Bacteria 1364
480 Ga0501071_0293394 3300049587 Bacteria 1232
481 Ga0501072_0283007 3300049588 Bacteria 1319
482 Ga0501075_0029672 3300049591 Bacteria 4046
483 Ga0501079_0292549 3300049741 Bacteria 1274
484 Ga0501035_0336333 3300049822 Bacteria 1266
485 Ga0501045_0089797 3300049824 Bacteria 2270
486 nmdc:mga03n38_9286_c1 3300050490 Bacteria 3569
487 nmdc:mga00v17_102207_c1 3300050491 Bacteria 1810
488 nmdc:mga00v17_487919_c1 3300050491 Bacteria 799
489 nmdc:mga06z11_59879_c1 3300050494 Bacteria 1980
490 nmdc:mga07m45_26889_c1 3300050496 Bacteria 3165
491 nmdc:mga0qj67_109128_c1 3300050509 Bacteria 2233
492 nmdc:mga0qj67_132637_c1 3300050509 Bacteria 2018
493 nmdc:mga0sz30_7816_c1 3300050516 Bacteria 4021
494 Ga0495601_0020405 3300053077 Bacteria 4047
495 Ga0495612_0199804 3300053078 Bacteria 882
496 Ga0495619_0000514 3300053085 Bacteria 25758
497 Ga0495619_0158040 3300053085 Bacteria 1565
498 Ga0587111_0061293 3300060346 Unclassified 856
499 Ga0501082_1135588 3300060353 Bacteria 683
500 Ga0466962_0028225 3300061719 Bacteria 2689
501 Ga0530510_0172794 3300061734 Unclassified 1601
502 Ga0530510_0456926 3300061734 Bacteria 966
503 Ga0307409_100074431
504 JGI24739J22299_10062257
505 JGI24748J21848_1010766
506 JGI24744J21845_10001125
507 JGI24744J21845_10008669
508 Ga0058861_11366977
509 Ga0058862_12535896
510 Ga0070676_10008299
511 Ga0070683_100166614
512 Ga0070690_100698108
513 Ga0068869_100195951
514 Ga0070680_100008354
515 Ga0070680_100266181
516 Ga0070682_100068429
517 Ga0068868_100000794
518 Ga0068868_100024695
519 Ga0070660_100007781
520 Ga0070660_100229701
521 Ga0070689_100076051
522 Ga0070689_100323243
523 Ga0070691_10008971
524 Ga0070692_10212509
525 Ga0070668_100009613
526 Ga0070668_100341756
527 Ga0070669_100010699
528 Ga0070669_100536792
529 Ga0070675_100469173
530 Ga0070675_100780815
531 Ga0070674_100016486
532 Ga0070674_100285679
533 Ga0070674_100456630
534 Ga0070674_100488202
535 Ga0070673_100188720
536 Ga0070688_100031904
537 Ga0070667_100032605
538 Ga0070667_100036675
539 Ga0070709_10000516
540 Ga0070709_10094992
541 Ga0070714_100402508
542 Ga0070714_101165002
543 Ga0070713_100000308
544 Ga0070713_100021283
545 Ga0070710_10251973
546 Ga0070711_100410730
547 Ga0070711_100640039
548 Ga0070705_100062850
549 Ga0070705_100561087
550 Ga0070700_100015592
551 Ga0070700_100142012
552 Ga0070700_100219283
553 Ga0070700_100894225
554 Ga0070694_100067953
555 Ga0070663_100002609
556 Ga0070663_100003303
557 Ga0070663_100149202
558 Ga0070663_100156836
559 Ga0070678_100010714
560 Ga0070678_100043159
561 Ga0070662_100106361
562 Ga0070662_100276952
563 Ga0070681_10146504
564 Ga0068867_100000281
565 Ga0068867_100006126
566 Ga0068867_100341092
567 Ga0070685_10060233
568 Ga0070707_100118746
569 Ga0070679_100002961
570 Ga0070679_100007879
571 Ga0070679_100333699
572 Ga0070684_100155067
573 Ga0070684_100799147
574 Ga0068853_100569011
575 Ga0070672_100089534
576 Ga0070672_100193987
577 Ga0070686_100235978
578 Ga0070686_100502553
579 Ga0070695_100000347
580 Ga0070695_100075025
581 Ga0070695_100131897
582 Ga0070695_100449691
583 Ga0070695_100478162
584 Ga0070696_100054908
585 Ga0070665_100013749
586 Ga0070665_100020362
587 Ga0070704_100006582
588 Ga0070704_100099617
589 Ga0068855_100743209
590 Ga0070664_100053798
591 Ga0070664_100259748
592 Ga0068854_100028182
593 Ga0068854_100150149
594 Ga0068854_100203700
595 Ga0068854_100311079
596 Ga0070702_100006826
597 Ga0070702_100120490
598 Ga0070702_100460976
599 Ga0068852_100010322
600 Ga0068852_100562058
601 Ga0068859_100085634
602 Ga0068859_100109369
603 Ga0068864_100113812
604 Ga0068864_100766889
605 Ga0068866_10007817
606 Ga0068866_10046836
607 Ga0068866_10077955
608 Ga0068861_100017327
609 Ga0068861_100086706
610 Ga0068861_100634791
611 Ga0068851_10065322
612 Ga0068863_100051857
613 Ga0068858_100024129
614 Ga0068858_100045074
615 Ga0068858_100352798
616 Ga0068858_100482326
617 Ga0068858_101370404
618 Ga0068860_100218045
619 Ga0068860_100247892
620 Ga0068862_100031740
621 Ga0068862_100055454
622 Ga0068862_100105452
623 Ga0068862_100573801
624 Ga0081455_10132800
625 Ga0081538_10112858
626 Ga0081538_10119210
627 Ga0081539_10000952
628 Ga0070717_10044014
629 Ga0070717_10140207
630 Ga0075365_10001091
631 Ga0075363_100010965
632 Ga0075363_100023178
633 Ga0075364_10007111
634 Ga0075364_10017196
635 Ga0075364_10027794
636 Ga0075364_10150941
637 Ga0070715_10000001
638 Ga0070715_10002164
639 Ga0070716_100086654
640 Ga0070716_100511110
641 Ga0070712_100016254
642 Ga0070712_100027964
643 Ga0070712_100052058
644 Ga0070712_100256746
645 Ga0070712_100780552
646 Ga0070712_100881545
647 Ga0075362_10036714
648 Ga0075367_10025118
649 Ga0075367_10075429
650 Ga0075369_10003323
651 Ga0075369_10012827
652 Ga0097621_100095974
653 Ga0068871_100018234
654 Ga0075430_100157527
655 Ga0075430_100271518
656 Ga0075434_100613079
657 Ga0068865_100012907
658 Ga0068865_100064632
659 Ga0068865_100109481
660 Ga0068865_100203726
661 Ga0097620_100085630
662 Ga0097620_100109366
663 Ga0099795_10002359
664 Ga0105240_10973447
665 Ga0111539_10051303
666 Ga0105245_10011408
667 Ga0105245_10062303
668 Ga0105245_10200114
669 Ga0105245_10232447
670 Ga0105245_10737577
671 Ga0105245_10793951
672 Ga0105245_11165805
673 Ga0105247_10106070
674 Ga0105247_10252708
675 Ga0105247_10368012
676 Ga0105243_10059413
677 Ga0105243_10117997
678 Ga0105243_10236779
679 Ga0105241_10010593
680 Ga0105242_10038018
681 Ga0105242_10896789
682 Ga0105248_10282576
683 Ga0105248_10410171
684 Ga0105248_10852762
685 Ga0105237_10049878
686 Ga0105237_10163103
687 Ga0105238_10194650
688 Ga0105249_10085738
689 Ga0105249_10187247
690 Ga0105249_10225636
691 Ga0105249_10531935
692 Ga0105239_10166507
693 Ga0105239_10409858
694 Ga0105246_10470617
695 Ga0157373_10197698
696 Ga0157371_10577631
697 Ga0157369_10442094
698 Ga0157374_10554272
699 Ga0157378_10152038
700 Ga0163162_10021515
701 Ga0163162_10129812
702 Ga0163162_10214782
703 Ga0163162_10356639
704 Ga0163162_10663015
705 Ga0157372_10055190
706 Ga0157372_10345938
707 Ga0157375_10018778
708 Ga0157375_10111182
709 Ga0157375_10208178
710 Ga0163163_10443572
711 Ga0163163_10612570
712 Ga0157380_10044062
713 Ga0182008_10060429
714 Ga0157377_10021442
715 Ga0157379_10151061
716 Ga0157379_10533363
717 Ga0157376_10001068
718 Ga0157376_10052693
719 Ga0157376_10704437
720 Ga0182005_1032652
721 Ga0163161_10032562
722 Ga0163161_10220531
723 Ga0206356_10348829
724 Ga0224712_10424847
725 Ga0207656_10062251
726 Ga0207642_10034981
727 Ga0207710_10008702
728 Ga0207688_10001000
729 Ga0207688_10038639
730 Ga0207688_10045316
731 Ga0207688_10139221
732 Ga0207647_10023589
733 Ga0207647_10161273
734 Ga0207685_10000036
735 Ga0207685_10205831
736 Ga0207699_10000024
737 Ga0207699_10841079
738 Ga0207645_10178883
739 Ga0207705_10182346
740 Ga0207705_10541903
741 Ga0207707_10158584
742 Ga0207695_10042804
743 Ga0207695_10686942
744 Ga0207693_10041694
745 Ga0207693_10295829
746 Ga0207693_10296446
747 Ga0207693_10424665
748 Ga0207663_10088640
749 Ga0207663_10175442
750 Ga0207657_10075511
751 Ga0207657_10398960
752 Ga0207657_10457645
753 Ga0207649_10297756
754 Ga0207652_10005866
755 Ga0207652_10026772
756 Ga0207652_10080143
757 Ga0207652_10900085
758 Ga0207646_10034257
759 Ga0207681_10134862
760 Ga0207681_10156300
761 Ga0207694_10123487
762 Ga0207694_10453177
763 Ga0207659_10036992
764 Ga0207659_10332958
765 Ga0207659_10405353
766 Ga0207687_10014170
767 Ga0207687_10019951
768 Ga0207700_10594742
769 Ga0207664_10186346
770 Ga0207664_10246599
771 Ga0207644_10391684
772 Ga0207690_10097647
773 Ga0207690_10227178
774 Ga0207706_10108669
775 Ga0207706_10291619
776 Ga0207686_10039493
777 Ga0207709_10143234
778 Ga0207709_10143322
779 Ga0207670_10027300
780 Ga0207669_10000932
781 Ga0207669_10331861
782 Ga0207704_10028414
783 Ga0207704_10068849
784 Ga0207704_10446025
785 Ga0207665_10699744
786 Ga0207691_10068716
787 Ga0207691_10703760
788 Ga0207689_10164551
789 Ga0207661_10052805
790 Ga0207661_10193006
791 Ga0207661_10241447
792 Ga0207661_10605381
793 Ga0207661_11130022
794 Ga0207679_10067793
795 Ga0207667_10614744
796 Ga0207651_10025914
797 Ga0207712_10520106
798 Ga0207668_10018189
799 Ga0207668_10096401
800 Ga0207640_10017936
801 Ga0207640_10285322
802 Ga0207640_10554050
803 Ga0207658_10010397
804 Ga0207658_10224831
805 Ga0207677_10005609
806 Ga0207677_10150120
807 Ga0207677_10435902
808 Ga0207677_10456172
809 Ga0207703_10448456
810 Ga0207703_11149201
811 Ga0207639_10060588
812 Ga0207678_10007104
813 Ga0207678_10007749
814 Ga0207678_10014607
815 Ga0207708_10021432
816 Ga0207708_10124586
817 Ga0207708_10256464
818 Ga0207708_10283668
819 Ga0207702_10033885
820 Ga0207648_10000872
821 Ga0207648_10018677
822 Ga0207648_10035576
823 Ga0207676_10659813
824 Ga0207676_10984753
825 Ga0207675_100006109
826 Ga0207675_100020245
827 Ga0207675_100126376
828 Ga0207683_10018563
829 Ga0207683_10305034
830 Ga0207683_10373374
831 Ga0207683_10502106
832 Ga0207683_10619261
833 Ga0207698_10033449
834 Ga0268266_10391802
835 Ga0268266_10400832
836 Ga0268265_10228934
837 Ga0268265_10274300
838 Ga0268264_10034191
839 Ga0268264_10058330
840 Ga0265338_10036185
841 Ga0265330_10076651
842 Ga0265325_10052975
843 Ga0265339_10030781
844 Ga0307408_100271583
845 Ga0265313_10053841
846 Ga0265314_10054126
847 Ga0307405_10023076
848 Ga0307413_10655576
849 Ga0307410_10065094
850 Ga0307410_10774170
851 Ga0307406_10679964
852 Ga0307407_10660592
853 Ga0307409_100641834
854 Ga0307416_100032735
855 Ga0307416_100396075
856 Ga0307416_100523258
857 Ga0373931_0308496
858 Ga0373947_0221520
859 Ga0395898_0597894
860 Ga0395898_0898544
861 Ga0395905_0908855
862 Ga0395901_0253766
863 Ga0395901_0858917
864 Ga0242420_023853
865 Ga0439465_0003270
866 Ga0466961_0030111
867 Ga0466961_0073522
868 Ga0466961_0125325
869 Ga0466963_0040024
870 Ga0466963_0199568
871 Ga0466964_0059692
872 Ga0466968_0040362
873 Ga0466957_0025666
874 Ga0466957_0029798
875 Ga0466959_0009920
876 Ga0466959_0138494
877 Ga0466959_0256462
878 Ga0466958_0003776
879 Ga0466958_0043272
880 Ga0466967_0228555
881 Ga0495603_0000354
882 Ga0495629_0043336
883 Ga0495580_0366312
884 Ga0495582_0000005
885 Ga0495582_0043712
886 Ga0495582_0273839
887 Ga0495662_0018886
888 Ga0495662_0019194
889 Ga0495584_0214208
890 Ga0495594_0063214
891 Ga0495618_0154685
892 Ga0495628_0155519
893 Ga0495630_0000714
894 Ga0495644_0125804
895 Ga0495665_0093993
896 Ga0495665_0242221
897 Ga0495634_0092897
898 Ga0495657_0094566
899 Ga0495647_0000508
900 Ga0495658_0000113
901 Ga0495658_0228242
902 Ga0495658_0400119
903 Ga0495613_0290313
904 Ga0495624_0052088
905 Ga0495624_0132199
906 Ga0495649_0204458
907 Ga0495589_0122452
908 Ga0495600_0333778
909 Ga0495581_0017627
910 Ga0495581_0209742
911 Ga0495674_0469819
912 Ga0495676_0024351
913 Ga0495684_0250686
914 Ga0495593_0025081
915 Ga0496100_0035726
916 Ga0496100_0591828
917 Ga0496101_0052319
918 Ga0496101_0590810
919 Ga0496102_0000002
920 Ga0496102_0123192
921 Ga0496102_0198585
922 Ga0496102_0304890
923 Ga0496102_0579638
924 Ga0496102_0836934
925 Ga0496103_0000303
926 Ga0496103_0044951
927 Ga0496103_0118066
928 Ga0496103_0130933
929 Ga0496103_0236882
930 Ga0496103_0285532
931 Ga0496104_0116821
932 Ga0496104_0124768
933 Ga0496104_0216309
934 Ga0496104_0283475
935 Ga0496105_0020582
936 Ga0496105_0158237
937 Ga0496105_0297730
938 Ga0496106_0043611
939 Ga0496106_0135870
940 Ga0496106_0143932
941 Ga0496107_0000477
942 Ga0496107_0073103
943 Ga0496107_0181365
944 Ga0496107_0304308
945 Ga0496107_0827938
946 Ga0496108_0005422
947 Ga0496108_0087362
948 Ga0496109_0001398
949 Ga0496109_0041219
950 Ga0496109_0043516
951 Ga0496109_0049636
952 Ga0496109_0195495
953 Ga0496109_0205078
954 Ga0496109_0487428
955 Ga0496109_0837475
956 Ga0496109_1179516
957 Ga0496110_0121178
958 Ga0496110_0628944
959 Ga0496111_0031621
960 Ga0496111_0115398
961 Ga0496111_0281458
962 Ga0496111_0512374
963 Ga0496112_0000006
964 Ga0496112_0012948
965 Ga0496112_0039401
966 Ga0496112_0256962
967 Ga0496112_0277332
968 Ga0496112_0306842
969 Ga0496113_0081553
970 Ga0496113_0112738
971 Ga0496113_0189580
972 Ga0496113_0391427
973 Ga0496113_0624417
974 Ga0496114_0065285
975 Ga0496115_0020020
976 Ga0496115_0064841
977 Ga0496115_0160527
978 Ga0496115_0165139
979 Ga0496115_0656496
980 Ga0501040_0142961
981 Ga0501040_0215969
982 Ga0501071_0293394
983 Ga0501072_0283007
984 Ga0501075_0029672
985 Ga0501079_0292549
986 Ga0501035_0336333
987 Ga0501045_0089797
988 nmdc:mga03n38_9286_c1
989 nmdc:mga00v17_102207_c1
990 nmdc:mga00v17_487919_c1
991 nmdc:mga06z11_59879_c1
992 nmdc:mga07m45_26889_c1
993 nmdc:mga0qj67_109128_c1
994 nmdc:mga0qj67_132637_c1
995 nmdc:mga0sz30_7816_c1
996 Ga0495601_0020405
997 Ga0495612_0199804
998 Ga0495619_0000514
999 Ga0495619_0158040
1000 Ga0587111_0061293
1001 Ga0501082_1135588
1002 Ga0466962_0028225
1003 Ga0530510_0172794
1004 Ga0530510_0456926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07040

DUF1326

Protein of unknown function (DUF1326)

9

177

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ejg-assembly1.cif.gz_A structure of lineage vii lassa virus glycoprotein complex (strain togo/2016/7082) 0.5705 116 148
7tyv-assembly1.cif.gz_A structure of lassa virus glycoprotein (josiah) bound to fab 25.10c 0.5671 116 148
7uov-assembly1.cif.gz_C native lassa glycoprotein in complex with neutralizing antibodies 12.1f and 37.2d 0.5657 116 148
6s2f-assembly1.cif.gz_D cryo-em structure of ctf18-1-8 in complex with the catalytic domain of dna polymerase epsilon (class 2) 0.5653 118 147
8eji-assembly1.cif.gz_C lassa virus glycoprotein complex (josiah) bound to 19.7e fab 0.5547 116 148
ID Description Score Start End Superfamily
af_I1MXP2_359_414_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.6185 116 146 2.60.40.1180
af_Q8LFG1_359_413_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.6146 116 147 2.60.40.1180
af_A0A0R0KQM5_20_151_3.15.10.20 Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 1;Activator of Hsp90 ATPase Aha1, N-terminal domain 0.563 33 91 3.15.10.20
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.5326 72 115 3.30.300.20
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.5181 72 115 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A6N7Z7Q6-F1-model_v4 DUF1326 domain-containing protein 0.9888 1 198
AF-A0A6N7Z7Q6-F1-model_v4 DUF1326 domain-containing protein 0.9839 1 198
AF-A0A852R180-F1-model_v4 deleted 0.9827 1 198
AF-A0A852R180-F1-model_v4 deleted 0.9778 1 198
AF-A0A6B1PBZ5-F1-model_v4 deleted 0.9761 1 130

Map