F455707

General Info

Members Datasets Scaffolds Average Seq Length
501 244 501 257

Family's Representative Sequence

Representative Sequence 3300028577|Ga0265318_10079779|Ga0265318_100797791
Length 285
Sequence VKSRIKDRPPVTRYLWKVKCMKTARILVLVVAVGAGGLAAFLASRTEKAAPVAAPVAVDSVDVLVAAGDIGIGQAMGSADVKWQAWPASAANSNFIRRNDKPDAVNELTGSIVRTPFVAGEPIREAKLIKSNGSGFMAAILPAGMRAISTEISAETGAGGFILPNDRVDVILSRRDKEAEKAAGVDVLTSEIILANVRVLAIDQTVQEKDGQRVVVGKTATLELSPRQSETLALSRQLGTLTLALRSIADANAPTAEVPTEGRTSGRRGSINMVRFGVTTTTTPK

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
147 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
167 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
168 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
236 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
237 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
238 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
239 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
240 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
241 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.59
Nodule 0
Rhizoplane 6.59
Rhizosphere 89.22
Stem 0
Stem Tuber 0
Unclassified 1.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10009650 3300003203 Bacteria 4316
2 rootH1_10219390 3300003323 Bacteria 1418
3 rootH1_10388944 3300003323 Bacteria 1698
4 Ga0058862_10092226 3300004803 Bacteria 1498
5 Ga0070658_10050571 3300005327 Bacteria 3369
6 Ga0070658_10275937 3300005327 Bacteria 1430
7 Ga0070683_100005616 3300005329 Bacteria 10482
8 Ga0070683_100023299 3300005329 Bacteria 5538
9 Ga0070670_100340157 3300005331 Bacteria 1317
10 Ga0070666_10018342 3300005335 Bacteria 4498
11 Ga0070680_100008640 3300005336 Bacteria 7807
12 Ga0070680_100097139 3300005336 Bacteria 2442
13 Ga0070682_100001892 3300005337 Bacteria 11687
14 Ga0070682_100105945 3300005337 Bacteria 1865
15 Ga0068868_100054852 3300005338 Bacteria 3143
16 Ga0070660_100098124 3300005339 Bacteria 2318
17 Ga0070689_100023388 3300005340 Bacteria 4625
18 Ga0070661_100091159 3300005344 Bacteria 2257
19 Ga0070675_100486630 3300005354 Bacteria 1110
20 Ga0070671_100010055 3300005355 Bacteria 7600
21 Ga0070671_100202316 3300005355 Bacteria 1684
22 Ga0070674_100093561 3300005356 Bacteria 2175
23 Ga0070674_100337758 3300005356 Bacteria 1212
24 Ga0070659_100020658 3300005366 Bacteria 5006
25 Ga0070659_100101442 3300005366 Bacteria 2317
26 Ga0070667_100072840 3300005367 Bacteria 2928
27 Ga0070667_100628162 3300005367 Bacteria 991
28 Ga0070709_10002216 3300005434 Bacteria 10530
29 Ga0070709_10034894 3300005434 Bacteria 3054
30 Ga0070709_10247074 3300005434 Bacteria 1284
31 Ga0070714_100060248 3300005435 Bacteria 3257
32 Ga0070714_100204935 3300005435 Bacteria 1806
33 Ga0070713_100347323 3300005436 Bacteria 1376
34 Ga0070713_100405452 3300005436 Bacteria 1274
35 Ga0070710_10002966 3300005437 Bacteria 8056
36 Ga0070710_10012893 3300005437 Bacteria 4165
37 Ga0070711_100012216 3300005439 Bacteria 5360
38 Ga0070711_100014753 3300005439 Bacteria 4932
39 Ga0070663_100130629 3300005455 Bacteria 1907
40 Ga0070663_100234868 3300005455 Bacteria 1445
41 Ga0070678_100005437 3300005456 Bacteria 7363
42 Ga0070681_10031178 3300005458 Bacteria 5351
43 Ga0070685_10064602 3300005466 Bacteria 2152
44 Ga0070706_100212968 3300005467 Bacteria 1804
45 Ga0070698_100098581 3300005471 Bacteria 2896
46 Ga0070679_100029146 3300005530 Bacteria 5444
47 Ga0070679_100098686 3300005530 Bacteria 2908
48 Ga0070684_100023098 3300005535 Bacteria 5194
49 Ga0070684_100132872 3300005535 Bacteria 2246
50 Ga0070697_100008013 3300005536 Bacteria 8237
51 Ga0068853_100001190 3300005539 Bacteria 18532
52 Ga0068853_100030148 3300005539 Bacteria 4580
53 Ga0070686_100039915 3300005544 Bacteria 2927
54 Ga0070695_100105139 3300005545 Unclassified 1907
55 Ga0070695_100164983 3300005545 Bacteria 1558
56 Ga0070696_100076526 3300005546 Bacteria 2363
57 Ga0070693_100006178 3300005547 Bacteria 5804
58 Ga0070693_100026376 3300005547 Bacteria 3137
59 Ga0070665_100007463 3300005548 Bacteria 11122
60 Ga0070665_100073305 3300005548 Bacteria 3430
61 Ga0070704_100002993 3300005549 Bacteria 9608
62 Ga0068855_100042130 3300005563 Bacteria 5410
63 Ga0068855_100060367 3300005563 Bacteria 4434
64 Ga0068857_100046580 3300005577 Bacteria 3848
65 Ga0068856_100125718 3300005614 Bacteria 2567
66 Ga0068856_100145132 3300005614 Bacteria 2381
67 Ga0068852_100291351 3300005616 Bacteria 1577
68 Ga0068859_100066757 3300005617 Bacteria 3632
69 Ga0068864_100033860 3300005618 Bacteria 4343
70 Ga0068864_100045542 3300005618 Bacteria 3763
71 Ga0068866_10014101 3300005718 Bacteria 3521
72 Ga0068851_10085510 3300005834 Bacteria 1653
73 Ga0068863_100081782 3300005841 Bacteria 3060
74 Ga0068858_100010777 3300005842 Bacteria 8644
75 Ga0068860_100090476 3300005843 Bacteria 2915
76 Ga0081455_10001271 3300005937 Bacteria 31492
77 Ga0081455_10005762 3300005937 Bacteria 13507
78 Ga0081455_10010795 3300005937 Bacteria 9232
79 Ga0081455_10149224 3300005937 Bacteria 1804
80 Ga0081540_1016374 3300005983 Bacteria 4642
81 Ga0081539_10001975 3300005985 Bacteria 31233
82 Ga0070717_10078841 3300006028 Bacteria 2761
83 Ga0070717_10144335 3300006028 Bacteria 2055
84 Ga0075368_10003840 3300006042 Bacteria 5053
85 Ga0075364_10092012 3300006051 Bacteria 2013
86 Ga0070715_10001099 3300006163 Bacteria 7676
87 Ga0070715_10006767 3300006163 Bacteria 3912
88 Ga0070716_100002384 3300006173 Bacteria 8648
89 Ga0070716_100092520 3300006173 Bacteria 1833
90 Ga0070716_100288980 3300006173 Bacteria 1135
91 Ga0070716_100326841 3300006173 Bacteria 1077
92 Ga0070712_100029042 3300006175 Bacteria 3705
93 Ga0070712_100067083 3300006175 Bacteria 2553
94 Ga0075367_10004365 3300006178 Bacteria 6896
95 Ga0075367_10147743 3300006178 Bacteria 1458
96 Ga0097621_100065650 3300006237 Bacteria 2987
97 Ga0068871_100042552 3300006358 Bacteria 3647
98 Ga0075428_100368856 3300006844 Bacteria 1540
99 Ga0075430_100000092 3300006846 Bacteria 52226
100 Ga0075430_100000094 3300006846 Bacteria 52204
101 Ga0075431_100019949 3300006847 Bacteria 6846
102 Ga0075433_10000311 3300006852 Bacteria 29567
103 Ga0075433_10032305 3300006852 Bacteria 4483
104 Ga0075433_10039718 3300006852 Bacteria 4071
105 Ga0075434_100000299 3300006871 Bacteria 35320
106 Ga0075434_100010423 3300006871 Bacteria 8711
107 Ga0075434_100035984 3300006871 Bacteria 4896
108 Ga0075434_100401409 3300006871 Bacteria 1392
109 Ga0075429_100013958 3300006880 Bacteria 6963
110 Ga0068865_100005241 3300006881 Bacteria 7838
111 Ga0075436_100008217 3300006914 Bacteria 7141
112 Ga0097620_100066761 3300006931 Bacteria 3632
113 Ga0075435_100004453 3300007076 Bacteria 9627
114 Ga0075435_100017872 3300007076 Bacteria 5375
115 Ga0075435_100025576 3300007076 Bacteria 4596
116 Ga0105240_10004694 3300009093 Bacteria 20654
117 Ga0105240_10671442 3300009093 Bacteria 1134
118 Ga0111539_10006361 3300009094 Bacteria 15230
119 Ga0111539_10037235 3300009094 Bacteria 5877
120 Ga0105245_10004710 3300009098 Bacteria 12058
121 Ga0105245_10056561 3300009098 Bacteria 3526
122 Ga0105247_10007722 3300009101 Bacteria 6583
123 Ga0114129_10001218 3300009147 Bacteria 34180
124 Ga0114129_10374300 3300009147 Bacteria 1882
125 Ga0114129_10772887 3300009147 Bacteria 1228
126 Ga0105243_10129559 3300009148 Bacteria 2138
127 Ga0105243_10314371 3300009148 Bacteria 1425
128 Ga0105241_10018120 3300009174 Bacteria 5178
129 Ga0105241_10466318 3300009174 Bacteria 1120
130 Ga0105242_10011410 3300009176 Bacteria 6830
131 Ga0105248_10033380 3300009177 Bacteria 5749
132 Ga0105248_10216277 3300009177 Bacteria 2158
133 Ga0105237_10048491 3300009545 Bacteria 4270
134 Ga0105237_10598246 3300009545 Bacteria 1110
135 Ga0105238_10007397 3300009551 Bacteria 11003
136 Ga0105249_10001043 3300009553 Bacteria 24498
137 Ga0105239_10018859 3300010375 Bacteria 7622
138 Ga0105239_10533323 3300010375 Bacteria 1336
139 Ga0157373_10007935 3300013100 Bacteria 7896
140 Ga0157370_10011023 3300013104 Bacteria 9483
141 Ga0157370_10040186 3300013104 Bacteria 4517
142 Ga0157370_10190594 3300013104 Bacteria 1903
143 Ga0157369_10072277 3300013105 Bacteria 3702
144 Ga0157374_10008513 3300013296 Bacteria 8775
145 Ga0157374_10014838 3300013296 Bacteria 6826
146 Ga0157378_10005396 3300013297 Bacteria 11209
147 Ga0163162_10009085 3300013306 Bacteria 9663
148 Ga0163162_10041191 3300013306 Bacteria 4621
149 Ga0157372_10003695 3300013307 Bacteria 16439
150 Ga0157372_10033678 3300013307 Bacteria 5629
151 Ga0157372_11087156 3300013307 Bacteria 925
152 Ga0157375_10012326 3300013308 Bacteria 7581
153 Ga0163163_10024935 3300014325 Bacteria 5695
154 Ga0157380_10132731 3300014326 Bacteria 2127
155 Ga0157379_10022392 3300014968 Bacteria 5597
156 Ga0157376_10008597 3300014969 Bacteria 7379
157 Ga0157376_10050040 3300014969 Plasmid 3465
158 Ga0213876_10019526 3300021384 Bacteria 3581
159 Ga0207692_10029960 3300025898 Bacteria 2591
160 Ga0207692_10121824 3300025898 Bacteria 1461
161 Ga0207710_10013101 3300025900 Bacteria 3492
162 Ga0207710_10105241 3300025900 Bacteria 1335
163 Ga0207680_10018562 3300025903 Bacteria 3701
164 Ga0207685_10000612 3300025905 Bacteria 6253
165 Ga0207685_10086864 3300025905 Bacteria 1308
166 Ga0207699_10002176 3300025906 Bacteria 9251
167 Ga0207699_10032151 3300025906 Bacteria 2954
168 Ga0207699_10218829 3300025906 Bacteria 1299
169 Ga0207705_10046081 3300025909 Bacteria 3133
170 Ga0207705_10304081 3300025909 Bacteria 1223
171 Ga0207684_10470476 3300025910 Bacteria 1078
172 Ga0207654_10021443 3300025911 Bacteria 3435
173 Ga0207707_10000706 3300025912 Bacteria 33199
174 Ga0207707_10004382 3300025912 Bacteria 12467
175 Ga0207707_10359887 3300025912 Bacteria 1253
176 Ga0207695_10217715 3300025913 Bacteria 1818
177 Ga0207671_10019453 3300025914 Bacteria 5190
178 Ga0207693_10080542 3300025915 Bacteria 2549
179 Ga0207693_10123294 3300025915 Bacteria 2035
180 Ga0207663_10128083 3300025916 Bacteria 1749
181 Ga0207660_10009266 3300025917 Bacteria 6372
182 Ga0207660_10012021 3300025917 Bacteria 5655
183 Ga0207662_10008217 3300025918 Bacteria 5710
184 Ga0207657_10004672 3300025919 Bacteria 14460
185 Ga0207649_10095368 3300025920 Bacteria 1957
186 Ga0207652_10001458 3300025921 Bacteria 20929
187 Ga0207652_10013394 3300025921 Bacteria 6638
188 Ga0207652_10293243 3300025921 Bacteria 1468
189 Ga0207694_10009977 3300025924 Bacteria 7159
190 Ga0207687_10054526 3300025927 Bacteria 2797
191 Ga0207687_10057361 3300025927 Bacteria 2736
192 Ga0207687_10155396 3300025927 Bacteria 1750
193 Ga0207700_10013789 3300025928 Bacteria 5274
194 Ga0207700_10076612 3300025928 Bacteria 2596
195 Ga0207700_10346336 3300025928 Bacteria 1293
196 Ga0207664_10003797 3300025929 Bacteria 10140
197 Ga0207664_10050494 3300025929 Bacteria 3280
198 Ga0207664_10179879 3300025929 Bacteria 1815
199 Ga0207644_10020007 3300025931 Bacteria 4546
200 Ga0207644_10314205 3300025931 Bacteria 1265
201 Ga0207690_10071881 3300025932 Bacteria 2388
202 Ga0207690_10132651 3300025932 Bacteria 1825
203 Ga0207706_10008973 3300025933 Bacteria 9203
204 Ga0207686_10019892 3300025934 Bacteria 3827
205 Ga0207670_10001957 3300025936 Bacteria 10798
206 Ga0207704_10003803 3300025938 Bacteria 6871
207 Ga0207665_10008613 3300025939 Bacteria 6714
208 Ga0207665_10064225 3300025939 Bacteria 2494
209 Ga0207711_10003089 3300025941 Bacteria 14519
210 Ga0207711_10049249 3300025941 Bacteria 3607
211 Ga0207661_10015446 3300025944 Bacteria 5618
212 Ga0207661_10206191 3300025944 Bacteria 1731
213 Ga0207679_10235175 3300025945 Bacteria 1549
214 Ga0207667_10006413 3300025949 Bacteria 14251
215 Ga0207667_10080899 3300025949 Bacteria 3365
216 Ga0207712_10003000 3300025961 Bacteria 10787
217 Ga0207658_10098819 3300025986 Bacteria 2281
218 Ga0207677_10034827 3300026023 Bacteria 3264
219 Ga0207677_10623014 3300026023 Bacteria 949
220 Ga0207703_10008661 3300026035 Bacteria 8028
221 Ga0207703_10080126 3300026035 Bacteria 2719
222 Ga0207639_10005907 3300026041 Bacteria 8294
223 Ga0207639_10188458 3300026041 Bacteria 1760
224 Ga0207678_10010864 3300026067 Bacteria 8002
225 Ga0207678_10153812 3300026067 Bacteria 1964
226 Ga0207702_10154901 3300026078 Bacteria 2088
227 Ga0207702_10203198 3300026078 Bacteria 1838
228 Ga0207641_10255346 3300026088 Bacteria 1639
229 Ga0207641_10356514 3300026088 Bacteria 1395
230 Ga0207676_10034081 3300026095 Bacteria 3852
231 Ga0207676_10038275 3300026095 Bacteria 3659
232 Ga0207674_10186517 3300026116 Bacteria 2024
233 Ga0207683_10037129 3300026121 Bacteria 4243
234 Ga0207698_10361131 3300026142 Bacteria 1375
235 Ga0207428_10000075 3300027907 Bacteria 137887
236 Ga0268266_10004873 3300028379 Bacteria 12733
237 Ga0268266_10613762 3300028379 Bacteria 1045
238 Ga0265318_10079779 3300028577 Bacteria 1209
239 Ga0265332_10003996 3300031238 Bacteria 7017
240 Ga0265325_10129761 3300031241 Bacteria 1208
241 Ga0265340_10025020 3300031247 Bacteria 3027
242 Ga0265340_10076954 3300031247 Bacteria 1575
243 Ga0265339_10033612 3300031249 Bacteria 2886
244 Ga0265331_10007677 3300031250 Bacteria 6211
245 Ga0265316_10049905 3300031344 Bacteria 3294
246 Ga0265316_10214475 3300031344 Bacteria 1422
247 Ga0265313_10083465 3300031595 Bacteria 1447
248 Ga0265314_10000439 3300031711 Bacteria 55613
249 Ga0373958_0022642 3300034819 Bacteria 1176
250 Ga0373936_0013511 3300035113 Bacteria 3116
251 Ga0373931_0023031 3300035691 Bacteria 3141
252 Ga0373931_0087976 3300035691 Bacteria 1726
253 Ga0373927_0005965 3300035695 Bacteria 8343
254 Ga0373947_0097088 3300035725 Bacteria 1846
255 Ga0373925_0236489 3300037068 Bacteria 1462
256 Ga0373925_0299889 3300037068 Bacteria 1297
257 Ga0395899_0174481 3300037312 Bacteria 1512
258 Ga0395900_0747877 3300037418 Bacteria 908
259 Ga0395900_0821369 3300037418 Bacteria 856
260 Ga0395898_0009340 3300037466 Bacteria 10307
261 Ga0395901_0019445 3300038443 Bacteria 6944
262 Ga0436365_0139851 3300039437 Bacteria 5712
263 Ga0436365_0855185 3300039437 Bacteria 4515
264 Ga0436365_1010724 3300039437 Bacteria 2078
265 Ga0436365_1851746 3300039437 Bacteria 881
266 Ga0439435_0000891 3300042436 Bacteria 5139
267 Ga0439440_0001866 3300042993 Bacteria 3909
268 Ga0495590_0084602 3300046457 Unclassified 1119
269 Ga0495582_0043913 3300046473 Bacteria 2461
270 Ga0495584_0106262 3300046491 Bacteria 1419
271 Ga0495594_0100844 3300046499 Bacteria 1624
272 Ga0495586_0184318 3300046535 Bacteria 1181
273 Ga0495625_0280982 3300046660 Bacteria 1071
274 Ga0495659_0116197 3300046664 Bacteria 1049
275 Ga0495581_0058092 3300047315 Bacteria 2233
276 Ga0495673_0068128 3300047469 Bacteria 1505
277 Ga0496100_0005901 3300048903 Bacteria 6635
278 Ga0496100_0028290 3300048903 Bacteria 3456
279 Ga0496101_0004388 3300048904 Bacteria 8868
280 Ga0496101_0030995 3300048904 Bacteria 3755
281 Ga0496101_0253992 3300048904 Bacteria 1370
282 Ga0496102_0067819 3300048905 Bacteria 3272
283 Ga0496103_0002131 3300048906 Bacteria 12593
284 Ga0496103_0008761 3300048906 Bacteria 6003
285 Ga0496103_0013007 3300048906 Bacteria 4935
286 Ga0496104_0031478 3300048907 Bacteria 4934
287 Ga0496104_0052621 3300048907 Bacteria 3846
288 Ga0496105_0014702 3300048908 Bacteria 6231
289 Ga0496105_0034951 3300048908 Bacteria 4135
290 Ga0496106_0004715 3300048909 Bacteria 10098
291 Ga0496106_0008869 3300048909 Bacteria 7433
292 Ga0496106_0123416 3300048909 Bacteria 2026
293 Ga0496107_0008852 3300048910 Bacteria 6975
294 Ga0496107_0010052 3300048910 Bacteria 6564
295 Ga0496108_0003501 3300048911 Bacteria 12578
296 Ga0496108_0015288 3300048911 Bacteria 6262
297 Ga0496109_0140466 3300048912 Bacteria 2258
298 Ga0496109_0182578 3300048912 Bacteria 1971
299 Ga0496109_0499290 3300048912 Bacteria 1148
300 Ga0496110_0040609 3300048913 Bacteria 4055
301 Ga0496110_0092852 3300048913 Bacteria 2701
302 Ga0496111_0028921 3300048914 Bacteria 3930
303 Ga0496111_0034708 3300048914 Bacteria 3602
304 Ga0496112_0666842 3300048915 Bacteria 969
305 Ga0496113_0005750 3300048916 Bacteria 7771
306 Ga0496114_0003448 3300048917 Bacteria 12128
307 Ga0496114_0005405 3300048917 Bacteria 9989
308 Ga0496115_0008004 3300048918 Bacteria 7801
309 Ga0496115_0140582 3300048918 Bacteria 1992
310 Ga0496121_0000523 3300048924 Bacteria 73281
311 Ga0501031_0000511 3300049568 Bacteria 22716
312 Ga0501031_0022900 3300049568 Bacteria 4074
313 Ga0501032_0000073 3300049569 Bacteria 85584
314 Ga0501032_0009541 3300049569 Bacteria 7036
315 Ga0501032_0011247 3300049569 Bacteria 6427
316 Ga0501032_0026989 3300049569 Bacteria 3948
317 Ga0501032_0032571 3300049569 Bacteria 3572
318 Ga0501032_0067519 3300049569 Bacteria 2388
319 Ga0501032_0110989 3300049569 Bacteria 1814
320 Ga0501033_0001342 3300049570 Bacteria 21886
321 Ga0501033_0001845 3300049570 Bacteria 18448
322 Ga0501033_0011356 3300049570 Bacteria 6815
323 Ga0501033_0034916 3300049570 Bacteria 3769
324 Ga0501033_0068718 3300049570 Bacteria 2604
325 Ga0501034_0000251 3300049571 Bacteria 99406
326 Ga0501034_0013749 3300049571 Bacteria 8326
327 Ga0501034_0019316 3300049571 Bacteria 6972
328 Ga0501034_0039921 3300049571 Bacteria 4753
329 Ga0501034_0048876 3300049571 Bacteria 4268
330 Ga0501034_0244186 3300049571 Bacteria 1741
331 Ga0501034_0644163 3300049571 Bacteria 962
332 Ga0501036_0000036 3300049572 Bacteria 87244
333 Ga0501036_0019586 3300049572 Bacteria 5681
334 Ga0501036_0021080 3300049572 Bacteria 5474
335 Ga0501036_0021491 3300049572 Bacteria 5426
336 Ga0501036_0084116 3300049572 Bacteria 2690
337 Ga0501037_0000040 3300049573 Bacteria 119364
338 Ga0501037_0001189 3300049573 Bacteria 19229
339 Ga0501037_0001298 3300049573 Bacteria 18369
340 Ga0501037_0010332 3300049573 Bacteria 6849
341 Ga0501037_0011959 3300049573 Bacteria 6394
342 Ga0501037_0012130 3300049573 Bacteria 6345
343 Ga0501037_0020178 3300049573 Bacteria 4921
344 Ga0501038_0000150 3300049574 Bacteria 59508
345 Ga0501038_0004064 3300049574 Bacteria 13606
346 Ga0501038_0004684 3300049574 Bacteria 12732
347 Ga0501038_0005769 3300049574 Bacteria 11466
348 Ga0501038_0028504 3300049574 Bacteria 4961
349 Ga0501038_0047648 3300049574 Bacteria 3711
350 Ga0501039_0001837 3300049575 Bacteria 15670
351 Ga0501039_0038077 3300049575 Bacteria 3715
352 Ga0501039_0110375 3300049575 Bacteria 2150
353 Ga0501039_0128559 3300049575 Bacteria 1988
354 Ga0501041_0081902 3300049577 Bacteria 1988
355 Ga0501042_0018908 3300049578 Bacteria 4777
356 Ga0501042_0144609 3300049578 Bacteria 1714
357 Ga0501043_0000707 3300049579 Bacteria 29553
358 Ga0501043_0004843 3300049579 Bacteria 10887
359 Ga0501043_0005879 3300049579 Bacteria 9869
360 Ga0501043_0010905 3300049579 Bacteria 7117
361 Ga0501043_0015284 3300049579 Bacteria 6012
362 Ga0501043_0024213 3300049579 Bacteria 4763
363 Ga0501043_0114407 3300049579 Bacteria 2118
364 Ga0501043_0164446 3300049579 Bacteria 1733
365 Ga0501046_0000398 3300049580 Bacteria 43497
366 Ga0501046_0006941 3300049580 Bacteria 9979
367 Ga0501046_0017912 3300049580 Bacteria 5905
368 Ga0501046_0059572 3300049580 Bacteria 2990
369 Ga0501046_0105934 3300049580 Bacteria 2153
370 Ga0501046_0136535 3300049580 Bacteria 1857
371 Ga0501046_0352347 3300049580 Bacteria 1069
372 Ga0501047_0000124 3300049581 Bacteria 94721
373 Ga0501047_0000656 3300049581 Bacteria 36126
374 Ga0501047_0004079 3300049581 Bacteria 13745
375 Ga0501047_0026630 3300049581 Bacteria 5565
376 Ga0501047_0063561 3300049581 Bacteria 3560
377 Ga0501047_0081301 3300049581 Bacteria 3114
378 Ga0501047_0106163 3300049581 Bacteria 2689
379 Ga0501048_0000150 3300049582 Bacteria 42721
380 Ga0501048_0001094 3300049582 Bacteria 20335
381 Ga0501048_0002054 3300049582 Bacteria 15303
382 Ga0501067_0002993 3300049583 Bacteria 9324
383 Ga0501067_0007941 3300049583 Bacteria 5894
384 Ga0501067_0113006 3300049583 Bacteria 1510
385 Ga0501067_0301308 3300049583 Bacteria 892
386 Ga0501068_0002550 3300049584 Bacteria 9661
387 Ga0501068_0017089 3300049584 Bacteria 4192
388 Ga0501068_0021687 3300049584 Bacteria 3753
389 Ga0501069_0005884 3300049585 Bacteria 6390
390 Ga0501069_0008121 3300049585 Bacteria 5515
391 Ga0501069_0010916 3300049585 Bacteria 4814
392 Ga0501069_0043884 3300049585 Bacteria 2475
393 Ga0501069_0143691 3300049585 Bacteria 1369
394 Ga0501070_0009424 3300049586 Bacteria 8253
395 Ga0501070_0019535 3300049586 Bacteria 5682
396 Ga0501070_0029962 3300049586 Bacteria 4559
397 Ga0501070_0046777 3300049586 Bacteria 3598
398 Ga0501070_0049544 3300049586 Bacteria 3488
399 Ga0501070_0220478 3300049586 Bacteria 1555
400 Ga0501071_0009094 3300049587 Bacteria 6596
401 Ga0501072_0001038 3300049588 Bacteria 20561
402 Ga0501072_0002358 3300049588 Bacteria 14171
403 Ga0501073_0000037 3300049589 Bacteria 87345
404 Ga0501073_0001123 3300049589 Bacteria 19412
405 Ga0501073_0004230 3300049589 Bacteria 10761
406 Ga0501073_0107810 3300049589 Bacteria 1933
407 Ga0501073_0259592 3300049589 Bacteria 1199
408 Ga0501073_0303658 3300049589 Bacteria 1101
409 Ga0501074_0000212 3300049590 Bacteria 31886
410 Ga0501074_0026651 3300049590 Bacteria 4191
411 Ga0501074_0027803 3300049590 Bacteria 4100
412 Ga0501074_0051495 3300049590 Bacteria 2971
413 Ga0501075_0108876 3300049591 Bacteria 2106
414 Ga0501075_0153642 3300049591 Bacteria 1755
415 Ga0501076_0004081 3300049592 Bacteria 10329
416 Ga0501076_0055533 3300049592 Bacteria 3141
417 Ga0501076_0128940 3300049592 Bacteria 2051
418 Ga0501076_0129322 3300049592 Bacteria 2048
419 Ga0501076_0420102 3300049592 Bacteria 1100
420 Ga0501077_0002084 3300049593 Bacteria 12059
421 Ga0501079_0003203 3300049741 Bacteria 11990
422 Ga0501079_0011091 3300049741 Bacteria 6874
423 Ga0501079_0025065 3300049741 Bacteria 4576
424 Ga0501079_0290347 3300049741 Bacteria 1279
425 Ga0501080_0000054 3300049742 Bacteria 74316
426 Ga0501080_0022887 3300049742 Bacteria 5793
427 Ga0501080_0023984 3300049742 Bacteria 5655
428 Ga0501080_0025297 3300049742 Bacteria 5509
429 Ga0501080_0044509 3300049742 Bacteria 4132
430 Ga0501080_0163702 3300049742 Bacteria 2053
431 Ga0501081_0015273 3300049743 Bacteria 5065
432 Ga0501083_0001836 3300049744 Bacteria 14565
433 Ga0501083_0003149 3300049744 Bacteria 11481
434 Ga0501083_0003874 3300049744 Bacteria 10511
435 Ga0501083_0036680 3300049744 Bacteria 3342
436 Ga0501083_0047739 3300049744 Bacteria 2892
437 Ga0501083_0189699 3300049744 Bacteria 1341
438 Ga0501083_0202090 3300049744 Bacteria 1296
439 Ga0501035_0000142 3300049822 Bacteria 87561
440 Ga0501035_0001311 3300049822 Bacteria 25709
441 Ga0501035_0001398 3300049822 Bacteria 24778
442 Ga0501035_0012945 3300049822 Bacteria 7700
443 Ga0501035_0022024 3300049822 Bacteria 5854
444 Ga0501035_0059488 3300049822 Bacteria 3402
445 Ga0501035_0232567 3300049822 Bacteria 1570
446 Ga0501035_0320231 3300049822 Bacteria 1303
447 Ga0501035_0429215 3300049822 Bacteria 1096
448 Ga0501035_0436603 3300049822 Bacteria 1085
449 Ga0501044_0000144 3300049823 Bacteria 87628
450 Ga0501044_0000985 3300049823 Bacteria 34233
451 Ga0501044_0009883 3300049823 Bacteria 10367
452 Ga0501044_0010577 3300049823 Bacteria 10009
453 Ga0501044_0014273 3300049823 Bacteria 8576
454 Ga0501044_0014727 3300049823 Bacteria 8431
455 Ga0501044_0015498 3300049823 Bacteria 8209
456 Ga0501044_0028600 3300049823 Bacteria 5883
457 Ga0501044_0041230 3300049823 Bacteria 4806
458 Ga0501044_0043662 3300049823 Bacteria 4656
459 Ga0501044_0146624 3300049823 Bacteria 2345
460 Ga0501044_0238068 3300049823 Bacteria 1765
461 Ga0501044_0288524 3300049823 Bacteria 1573
462 Ga0501044_0460931 3300049823 Bacteria 1176
463 Ga0501045_0002914 3300049824 Bacteria 11693
464 Ga0501045_0089745 3300049824 Bacteria 2270
465 nmdc:mga0yw44_354411_c1 3300050492 Bacteria 988
466 nmdc:mga09592_48915_c1 3300050508 Bacteria 3565
467 nmdc:mga09592_70345_c1 3300050508 Bacteria 2969
468 nmdc:mga0qj67_276_c1 3300050509 Bacteria 35718
469 nmdc:mga0qj67_55_c1 3300050509 Bacteria 83015
470 nmdc:mga0qj67_99265_c1 3300050509 Bacteria 2346
471 nmdc:mga06r32_318247_c1 3300050510 Bacteria 1541
472 nmdc:mga06r32_7075_c1 3300050510 Bacteria 10096
473 nmdc:mga08y16_20620_c1 3300050511 Bacteria 6955
474 nmdc:mga0n895_10223_c1 3300050512 Bacteria 8267
475 nmdc:mga0n895_13472_c1 3300050512 Bacteria 7379
476 nmdc:mga0n895_205452_c1 3300050512 Bacteria 2000
477 nmdc:mga0n895_71232_c1 3300050512 Bacteria 3446
478 nmdc:mga0rr50_20603_c1 3300050513 Bacteria 4483
479 nmdc:mga0rr50_374254_c1 3300050513 Bacteria 1200
480 nmdc:mga0rr50_83563_c1 3300050513 Bacteria 2469
481 nmdc:mga08x19_21_c1 3300050514 Bacteria 302369
482 nmdc:mga0a205_1012_c1 3300050515 Bacteria 23345
483 nmdc:mga0a205_12662_c1 3300050515 Bacteria 7812
484 nmdc:mga0a205_95652_c1 3300050515 Bacteria 2869
485 Ga0500643_020740 3300053087 Bacteria 2141
486 Ga0500651_0007510 3300053093 Bacteria 6367
487 Ga0500650_0025142 3300053098 Bacteria 2660
488 Ga0500595_000010 3300053119 Bacteria 275806
489 Ga0500595_019995 3300053119 Bacteria 2418
490 Ga0500568_0084333 3300053139 Bacteria 1203
491 Ga0500616_0000001 3300053153 Bacteria 1986011
492 Ga0500645_001000 3300053730 Bacteria 15943
493 Ga0501084_0007797 3300054114 Bacteria 8813
494 Ga0501084_0139706 3300054114 Bacteria 2040
495 Ga0501084_0174800 3300054114 Bacteria 1812
496 Ga0501082_0000002 3300060353 Bacteria 186546
497 Ga0501082_0008040 3300060353 Bacteria 9102
498 Ga0501082_0017051 3300060353 Bacteria 6256
499 Ga0501082_0074629 3300060353 Bacteria 2921
500 Ga0530510_0273392 3300061734 Bacteria 1261
501 Ga0530510_0408678 3300061734 Bacteria 1024

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_11087156 Ga0157372_110871561 189
2 3300006051 Ga0075364_10092012 Ga0075364_100920122 197
3 3300006178 Ga0075367_10147743 Ga0075367_101477432 201
4 3300049823 Ga0501044_0146624 Ga0501044_0146624_332_1111 206
5 3300049583 Ga0501067_0301308 Ga0501067_0301308_71_868 216
6 3300053087 Ga0500643_020740 Ga0500643_020740_553_1353 216
7 3300049590 Ga0501074_0026651 Ga0501074_0026651_2017_2811 217
8 3300049742 Ga0501080_0025297 Ga0501080_0025297_3681_4475 217
9 3300054114 Ga0501084_0139706 Ga0501084_0139706_121_915 217
10 3300006042 Ga0075368_10003840 Ga0075368_100038407 219
11 3300006178 Ga0075367_10004365 Ga0075367_100043655 219
12 3300049570 Ga0501033_0068718 Ga0501033_0068718_22_690 219
13 3300049585 Ga0501069_0043884 Ga0501069_0043884_497_1270 220
14 3300049589 Ga0501073_0107810 Ga0501073_0107810_786_1559 220
15 3300049591 Ga0501075_0108876 Ga0501075_0108876_1137_1847 220
16 3300049592 Ga0501076_0004081 Ga0501076_0004081_4887_5597 220
17 3300049593 Ga0501077_0002084 Ga0501077_0002084_5418_6128 220
18 3300049741 Ga0501079_0011091 Ga0501079_0011091_771_1481 220
19 3300049743 Ga0501081_0015273 Ga0501081_0015273_549_1259 220
20 3300049822 Ga0501035_0001398 Ga0501035_0001398_14548_15321 220
21 3300060353 Ga0501082_0017051 Ga0501082_0017051_4336_5046 220
22 3300061734 Ga0530510_0273392 Ga0530510_0273392_534_1244 220
23 3300049741 Ga0501079_0290347 Ga0501079_0290347_356_1153 221
24 3300005434 Ga0070709_10034894 Ga0070709_100348943 222
25 3300006028 Ga0070717_10078841 Ga0070717_100788412 222
26 3300025906 Ga0207699_10032151 Ga0207699_100321513 222
27 3300049586 Ga0501070_0046777 Ga0501070_0046777_2379_3167 224
28 3300005937 Ga0081455_10149224 Ga0081455_101492242 225
29 3300006173 Ga0070716_100288980 Ga0070716_1002889802 225
30 3300049580 Ga0501046_0352347 Ga0501046_0352347_235_1002 225
31 3300049583 Ga0501067_0113006 Ga0501067_0113006_53_778 225
32 3300049591 Ga0501075_0153642 Ga0501075_0153642_781_1548 225
33 3300049592 Ga0501076_0129322 Ga0501076_0129322_477_1274 225
34 3300049744 Ga0501083_0003149 Ga0501083_0003149_4100_4897 225
35 3300005327 Ga0070658_10050571 Ga0070658_100505714 226
36 3300006844 Ga0075428_100368856 Ga0075428_1003688562 226
37 3300025909 Ga0207705_10304081 Ga0207705_103040811 226
38 3300025929 Ga0207664_10050494 Ga0207664_100504944 226
39 3300037068 Ga0373925_0236489 Ga0373925_0236489_198_1049 226
40 3300037312 Ga0395899_0174481 Ga0395899_0174481_36_854 226
41 3300037418 Ga0395900_0821369 Ga0395900_0821369_11_829 226
42 3300037466 Ga0395898_0009340 Ga0395898_0009340_272_1090 226
43 3300038443 Ga0395901_0019445 Ga0395901_0019445_2180_2998 226
44 3300049568 Ga0501031_0022900 Ga0501031_0022900_1734_2513 226
45 3300049569 Ga0501032_0011247 Ga0501032_0011247_5215_5994 226
46 3300049569 Ga0501032_0032571 Ga0501032_0032571_2709_3527 226
47 3300049570 Ga0501033_0011356 Ga0501033_0011356_3967_4785 226
48 3300049571 Ga0501034_0048876 Ga0501034_0048876_134_913 226
49 3300049572 Ga0501036_0084116 Ga0501036_0084116_438_1256 226
50 3300049573 Ga0501037_0001189 Ga0501037_0001189_5126_5905 226
51 3300049573 Ga0501037_0011959 Ga0501037_0011959_2343_3161 226
52 3300049574 Ga0501038_0004064 Ga0501038_0004064_9472_10251 226
53 3300049574 Ga0501038_0028504 Ga0501038_0028504_1412_2230 226
54 3300049575 Ga0501039_0038077 Ga0501039_0038077_1752_2531 226
55 3300049575 Ga0501039_0128559 Ga0501039_0128559_1132_1950 226
56 3300049579 Ga0501043_0015284 Ga0501043_0015284_1878_2657 226
57 3300049579 Ga0501043_0024213 Ga0501043_0024213_2555_3373 226
58 3300049579 Ga0501043_0114407 Ga0501043_0114407_553_1332 226
59 3300049580 Ga0501046_0006941 Ga0501046_0006941_8767_9546 226
60 3300049580 Ga0501046_0136535 Ga0501046_0136535_435_1253 226
61 3300049581 Ga0501047_0063561 Ga0501047_0063561_134_913 226
62 3300049581 Ga0501047_0081301 Ga0501047_0081301_465_1283 226
63 3300049582 Ga0501048_0001094 Ga0501048_0001094_5247_6026 226
64 3300049583 Ga0501067_0007941 Ga0501067_0007941_1160_1939 226
65 3300049584 Ga0501068_0021687 Ga0501068_0021687_2664_3443 226
66 3300049585 Ga0501069_0008121 Ga0501069_0008121_2631_3410 226
67 3300049586 Ga0501070_0220478 Ga0501070_0220478_709_1488 226
68 3300049587 Ga0501071_0009094 Ga0501071_0009094_4789_5568 226
69 3300049589 Ga0501073_0001123 Ga0501073_0001123_16719_17498 226
70 3300049590 Ga0501074_0027803 Ga0501074_0027803_1279_2058 226
71 3300049741 Ga0501079_0025065 Ga0501079_0025065_2766_3545 226
72 3300049742 Ga0501080_0023984 Ga0501080_0023984_912_1691 226
73 3300049744 Ga0501083_0036680 Ga0501083_0036680_1562_2341 226
74 3300049744 Ga0501083_0202090 Ga0501083_0202090_287_1105 226
75 3300049822 Ga0501035_0012945 Ga0501035_0012945_4429_5247 226
76 3300049822 Ga0501035_0059488 Ga0501035_0059488_709_1488 226
77 3300049823 Ga0501044_0010577 Ga0501044_0010577_8522_9301 226
78 3300049823 Ga0501044_0043662 Ga0501044_0043662_2534_3352 226
79 3300049824 Ga0501045_0089745 Ga0501045_0089745_416_1195 226
80 3300060353 Ga0501082_0074629 Ga0501082_0074629_317_1096 226
81 3300049580 Ga0501046_0105934 Ga0501046_0105934_159_941 227
82 3300049585 Ga0501069_0005884 Ga0501069_0005884_984_1757 227
83 3300049586 Ga0501070_0019535 Ga0501070_0019535_1012_1785 227
84 3300049742 Ga0501080_0044509 Ga0501080_0044509_2484_3257 227
85 3300049822 Ga0501035_0320231 Ga0501035_0320231_444_1232 227
86 3300049823 Ga0501044_0000144 Ga0501044_0000144_21311_22093 227
87 3300049823 Ga0501044_0238068 Ga0501044_0238068_436_1209 227
88 3300003323 rootH1_10388944 rootH1_103889442 228
89 3300004803 Ga0058862_10092226 Ga0058862_100922262 228
90 3300005327 Ga0070658_10275937 Ga0070658_102759372 228
91 3300005329 Ga0070683_100005616 Ga0070683_10000561612 228
92 3300005329 Ga0070683_100023299 Ga0070683_1000232996 228
93 3300005336 Ga0070680_100097139 Ga0070680_1000971391 228
94 3300005339 Ga0070660_100098124 Ga0070660_1000981242 228
95 3300005344 Ga0070661_100091159 Ga0070661_1000911592 228
96 3300005355 Ga0070671_100202316 Ga0070671_1002023162 228
97 3300005366 Ga0070659_100101442 Ga0070659_1001014422 228
98 3300005436 Ga0070713_100405452 Ga0070713_1004054522 228
99 3300005439 Ga0070711_100012216 Ga0070711_1000122166 228
100 3300005455 Ga0070663_100234868 Ga0070663_1002348681 228
101 3300005466 Ga0070685_10064602 Ga0070685_100646023 228
102 3300005535 Ga0070684_100023098 Ga0070684_1000230982 228
103 3300005535 Ga0070684_100132872 Ga0070684_1001328722 228
104 3300005539 Ga0068853_100030148 Ga0068853_1000301484 228
105 3300005548 Ga0070665_100073305 Ga0070665_1000733054 228
106 3300005549 Ga0070704_100002993 Ga0070704_1000029937 228
107 3300005563 Ga0068855_100042130 Ga0068855_1000421301 228
108 3300005618 Ga0068864_100033860 Ga0068864_1000338605 228
109 3300005834 Ga0068851_10085510 Ga0068851_100855102 228
110 3300006175 Ga0070712_100067083 Ga0070712_1000670832 228
111 3300009093 Ga0105240_10004694 Ga0105240_1000469421 228
112 3300009098 Ga0105245_10056561 Ga0105245_100565612 228
113 3300009101 Ga0105247_10007722 Ga0105247_100077224 228
114 3300009177 Ga0105248_10216277 Ga0105248_102162773 228
115 3300009545 Ga0105237_10048491 Ga0105237_100484917 228
116 3300009551 Ga0105238_10007397 Ga0105238_100073976 228
117 3300010375 Ga0105239_10018859 Ga0105239_100188594 228
118 3300013104 Ga0157370_10190594 Ga0157370_101905942 228
119 3300013105 Ga0157369_10072277 Ga0157369_100722773 228
120 3300013296 Ga0157374_10014838 Ga0157374_100148382 228
121 3300013306 Ga0163162_10009085 Ga0163162_1000908512 228
122 3300014969 Ga0157376_10050040 Ga0157376_100500402 228
123 3300021384 Ga0213876_10019526 Ga0213876_100195262 228
124 3300025900 Ga0207710_10105241 Ga0207710_101052412 228
125 3300025909 Ga0207705_10046081 Ga0207705_100460815 228
126 3300025912 Ga0207707_10000706 Ga0207707_1000070624 228
127 3300025913 Ga0207695_10217715 Ga0207695_102177152 228
128 3300025914 Ga0207671_10019453 Ga0207671_100194534 228
129 3300025915 Ga0207693_10123294 Ga0207693_101232942 228
130 3300025916 Ga0207663_10128083 Ga0207663_101280833 228
131 3300025917 Ga0207660_10012021 Ga0207660_100120218 228
132 3300025919 Ga0207657_10004672 Ga0207657_100046725 228
133 3300025920 Ga0207649_10095368 Ga0207649_100953682 228
134 3300025921 Ga0207652_10001458 Ga0207652_100014589 228
135 3300025924 Ga0207694_10009977 Ga0207694_100099777 228
136 3300025927 Ga0207687_10155396 Ga0207687_101553962 228
137 3300025928 Ga0207700_10013789 Ga0207700_100137894 228
138 3300025931 Ga0207644_10314205 Ga0207644_103142052 228
139 3300025932 Ga0207690_10132651 Ga0207690_101326512 228
140 3300025941 Ga0207711_10049249 Ga0207711_100492494 228
141 3300025944 Ga0207661_10015446 Ga0207661_100154462 228
142 3300025945 Ga0207679_10235175 Ga0207679_102351752 228
143 3300025949 Ga0207667_10006413 Ga0207667_1000641316 228
144 3300026023 Ga0207677_10623014 Ga0207677_106230141 228
145 3300026035 Ga0207703_10080126 Ga0207703_100801263 228
146 3300026041 Ga0207639_10188458 Ga0207639_101884581 228
147 3300026067 Ga0207678_10010864 Ga0207678_100108641 228
148 3300026095 Ga0207676_10038275 Ga0207676_100382752 228
149 3300026116 Ga0207674_10186517 Ga0207674_101865172 228
150 3300035725 Ga0373947_0097088 Ga0373947_0097088_258_1034 228
151 3300039437 Ga0436365_0855185 Ga0436365_0855185_119_919 228
152 3300048903 Ga0496100_0028290 Ga0496100_0028290_451_1227 228
153 3300048904 Ga0496101_0004388 Ga0496101_0004388_4445_5221 228
154 3300048906 Ga0496103_0008761 Ga0496103_0008761_2318_3094 228
155 3300048906 Ga0496103_0013007 Ga0496103_0013007_2810_3586 228
156 3300048907 Ga0496104_0052621 Ga0496104_0052621_2952_3728 228
157 3300048908 Ga0496105_0034951 Ga0496105_0034951_3188_3964 228
158 3300048909 Ga0496106_0004715 Ga0496106_0004715_8667_9443 228
159 3300048910 Ga0496107_0008852 Ga0496107_0008852_5443_6219 228
160 3300048910 Ga0496107_0010052 Ga0496107_0010052_1228_2055 228
161 3300048911 Ga0496108_0003501 Ga0496108_0003501_4432_5208 228
162 3300048911 Ga0496108_0015288 Ga0496108_0015288_3247_4023 228
163 3300048912 Ga0496109_0499290 Ga0496109_0499290_254_1030 228
164 3300048913 Ga0496110_0040609 Ga0496110_0040609_3066_3842 228
165 3300048914 Ga0496111_0034708 Ga0496111_0034708_2720_3496 228
166 3300048917 Ga0496114_0003448 Ga0496114_0003448_7670_8446 228
167 3300048918 Ga0496115_0008004 Ga0496115_0008004_2187_2963 228
168 3300048924 Ga0496121_0000523 Ga0496121_0000523_1408_2235 228
169 3300049571 Ga0501034_0644163 Ga0501034_0644163_20_757 228
170 3300049823 Ga0501044_0014727 Ga0501044_0014727_4135_4914 228
171 3300050508 nmdc:mga09592_70345_c1 nmdc:mga09592_70345_c1_1326_2111 228
172 3300050512 nmdc:mga0n895_71232_c1 nmdc:mga0n895_71232_c1_881_1657 228
173 3300005937 Ga0081455_10005762 Ga0081455_1000576211 229
174 3300006852 Ga0075433_10032305 Ga0075433_100323057 229
175 3300006871 Ga0075434_100035984 Ga0075434_1000359844 229
176 3300007076 Ga0075435_100004453 Ga0075435_1000044532 229
177 3300009094 Ga0111539_10006361 Ga0111539_1000636110 229
178 3300031238 Ga0265332_10003996 Ga0265332_100039965 229
179 3300031241 Ga0265325_10129761 Ga0265325_101297612 229
180 3300031247 Ga0265340_10025020 Ga0265340_100250202 229
181 3300031249 Ga0265339_10033612 Ga0265339_100336122 229
182 3300031250 Ga0265331_10007677 Ga0265331_100076774 229
183 3300037418 Ga0395900_0747877 Ga0395900_0747877_37_822 229
184 3300049569 Ga0501032_0110989 Ga0501032_0110989_377_1159 229
185 3300049570 Ga0501033_0001342 Ga0501033_0001342_18175_18957 229
186 3300049572 Ga0501036_0019586 Ga0501036_0019586_3680_4462 229
187 3300049573 Ga0501037_0001298 Ga0501037_0001298_6151_6933 229
188 3300049574 Ga0501038_0047648 Ga0501038_0047648_1828_2610 229
189 3300049578 Ga0501042_0144609 Ga0501042_0144609_564_1346 229
190 3300049579 Ga0501043_0004843 Ga0501043_0004843_4394_5176 229
191 3300049580 Ga0501046_0059572 Ga0501046_0059572_1629_2411 229
192 3300049822 Ga0501035_0001311 Ga0501035_0001311_12957_13739 229
193 3300049823 Ga0501044_0028600 Ga0501044_0028600_119_901 229
194 3300050511 nmdc:mga08y16_20620_c1 nmdc:mga08y16_20620_c1_1938_2786 229
195 3300050513 nmdc:mga0rr50_20603_c1 nmdc:mga0rr50_20603_c1_57_905 229
196 3300050515 nmdc:mga0a205_95652_c1 nmdc:mga0a205_95652_c1_148_996 229
197 3300005331 Ga0070670_100340157 Ga0070670_1003401572 230
198 3300005335 Ga0070666_10018342 Ga0070666_100183425 230
199 3300005337 Ga0070682_100105945 Ga0070682_1001059452 230
200 3300005338 Ga0068868_100054852 Ga0068868_1000548523 230
201 3300005340 Ga0070689_100023388 Ga0070689_1000233886 230
202 3300005355 Ga0070671_100010055 Ga0070671_1000100556 230
203 3300005356 Ga0070674_100093561 Ga0070674_1000935612 230
204 3300005367 Ga0070667_100072840 Ga0070667_1000728402 230
205 3300005434 Ga0070709_10002216 Ga0070709_100022166 230
206 3300005435 Ga0070714_100204935 Ga0070714_1002049352 230
207 3300005437 Ga0070710_10002966 Ga0070710_100029664 230
208 3300005439 Ga0070711_100014753 Ga0070711_1000147533 230
209 3300005455 Ga0070663_100130629 Ga0070663_1001306292 230
210 3300005456 Ga0070678_100005437 Ga0070678_1000054377 230
211 3300005544 Ga0070686_100039915 Ga0070686_1000399152 230
212 3300005546 Ga0070696_100076526 Ga0070696_1000765262 230
213 3300005547 Ga0070693_100026376 Ga0070693_1000263762 230
214 3300005548 Ga0070665_100007463 Ga0070665_1000074633 230
215 3300005614 Ga0068856_100125718 Ga0068856_1001257184 230
216 3300005614 Ga0068856_100145132 Ga0068856_1001451322 230
217 3300005617 Ga0068859_100066757 Ga0068859_1000667574 230
218 3300005618 Ga0068864_100045542 Ga0068864_1000455423 230
219 3300005718 Ga0068866_10014101 Ga0068866_100141014 230
220 3300005842 Ga0068858_100010777 Ga0068858_1000107778 230
221 3300005937 Ga0081455_10010795 Ga0081455_100107953 230
222 3300006028 Ga0070717_10144335 Ga0070717_101443352 230
223 3300006163 Ga0070715_10001099 Ga0070715_100010994 230
224 3300006173 Ga0070716_100002384 Ga0070716_1000023848 230
225 3300006237 Ga0097621_100065650 Ga0097621_1000656504 230
226 3300006358 Ga0068871_100042552 Ga0068871_1000425522 230
227 3300006846 Ga0075430_100000094 Ga0075430_10000009423 230
228 3300006847 Ga0075431_100019949 Ga0075431_1000199494 230
229 3300006852 Ga0075433_10000311 Ga0075433_100003119 230
230 3300006871 Ga0075434_100000299 Ga0075434_10000029916 230
231 3300006880 Ga0075429_100013958 Ga0075429_1000139584 230
232 3300006881 Ga0068865_100005241 Ga0068865_1000052415 230
233 3300006931 Ga0097620_100066761 Ga0097620_1000667614 230
234 3300007076 Ga0075435_100025576 Ga0075435_1000255761 230
235 3300009098 Ga0105245_10004710 Ga0105245_100047108 230
236 3300009147 Ga0114129_10001218 Ga0114129_100012186 230
237 3300009148 Ga0105243_10129559 Ga0105243_101295592 230
238 3300009176 Ga0105242_10011410 Ga0105242_100114107 230
239 3300009177 Ga0105248_10033380 Ga0105248_100333803 230
240 3300013104 Ga0157370_10040186 Ga0157370_100401863 230
241 3300013296 Ga0157374_10008513 Ga0157374_100085134 230
242 3300013297 Ga0157378_10005396 Ga0157378_1000539610 230
243 3300013306 Ga0163162_10041191 Ga0163162_100411913 230
244 3300013307 Ga0157372_10033678 Ga0157372_100336784 230
245 3300013308 Ga0157375_10012326 Ga0157375_100123266 230
246 3300014325 Ga0163163_10024935 Ga0163163_100249354 230
247 3300014968 Ga0157379_10022392 Ga0157379_100223924 230
248 3300014969 Ga0157376_10008597 Ga0157376_100085973 230
249 3300025898 Ga0207692_10121824 Ga0207692_101218242 230
250 3300025900 Ga0207710_10013101 Ga0207710_100131013 230
251 3300025903 Ga0207680_10018562 Ga0207680_100185625 230
252 3300025905 Ga0207685_10000612 Ga0207685_100006125 230
253 3300025906 Ga0207699_10002176 Ga0207699_100021764 230
254 3300025927 Ga0207687_10054526 Ga0207687_100545262 230
255 3300025928 Ga0207700_10076612 Ga0207700_100766122 230
256 3300025929 Ga0207664_10179879 Ga0207664_101798792 230
257 3300025931 Ga0207644_10020007 Ga0207644_100200072 230
258 3300025934 Ga0207686_10019892 Ga0207686_100198923 230
259 3300025938 Ga0207704_10003803 Ga0207704_100038034 230
260 3300025939 Ga0207665_10008613 Ga0207665_100086135 230
261 3300025941 Ga0207711_10003089 Ga0207711_100030899 230
262 3300025986 Ga0207658_10098819 Ga0207658_100988193 230
263 3300026023 Ga0207677_10034827 Ga0207677_100348272 230
264 3300026035 Ga0207703_10008661 Ga0207703_100086613 230
265 3300026067 Ga0207678_10153812 Ga0207678_101538122 230
266 3300026078 Ga0207702_10154901 Ga0207702_101549012 230
267 3300026095 Ga0207676_10034081 Ga0207676_100340812 230
268 3300026121 Ga0207683_10037129 Ga0207683_100371294 230
269 3300027907 Ga0207428_10000075 Ga0207428_100000751 230
270 3300028379 Ga0268266_10004873 Ga0268266_100048738 230
271 3300035691 Ga0373931_0087976 Ga0373931_0087976_523_1305 230
272 3300035695 Ga0373927_0005965 Ga0373927_0005965_5982_6770 230
273 3300037068 Ga0373925_0299889 Ga0373925_0299889_341_1129 230
274 3300046457 Ga0495590_0084602 Ga0495590_0084602_152_940 230
275 3300046473 Ga0495582_0043913 Ga0495582_0043913_788_1576 230
276 3300046499 Ga0495594_0100844 Ga0495594_0100844_398_1186 230
277 3300046535 Ga0495586_0184318 Ga0495586_0184318_243_1031 230
278 3300047315 Ga0495581_0058092 Ga0495581_0058092_172_960 230
279 3300048903 Ga0496100_0005901 Ga0496100_0005901_3203_3985 230
280 3300048904 Ga0496101_0030995 Ga0496101_0030995_2055_2837 230
281 3300048905 Ga0496102_0067819 Ga0496102_0067819_1936_2718 230
282 3300048906 Ga0496103_0002131 Ga0496103_0002131_4649_5431 230
283 3300048907 Ga0496104_0031478 Ga0496104_0031478_3970_4752 230
284 3300048908 Ga0496105_0014702 Ga0496105_0014702_3932_4714 230
285 3300048909 Ga0496106_0008869 Ga0496106_0008869_5737_6519 230
286 3300048912 Ga0496109_0140466 Ga0496109_0140466_1050_1832 230
287 3300048913 Ga0496110_0092852 Ga0496110_0092852_554_1336 230
288 3300048914 Ga0496111_0028921 Ga0496111_0028921_2752_3534 230
289 3300048916 Ga0496113_0005750 Ga0496113_0005750_3879_4661 230
290 3300048917 Ga0496114_0005405 Ga0496114_0005405_3990_4772 230
291 3300049568 Ga0501031_0000511 Ga0501031_0000511_14303_15106 230
292 3300049569 Ga0501032_0000073 Ga0501032_0000073_26190_26993 230
293 3300049569 Ga0501032_0026989 Ga0501032_0026989_905_1690 230
294 3300049570 Ga0501033_0001845 Ga0501033_0001845_6536_7339 230
295 3300049570 Ga0501033_0034916 Ga0501033_0034916_703_1488 230
296 3300049571 Ga0501034_0000251 Ga0501034_0000251_6766_7569 230
297 3300049571 Ga0501034_0039921 Ga0501034_0039921_2277_3062 230
298 3300049572 Ga0501036_0000036 Ga0501036_0000036_81945_82748 230
299 3300049572 Ga0501036_0021080 Ga0501036_0021080_2689_3474 230
300 3300049573 Ga0501037_0000040 Ga0501037_0000040_46429_47232 230
301 3300049573 Ga0501037_0020178 Ga0501037_0020178_1668_2453 230
302 3300049574 Ga0501038_0000150 Ga0501038_0000150_12927_13730 230
303 3300049574 Ga0501038_0005769 Ga0501038_0005769_3661_4446 230
304 3300049575 Ga0501039_0001837 Ga0501039_0001837_1504_2307 230
305 3300049575 Ga0501039_0110375 Ga0501039_0110375_917_1702 230
306 3300049578 Ga0501042_0018908 Ga0501042_0018908_1887_2690 230
307 3300049579 Ga0501043_0000707 Ga0501043_0000707_28535_29338 230
308 3300049579 Ga0501043_0010905 Ga0501043_0010905_3202_3987 230
309 3300049580 Ga0501046_0000398 Ga0501046_0000398_6300_7103 230
310 3300049581 Ga0501047_0000656 Ga0501047_0000656_6536_7339 230
311 3300049581 Ga0501047_0004079 Ga0501047_0004079_8868_9653 230
312 3300049581 Ga0501047_0026630 Ga0501047_0026630_731_1519 230
313 3300049582 Ga0501048_0002054 Ga0501048_0002054_3394_4197 230
314 3300049583 Ga0501067_0002993 Ga0501067_0002993_7564_8367 230
315 3300049584 Ga0501068_0002550 Ga0501068_0002550_2168_2971 230
316 3300049585 Ga0501069_0010916 Ga0501069_0010916_1183_1986 230
317 3300049586 Ga0501070_0009424 Ga0501070_0009424_1602_2405 230
318 3300049588 Ga0501072_0001038 Ga0501072_0001038_5125_5928 230
319 3300049589 Ga0501073_0000037 Ga0501073_0000037_4525_5328 230
320 3300049589 Ga0501073_0004230 Ga0501073_0004230_3614_4399 230
321 3300049589 Ga0501073_0303658 Ga0501073_0303658_176_964 230
322 3300049590 Ga0501074_0000212 Ga0501074_0000212_20288_21091 230
323 3300049592 Ga0501076_0420102 Ga0501076_0420102_87_890 230
324 3300049741 Ga0501079_0003203 Ga0501079_0003203_10706_11509 230
325 3300049742 Ga0501080_0000054 Ga0501080_0000054_55420_56223 230
326 3300049742 Ga0501080_0022887 Ga0501080_0022887_2417_3202 230
327 3300049744 Ga0501083_0003874 Ga0501083_0003874_4229_5032 230
328 3300049822 Ga0501035_0000142 Ga0501035_0000142_79993_80796 230
329 3300049822 Ga0501035_0232567 Ga0501035_0232567_141_929 230
330 3300049823 Ga0501044_0000985 Ga0501044_0000985_6766_7569 230
331 3300049823 Ga0501044_0014273 Ga0501044_0014273_3842_4627 230
332 3300049823 Ga0501044_0041230 Ga0501044_0041230_2837_3625 230
333 3300049823 Ga0501044_0288524 Ga0501044_0288524_461_1240 230
334 3300049824 Ga0501045_0002914 Ga0501045_0002914_3248_4051 230
335 3300050492 nmdc:mga0yw44_354411_c1 nmdc:mga0yw44_354411_c1_157_945 230
336 3300050508 nmdc:mga09592_48915_c1 nmdc:mga09592_48915_c1_92_874 230
337 3300050509 nmdc:mga0qj67_276_c1 nmdc:mga0qj67_276_c1_18177_18959 230
338 3300050510 nmdc:mga06r32_7075_c1 nmdc:mga06r32_7075_c1_2739_3521 230
339 3300050512 nmdc:mga0n895_13472_c1 nmdc:mga0n895_13472_c1_2085_2882 230
340 3300050515 nmdc:mga0a205_1012_c1 nmdc:mga0a205_1012_c1_4259_5041 230
341 3300054114 Ga0501084_0007797 Ga0501084_0007797_5848_6651 230
342 3300060353 Ga0501082_0008040 Ga0501082_0008040_7957_8760 230
343 3300003323 rootH1_10219390 rootH1_102193902 231
344 3300005843 Ga0068860_100090476 Ga0068860_1000904761 231
345 3300005983 Ga0081540_1016374 Ga0081540_10163744 231
346 3300006852 Ga0075433_10039718 Ga0075433_100397185 231
347 3300006871 Ga0075434_100010423 Ga0075434_1000104232 231
348 3300009094 Ga0111539_10037235 Ga0111539_100372357 231
349 3300009147 Ga0114129_10374300 Ga0114129_103743001 231
350 3300026088 Ga0207641_10356514 Ga0207641_103565141 231
351 3300034819 Ga0373958_0022642 Ga0373958_0022642_23_814 231
352 3300035113 Ga0373936_0013511 Ga0373936_0013511_1291_2079 231
353 3300035691 Ga0373931_0023031 Ga0373931_0023031_2232_3023 231
354 3300046660 Ga0495625_0280982 Ga0495625_0280982_183_986 231
355 3300047469 Ga0495673_0068128 Ga0495673_0068128_356_1141 231
356 3300048904 Ga0496101_0253992 Ga0496101_0253992_475_1266 231
357 3300048909 Ga0496106_0123416 Ga0496106_0123416_1064_1855 231
358 3300048912 Ga0496109_0182578 Ga0496109_0182578_271_1062 231
359 3300048915 Ga0496112_0666842 Ga0496112_0666842_13_798 231
360 3300048918 Ga0496115_0140582 Ga0496115_0140582_701_1492 231
361 3300049577 Ga0501041_0081902 Ga0501041_0081902_1114_1926 231
362 3300049592 Ga0501076_0128940 Ga0501076_0128940_546_1358 231
363 3300049822 Ga0501035_0429215 Ga0501035_0429215_213_1007 231
364 3300050510 nmdc:mga06r32_318247_c1 nmdc:mga06r32_318247_c1_524_1327 231
365 3300050512 nmdc:mga0n895_10223_c1 nmdc:mga0n895_10223_c1_814_1605 231
366 3300050513 nmdc:mga0rr50_374254_c1 nmdc:mga0rr50_374254_c1_149_940 231
367 3300050515 nmdc:mga0a205_12662_c1 nmdc:mga0a205_12662_c1_2557_3348 231
368 3300053093 Ga0500651_0007510 Ga0500651_0007510_1378_2160 231
369 3300053119 Ga0500595_000010 Ga0500595_000010_219539_220321 231
370 3300053119 Ga0500595_019995 Ga0500595_019995_799_1584 231
371 3300053139 Ga0500568_0084333 Ga0500568_0084333_175_978 231
372 3300053153 Ga0500616_0000001 Ga0500616_0000001_607627_608409 231
373 3300053730 Ga0500645_001000 Ga0500645_001000_4095_4877 231
374 3300061734 Ga0530510_0408678 Ga0530510_0408678_78_890 231
375 3300005336 Ga0070680_100008640 Ga0070680_1000086404 232
376 3300005337 Ga0070682_100001892 Ga0070682_1000018928 232
377 3300005366 Ga0070659_100020658 Ga0070659_1000206587 232
378 3300005458 Ga0070681_10031178 Ga0070681_100311784 232
379 3300005471 Ga0070698_100098581 Ga0070698_1000985812 232
380 3300005530 Ga0070679_100029146 Ga0070679_1000291467 232
381 3300005539 Ga0068853_100001190 Ga0068853_1000011907 232
382 3300005545 Ga0070695_100164983 Ga0070695_1001649832 232
383 3300005547 Ga0070693_100006178 Ga0070693_1000061783 232
384 3300005563 Ga0068855_100060367 Ga0068855_1000603673 232
385 3300005577 Ga0068857_100046580 Ga0068857_1000465802 232
386 3300005937 Ga0081455_10001271 Ga0081455_1000127113 232
387 3300006871 Ga0075434_100401409 Ga0075434_1004014091 232
388 3300009093 Ga0105240_10671442 Ga0105240_106714421 232
389 3300009174 Ga0105241_10018120 Ga0105241_100181204 232
390 3300009545 Ga0105237_10598246 Ga0105237_105982461 232
391 3300010375 Ga0105239_10533323 Ga0105239_105333232 232
392 3300013100 Ga0157373_10007935 Ga0157373_100079357 232
393 3300013104 Ga0157370_10011023 Ga0157370_100110235 232
394 3300013307 Ga0157372_10003695 Ga0157372_1000369512 232
395 3300025911 Ga0207654_10021443 Ga0207654_100214434 232
396 3300025912 Ga0207707_10004382 Ga0207707_1000438211 232
397 3300025917 Ga0207660_10009266 Ga0207660_100092665 232
398 3300025921 Ga0207652_10013394 Ga0207652_100133945 232
399 3300025932 Ga0207690_10071881 Ga0207690_100718812 232
400 3300025949 Ga0207667_10080899 Ga0207667_100808992 232
401 3300026041 Ga0207639_10005907 Ga0207639_100059075 232
402 3300031344 Ga0265316_10214475 Ga0265316_102144752 232
403 3300031595 Ga0265313_10083465 Ga0265313_100834651 232
404 3300049592 Ga0501076_0055533 Ga0501076_0055533_2138_2935 232
405 3300050509 nmdc:mga0qj67_99265_c1 nmdc:mga0qj67_99265_c1_503_1297 232
406 3300050512 nmdc:mga0n895_205452_c1 nmdc:mga0n895_205452_c1_492_1289 232
407 3300005434 Ga0070709_10247074 Ga0070709_102470742 233
408 3300005437 Ga0070710_10012893 Ga0070710_100128931 233
409 3300005467 Ga0070706_100212968 Ga0070706_1002129681 233
410 3300005545 Ga0070695_100105139 Ga0070695_1001051392 233
411 3300006163 Ga0070715_10006767 Ga0070715_100067673 233
412 3300009147 Ga0114129_10772887 Ga0114129_107728871 233
413 3300009148 Ga0105243_10314371 Ga0105243_103143712 233
414 3300009553 Ga0105249_10001043 Ga0105249_1000104326 233
415 3300025898 Ga0207692_10029960 Ga0207692_100299602 233
416 3300025905 Ga0207685_10086864 Ga0207685_100868641 233
417 3300025906 Ga0207699_10218829 Ga0207699_102188292 233
418 3300025910 Ga0207684_10470476 Ga0207684_104704762 233
419 3300025939 Ga0207665_10064225 Ga0207665_100642253 233
420 3300025961 Ga0207712_10003000 Ga0207712_100030002 233
421 3300039437 Ga0436365_1851746 Ga0436365_1851746_161_862 233
422 3300049579 Ga0501043_0164446 Ga0501043_0164446_155_943 233
423 3300005530 Ga0070679_100098686 Ga0070679_1000986862 234
424 3300005536 Ga0070697_100008013 Ga0070697_1000080134 234
425 3300006173 Ga0070716_100092520 Ga0070716_1000925202 234
426 3300006173 Ga0070716_100326841 Ga0070716_1003268412 234
427 3300006914 Ga0075436_100008217 Ga0075436_1000082176 234
428 3300007076 Ga0075435_100017872 Ga0075435_1000178722 234
429 3300025912 Ga0207707_10359887 Ga0207707_103598872 234
430 3300025921 Ga0207652_10293243 Ga0207652_102932432 234
431 3300028379 Ga0268266_10613762 Ga0268266_106137621 234
432 3300031247 Ga0265340_10076954 Ga0265340_100769542 234
433 3300031344 Ga0265316_10049905 Ga0265316_100499052 234
434 3300031711 Ga0265314_10000439 Ga0265314_1000043912 234
435 3300039437 Ga0436365_1010724 Ga0436365_1010724_861_1661 234
436 3300049569 Ga0501032_0067519 Ga0501032_0067519_427_1221 234
437 3300049571 Ga0501034_0013749 Ga0501034_0013749_918_1712 234
438 3300049572 Ga0501036_0021491 Ga0501036_0021491_470_1264 234
439 3300049573 Ga0501037_0010332 Ga0501037_0010332_5025_5819 234
440 3300049581 Ga0501047_0000124 Ga0501047_0000124_92360_93154 234
441 3300049582 Ga0501048_0000150 Ga0501048_0000150_4983_5777 234
442 3300049586 Ga0501070_0049544 Ga0501070_0049544_1830_2624 234
443 3300049590 Ga0501074_0051495 Ga0501074_0051495_1476_2270 234
444 3300049744 Ga0501083_0001836 Ga0501083_0001836_9659_10453 234
445 3300049822 Ga0501035_0436603 Ga0501035_0436603_179_973 234
446 3300049823 Ga0501044_0015498 Ga0501044_0015498_2509_3303 234
447 3300049823 Ga0501044_0460931 Ga0501044_0460931_311_1105 234
448 3300050513 nmdc:mga0rr50_83563_c1 nmdc:mga0rr50_83563_c1_1044_1841 234
449 3300050514 nmdc:mga08x19_21_c1 nmdc:mga08x19_21_c1_177134_177931 234
450 3300053098 Ga0500650_0025142 Ga0500650_0025142_1845_2639 234
451 3300005354 Ga0070675_100486630 Ga0070675_1004866301 235
452 3300005367 Ga0070667_100628162 Ga0070667_1006281621 235
453 3300005841 Ga0068863_100081782 Ga0068863_1000817821 235
454 3300025918 Ga0207662_10008217 Ga0207662_100082175 235
455 3300025927 Ga0207687_10057361 Ga0207687_100573612 235
456 3300025936 Ga0207670_10001957 Ga0207670_1000195710 235
457 3300026088 Ga0207641_10255346 Ga0207641_102553462 235
458 3300039437 Ga0436365_0139851 Ga0436365_0139851_1919_2710 235
459 3300046491 Ga0495584_0106262 Ga0495584_0106262_186_980 235
460 3300049569 Ga0501032_0009541 Ga0501032_0009541_5291_6091 235
461 3300049571 Ga0501034_0019316 Ga0501034_0019316_3720_4520 235
462 3300049571 Ga0501034_0244186 Ga0501034_0244186_889_1686 235
463 3300049573 Ga0501037_0012130 Ga0501037_0012130_5085_5885 235
464 3300049574 Ga0501038_0004684 Ga0501038_0004684_7381_8181 235
465 3300049579 Ga0501043_0005879 Ga0501043_0005879_3928_4728 235
466 3300049580 Ga0501046_0017912 Ga0501046_0017912_2430_3230 235
467 3300049581 Ga0501047_0106163 Ga0501047_0106163_1640_2437 235
468 3300049584 Ga0501068_0017089 Ga0501068_0017089_1310_2110 235
469 3300049585 Ga0501069_0143691 Ga0501069_0143691_336_1136 235
470 3300049586 Ga0501070_0029962 Ga0501070_0029962_953_1753 235
471 3300049742 Ga0501080_0163702 Ga0501080_0163702_589_1389 235
472 3300049744 Ga0501083_0047739 Ga0501083_0047739_1158_1958 235
473 3300049822 Ga0501035_0022024 Ga0501035_0022024_1856_2656 235
474 3300049823 Ga0501044_0009883 Ga0501044_0009883_4088_4888 235
475 3300005435 Ga0070714_100060248 Ga0070714_1000602484 236
476 3300005436 Ga0070713_100347323 Ga0070713_1003473232 236
477 3300006175 Ga0070712_100029042 Ga0070712_1000290422 236
478 3300006846 Ga0075430_100000092 Ga0075430_10000009246 236
479 3300014326 Ga0157380_10132731 Ga0157380_101327313 236
480 3300025915 Ga0207693_10080542 Ga0207693_100805422 236
481 3300025928 Ga0207700_10346336 Ga0207700_103463362 236
482 3300025929 Ga0207664_10003797 Ga0207664_1000379710 236
483 3300026078 Ga0207702_10203198 Ga0207702_102031983 236
484 3300028577 Ga0265318_10079779 Ga0265318_100797791 236
485 3300042436 Ga0439435_0000891 Ga0439435_0000891_3156_3959 236
486 3300042993 Ga0439440_0001866 Ga0439440_0001866_569_1372 236
487 3300050509 nmdc:mga0qj67_55_c1 nmdc:mga0qj67_55_c1_73924_74724 236
488 3300003203 JGI25406J46586_10009650 JGI25406J46586_100096504 237
489 3300005356 Ga0070674_100337758 Ga0070674_1003377582 237
490 3300005616 Ga0068852_100291351 Ga0068852_1002913512 237
491 3300005985 Ga0081539_10001975 Ga0081539_100019753 237
492 3300009174 Ga0105241_10466318 Ga0105241_104663182 237
493 3300025933 Ga0207706_10008973 Ga0207706_100089739 237
494 3300025944 Ga0207661_10206191 Ga0207661_102061912 237
495 3300026142 Ga0207698_10361131 Ga0207698_103611312 237
496 3300046664 Ga0495659_0116197 Ga0495659_0116197_183_986 237
497 3300049588 Ga0501072_0002358 Ga0501072_0002358_4016_4822 237
498 3300049589 Ga0501073_0259592 Ga0501073_0259592_380_1189 237
499 3300049744 Ga0501083_0189699 Ga0501083_0189699_151_957 237
500 3300054114 Ga0501084_0174800 Ga0501084_0174800_762_1568 237
501 3300060353 Ga0501082_0000002 Ga0501082_0000002_70578_71387 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16976

RcpC

Flp pilus assembly protein RcpC/CpaB

135

246

0.96

PF08666

SAF

SAF domain

61

129

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ur6-assembly2.cif.gz_A structure of the type iii fish antifreeze protein from zoarces viviparus zvafp6 0.8689 15 81
1b7j-assembly1.cif.gz_A type iii antifreeze protein isoform hplc 12 v20a 0.8649 14 81
4msi-assembly1.cif.gz_A type iii antifreeze protein isoform hplc 12 0.8644 14 81
1msj-assembly1.cif.gz_A type iii antifreeze protein isoform hplc 12 t15v 0.8644 14 81
5xqv-assembly1.cif.gz_A crystal structure of notched-fin eelpout type iii antifreeze protein a20l mutant (nfe6, afp), p21 form 0.8637 15 81
ID Description Score Start End Superfamily
af_P75933_96_158_3.90.1210.10 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.8927 16 81 3.90.1210.10
af_A0A0G2L5X9_296_357_3.90.1210.10 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.8821 14 81 3.90.1210.10
af_Q9VG74_312_372_3.90.1210.10 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.8727 15 82 3.90.1210.10
5xqrB00 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.8638 15 81 3.90.1210.10
2lx3A00 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.8477 14 81 3.90.1210.10
ID Description Score Start End GO Terms
AF-A0A401TWM7-F1-model_v4 SAF domain-containing protein 0.9428 3 73
AF-A0A7X6EPB6-F1-model_v4 deleted 0.9361 5 77
AF-A0A537NUV1-F1-model_v4 Flp pilus assembly protein CpaB 0.9196 5 76
AF-A0A2V9Z019-F1-model_v4 Flp pilus assembly protein CpaB 0.8209 91 208
AF-A0A4V3V7A0-F1-model_v4 Flp pilus assembly protein CpaB 0.8184 94 208 GO:0016020

Feature Viewer

pLDDT pTM Quality
76.63 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map