F455648

General Info

Members Datasets Scaffolds Average Seq Length
501 247 1002 123

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_101202855|Ga0070671_1012028552
Length 135
Sequence VSDDAFTWRAGGCHCGGVRFEVALPAEVEAQTCNCSMCAKTGFVHIIVPESRFRLTKGAERLSEYSFNTRVAKHLFCVECGVKSFYRPRSNPDGWSVNARCLDSLDGVTLQVEAFDGQNWEANAAGLAHLSKEHA

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
166 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
167 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
168 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
169 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
170 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
174 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
183 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
189 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
209 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
210 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
211 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
215 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
216 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
217 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
220 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
221 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
222 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
223 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
224 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
225 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
226 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
227 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
228 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
229 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
230 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
231 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
232 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
233 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
234 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
235 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
238 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
239 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
240 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
241 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
242 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
243 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
244 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
245 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
246 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
247 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0
Isolates 1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.38
Nodule 0
Rhizoplane 3.39
Rhizosphere 82.04
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_101202855 3300005355 Bacteria 667
2 JGI24736J21556_1000110 3300001904 Bacteria 13961
3 JGI24741J21665_1005243 3300001915 Bacteria 2744
4 JGI24752J21851_1000117 3300001976 Bacteria 10849
5 JGI24752J21851_1000299 3300001976 Bacteria 6927
6 JGI24740J21852_10013639 3300001979 Bacteria 3024
7 JGI24740J21852_10079329 3300001979 Bacteria 863
8 JGI24739J22299_10003120 3300001989 Bacteria 6323
9 JGI24739J22299_10009998 3300001989 Bacteria 3527
10 JGI24739J22299_10059101 3300001989 Bacteria 1215
11 JGI24737J22298_10001852 3300001990 Bacteria 7565
12 JGI24737J22298_10005386 3300001990 Bacteria 4418
13 JGI24737J22298_10235397 3300001990 Bacteria 540
14 JGI24743J22301_10014867 3300001991 Bacteria 1438
15 JGI24743J22301_10016268 3300001991 Bacteria 1386
16 JGI24735J21928_10016408 3300002067 Bacteria 2297
17 JGI24735J21928_10027963 3300002067 Bacteria 1686
18 JGI24735J21928_10041379 3300002067 Bacteria 1343
19 JGI24735J21928_10041460 3300002067 Bacteria 1342
20 JGI24735J21928_10048876 3300002067 Bacteria 1223
21 JGI24735J21928_10079160 3300002067 Bacteria 941
22 JGI24735J21928_10222290 3300002067 Bacteria 549
23 JGI24750J21931_1000358 3300002070 Bacteria 7800
24 JGI24750J21931_1000504 3300002070 Bacteria 6125
25 JGI24748J21848_1000029 3300002074 Bacteria 90134
26 JGI24738J21930_10001537 3300002075 Bacteria 6363
27 JGI24738J21930_10020090 3300002075 Bacteria 1389
28 JGI24749J21850_1000261 3300002076 Bacteria 8195
29 JGI24744J21845_10000726 3300002077 Bacteria 6086
30 JGI24034J26672_10000006 3300002239 Bacteria 294495
31 JGI24742J22300_10001153 3300002244 Bacteria 4101
32 JGI24751J29686_10000225 3300002459 Bacteria 23753
33 JGI24751J29686_10014058 3300002459 Bacteria 1652
34 JGI25165J46597_1000106 3300003214 Bacteria 151139
35 Ga0055542_1022713 3300003762 Bacteria 889
36 JGI25405J52794_10026775 3300003911 Bacteria 1186
37 Ga0065704_10078300 3300005289 Bacteria 4470
38 Ga0065707_10082105 3300005295 Bacteria 21836
39 Ga0065707_10090132 3300005295 Bacteria 4202
40 Ga0065707_10210508 3300005295 Bacteria 1268
41 Ga0065707_10248241 3300005295 Bacteria 1133
42 Ga0070658_10000478 3300005327 Bacteria 34694
43 Ga0070658_10005193 3300005327 Bacteria 10592
44 Ga0070658_10026624 3300005327 Bacteria 4640
45 Ga0070658_10357618 3300005327 Bacteria 1250
46 Ga0070676_10001299 3300005328 Bacteria 12568
47 Ga0070676_10101437 3300005328 Bacteria 1778
48 Ga0070683_100341959 3300005329 Bacteria 1425
49 Ga0070690_100000002 3300005330 Bacteria 176748
50 Ga0070670_100000005 3300005331 Bacteria 351569
51 Ga0070670_100000021 3300005331 Bacteria 202776
52 Ga0070670_100399374 3300005331 Bacteria 1213
53 Ga0068869_100000134 3300005334 Bacteria 35796
54 Ga0070666_10000002 3300005335 Bacteria 478684
55 Ga0070666_10031628 3300005335 Bacteria 3494
56 Ga0070666_10894948 3300005335 Bacteria 656
57 Ga0068868_100000596 3300005338 Bacteria 24264
58 Ga0070660_100000924 3300005339 Bacteria 19633
59 Ga0070660_100008479 3300005339 Bacteria 7192
60 Ga0070660_100097877 3300005339 Bacteria 2321
61 Ga0070660_100131796 3300005339 Bacteria 2001
62 Ga0070660_100227827 3300005339 Bacteria 1516
63 Ga0070660_100867231 3300005339 Bacteria 760
64 Ga0070689_100015422 3300005340 Bacteria 5571
65 Ga0070689_101272897 3300005340 Bacteria 662
66 Ga0070661_100459089 3300005344 Bacteria 1014
67 Ga0070661_100523807 3300005344 Bacteria 951
68 Ga0070661_101360426 3300005344 Bacteria 597
69 Ga0070661_101914963 3300005344 Bacteria 504
70 Ga0070669_100000057 3300005353 Bacteria 110803
71 Ga0070669_100000078 3300005353 Bacteria 94641
72 Ga0070675_100013296 3300005354 Bacteria 6468
73 Ga0070675_100774683 3300005354 Bacteria 876
74 Ga0070671_100072139 3300005355 Bacteria 2883
75 Ga0070671_100093011 3300005355 Bacteria 2527
76 Ga0070674_100008746 3300005356 Bacteria 6040
77 Ga0070674_100324777 3300005356 Bacteria 1235
78 Ga0070673_100000004 3300005364 Bacteria 199809
79 Ga0070673_100311721 3300005364 Bacteria 1388
80 Ga0070688_100056513 3300005365 Bacteria 2465
81 Ga0070659_100044363 3300005366 Bacteria 3480
82 Ga0070659_100044556 3300005366 Bacteria 3473
83 Ga0070659_100220115 3300005366 Bacteria 1566
84 Ga0070659_100486004 3300005366 Bacteria 1051
85 Ga0070659_100493993 3300005366 Bacteria 1042
86 Ga0070667_100000016 3300005367 Bacteria 237028
87 Ga0070667_100000750 3300005367 Bacteria 30912
88 Ga0070667_100001565 3300005367 Bacteria 20500
89 Ga0070667_101299029 3300005367 Bacteria 682
90 Ga0070667_101725606 3300005367 Bacteria 589
91 Ga0070708_100489495 3300005445 Bacteria 1160
92 Ga0070663_100018206 3300005455 Bacteria 4599
93 Ga0070663_100018496 3300005455 Bacteria 4571
94 Ga0070663_100027240 3300005455 Bacteria 3879
95 Ga0070678_100012107 3300005456 Bacteria 5348
96 Ga0070662_100010265 3300005457 Bacteria 6140
97 Ga0070662_100220529 3300005457 Bacteria 1513
98 Ga0068867_100000028 3300005459 Bacteria 87716
99 Ga0070685_10000056 3300005466 Bacteria 68183
100 Ga0070698_100433002 3300005471 Bacteria 1250
101 Ga0070684_100154408 3300005535 Bacteria 2081
102 Ga0070684_101982406 3300005535 Bacteria 549
103 Ga0068853_100006114 3300005539 Bacteria 9533
104 Ga0068853_100148011 3300005539 Bacteria 2112
105 Ga0068853_100272162 3300005539 Bacteria 1560
106 Ga0068853_100323511 3300005539 Bacteria 1430
107 Ga0068853_100779933 3300005539 Bacteria 914
108 Ga0070672_100128724 3300005543 Bacteria 2079
109 Ga0070686_100000002 3300005544 Bacteria 336303
110 Ga0070665_100000025 3300005548 Bacteria 367488
111 Ga0068855_100065569 3300005563 Bacteria 4234
112 Ga0068855_100078239 3300005563 Bacteria 3837
113 Ga0068855_100527389 3300005563 Bacteria 1280
114 Ga0068855_101369930 3300005563 Bacteria 730
115 Ga0070664_100391637 3300005564 Bacteria 1270
116 Ga0068857_100041395 3300005577 Bacteria 4086
117 Ga0068857_100391879 3300005577 Bacteria 1291
118 Ga0068857_101378234 3300005577 Bacteria 685
119 Ga0068854_100000881 3300005578 Bacteria 18023
120 Ga0068854_100015321 3300005578 Bacteria 5076
121 Ga0068854_100100041 3300005578 Bacteria 2172
122 Ga0068854_100122686 3300005578 Bacteria 1975
123 Ga0068854_100557892 3300005578 Bacteria 972
124 Ga0068852_100106310 3300005616 Bacteria 2544
125 Ga0068852_100216308 3300005616 Bacteria 1820
126 Ga0068852_100503079 3300005616 Bacteria 1207
127 Ga0068852_100933082 3300005616 Bacteria 886
128 Ga0068859_100002060 3300005617 Bacteria 20516
129 Ga0068859_100040411 3300005617 Bacteria 4682
130 Ga0068859_100044577 3300005617 Bacteria 4457
131 Ga0068859_100426232 3300005617 Bacteria 1423
132 Ga0068864_100000004 3300005618 Bacteria 489341
133 Ga0068864_100000011 3300005618 Bacteria 350056
134 Ga0068864_100987635 3300005618 Bacteria 834
135 Ga0068866_10068610 3300005718 Bacteria 1865
136 Ga0068861_100003702 3300005719 Bacteria 10200
137 Ga0068861_100009174 3300005719 Bacteria 6823
138 Ga0068851_10060715 3300005834 Bacteria 1936
139 Ga0068851_10150821 3300005834 Bacteria 1270
140 Ga0068863_100000002 3300005841 Bacteria 489510
141 Ga0068863_100000070 3300005841 Bacteria 115715
142 Ga0068863_100090679 3300005841 Bacteria 2898
143 Ga0068858_100016855 3300005842 Bacteria 6860
144 Ga0068858_100072792 3300005842 Bacteria 3189
145 Ga0068860_100000001 3300005843 Bacteria 703043
146 Ga0068860_100000196 3300005843 Bacteria 97096
147 Ga0068862_100000002 3300005844 Bacteria 489341
148 Ga0068862_100000011 3300005844 Bacteria 270105
149 Ga0068862_100000020 3300005844 Bacteria 219516
150 Ga0081455_10001900 3300005937 Bacteria 25136
151 Ga0075362_10308588 3300006177 Bacteria 786
152 Ga0097621_100004543 3300006237 Bacteria 9677
153 Ga0097621_100638379 3300006237 Bacteria 976
154 Ga0075370_10005832 3300006353 Bacteria 6152
155 Ga0068871_101136377 3300006358 Bacteria 731
156 Ga0068871_101975478 3300006358 Bacteria 555
157 Ga0068865_100000006 3300006881 Bacteria 201186
158 Ga0097620_100002060 3300006931 Bacteria 20516
159 Ga0097620_100040412 3300006931 Bacteria 4682
160 Ga0097620_100044577 3300006931 Bacteria 4457
161 Ga0097620_100426211 3300006931 Bacteria 1423
162 Ga0105251_10001395 3300009011 Bacteria 20854
163 Ga0105240_10008281 3300009093 Bacteria 14883
164 Ga0105240_10052322 3300009093 Bacteria 5135
165 Ga0105240_10233073 3300009093 Bacteria 2138
166 Ga0105240_10257552 3300009093 Bacteria 2014
167 Ga0105240_10313950 3300009093 Bacteria 1789
168 Ga0105240_11244915 3300009093 Bacteria 787
169 Ga0105240_12289617 3300009093 Bacteria 560
170 Ga0105245_10001073 3300009098 Bacteria 24782
171 Ga0105247_10007084 3300009101 Bacteria 6887
172 Ga0105247_10025182 3300009101 Bacteria 3590
173 Ga0105243_10001033 3300009148 Bacteria 25571
174 Ga0105241_10147951 3300009174 Bacteria 1918
175 Ga0105241_10374869 3300009174 Bacteria 1242
176 Ga0105242_10000413 3300009176 Bacteria 34034
177 Ga0105248_10000010 3300009177 Bacteria 344314
178 Ga0105248_10000406 3300009177 Bacteria 49988
179 Ga0105248_10014736 3300009177 Bacteria 8608
180 Ga0105237_10050433 3300009545 Bacteria 4181
181 Ga0105237_10065333 3300009545 Bacteria 3635
182 Ga0105237_10165183 3300009545 Bacteria 2212
183 Ga0105237_11140661 3300009545 Bacteria 786
184 Ga0105237_11348132 3300009545 Bacteria 720
185 Ga0105238_10216404 3300009551 Bacteria 1892
186 Ga0105238_10232627 3300009551 Bacteria 1819
187 Ga0105238_10296612 3300009551 Bacteria 1600
188 Ga0105238_10808153 3300009551 Bacteria 953
189 Ga0105238_11007106 3300009551 Bacteria 854
190 Ga0105238_11262110 3300009551 Bacteria 764
191 Ga0105249_10000041 3300009553 Bacteria 195999
192 Ga0105249_10019332 3300009553 Bacteria 6076
193 Ga0105249_10190267 3300009553 Bacteria 2002
194 Ga0105239_10000694 3300010375 Bacteria 47928
195 Ga0105239_10236976 3300010375 Bacteria 2048
196 Ga0105239_10597771 3300010375 Bacteria 1258
197 Ga0105239_11397139 3300010375 Bacteria 808
198 Ga0105246_10002567 3300011119 Bacteria 10983
199 Ga0157373_10021371 3300013100 Bacteria 4701
200 Ga0157373_10194892 3300013100 Bacteria 1428
201 Ga0157373_10689590 3300013100 Bacteria 748
202 Ga0157371_11188315 3300013102 Bacteria 587
203 Ga0157370_10000318 3300013104 Bacteria 60585
204 Ga0157370_10378766 3300013104 Bacteria 1303
205 Ga0157370_10541196 3300013104 Bacteria 1068
206 Ga0157369_10018433 3300013105 Bacteria 7826
207 Ga0157369_10139389 3300013105 Bacteria 2567
208 Ga0157369_10213671 3300013105 Bacteria 2021
209 Ga0157369_11480111 3300013105 Bacteria 691
210 Ga0157374_10004031 3300013296 Bacteria 12342
211 Ga0157378_10001466 3300013297 Bacteria 21299
212 Ga0157378_10014891 3300013297 Bacteria 6805
213 Ga0163162_10348255 3300013306 Bacteria 1614
214 Ga0163162_10556341 3300013306 Bacteria 1275
215 Ga0163162_11192092 3300013306 Bacteria 864
216 Ga0163162_11232842 3300013306 Bacteria 849
217 Ga0157372_10061610 3300013307 Bacteria 4202
218 Ga0157372_10077218 3300013307 Bacteria 3761
219 Ga0157372_10514172 3300013307 Bacteria 1396
220 Ga0157372_10525783 3300013307 Bacteria 1379
221 Ga0157372_11163519 3300013307 Bacteria 892
222 Ga0157375_10000586 3300013308 Bacteria 32467
223 Ga0163163_10017089 3300014325 Bacteria 6757
224 Ga0157380_10000031 3300014326 Bacteria 90245
225 Ga0157380_10001415 3300014326 Bacteria 15694
226 Ga0157380_10118075 3300014326 Bacteria 2242
227 Ga0157379_10008271 3300014968 Bacteria 9039
228 Ga0157379_10068801 3300014968 Bacteria 3165
229 Ga0157379_10725409 3300014968 Bacteria 934
230 Ga0157376_10000347 3300014969 Bacteria 30895
231 Ga0163161_10002791 3300017792 Bacteria 12382
232 Ga0163161_10123837 3300017792 Bacteria 1945
233 Ga0163161_10356050 3300017792 Bacteria 1165
234 Ga0209026_1005077 3300025250 Bacteria 3654
235 Ga0209148_1002373 3300025254 Bacteria 6611
236 Ga0209233_1000003 3300025261 Bacteria 1607366
237 Ga0209455_1000441 3300025272 Bacteria 32004
238 Ga0207656_10093619 3300025321 Bacteria 1368
239 Ga0207656_10460397 3300025321 Bacteria 643
240 Ga0207710_10040389 3300025900 Bacteria 2067
241 Ga0207680_10000004 3300025903 Bacteria 827324
242 Ga0207680_10005149 3300025903 Bacteria 6239
243 Ga0207647_10000069 3300025904 Bacteria 80952
244 Ga0207647_10053075 3300025904 Bacteria 2500
245 Ga0207647_10058505 3300025904 Bacteria 2360
246 Ga0207647_10266603 3300025904 Bacteria 980
247 Ga0207645_10003000 3300025907 Bacteria 13042
248 Ga0207645_10059264 3300025907 Bacteria 2445
249 Ga0207705_10000049 3300025909 Bacteria 170616
250 Ga0207705_10000119 3300025909 Bacteria 88108
251 Ga0207705_10000903 3300025909 Bacteria 24279
252 Ga0207705_10137457 3300025909 Bacteria 1823
253 Ga0207705_10200499 3300025909 Bacteria 1512
254 Ga0207654_10278499 3300025911 Bacteria 1131
255 Ga0207654_10567160 3300025911 Bacteria 808
256 Ga0207695_10080676 3300025913 Bacteria 3294
257 Ga0207695_10119320 3300025913 Bacteria 2608
258 Ga0207695_10395768 3300025913 Bacteria 1266
259 Ga0207695_11324229 3300025913 Bacteria 601
260 Ga0207671_10001601 3300025914 Bacteria 25733
261 Ga0207671_10053198 3300025914 Bacteria 3000
262 Ga0207671_10132162 3300025914 Bacteria 1916
263 Ga0207657_10002263 3300025919 Bacteria 20875
264 Ga0207657_10002725 3300025919 Bacteria 19022
265 Ga0207657_10080857 3300025919 Bacteria 2731
266 Ga0207657_10089130 3300025919 Bacteria 2578
267 Ga0207657_10124996 3300025919 Bacteria 2113
268 Ga0207657_10231737 3300025919 Bacteria 1477
269 Ga0207657_10291944 3300025919 Bacteria 1293
270 Ga0207649_10010670 3300025920 Bacteria 5051
271 Ga0207649_10257316 3300025920 Bacteria 1260
272 Ga0207649_10270260 3300025920 Bacteria 1232
273 Ga0207649_11044008 3300025920 Bacteria 644
274 Ga0207681_10000001 3300025923 Bacteria 1105841
275 Ga0207681_10000130 3300025923 Bacteria 61067
276 Ga0207694_10002944 3300025924 Bacteria 13673
277 Ga0207694_10085601 3300025924 Bacteria 2481
278 Ga0207694_10549544 3300025924 Bacteria 969
279 Ga0207694_11211053 3300025924 Bacteria 639
280 Ga0207650_10000018 3300025925 Bacteria 352120
281 Ga0207650_10000298 3300025925 Bacteria 49421
282 Ga0207659_10007115 3300025926 Bacteria 6870
283 Ga0207659_10701431 3300025926 Bacteria 867
284 Ga0207687_10021138 3300025927 Bacteria 4320
285 Ga0207644_10018489 3300025931 Bacteria 4716
286 Ga0207644_10049340 3300025931 Bacteria 3013
287 Ga0207644_10074769 3300025931 Bacteria 2487
288 Ga0207644_10662973 3300025931 Bacteria 869
289 Ga0207690_10007558 3300025932 Bacteria 6451
290 Ga0207690_10258953 3300025932 Bacteria 1347
291 Ga0207690_10365942 3300025932 Bacteria 1143
292 Ga0207690_10674764 3300025932 Bacteria 848
293 Ga0207690_10760939 3300025932 Bacteria 799
294 Ga0207706_10020553 3300025933 Bacteria 5934
295 Ga0207706_10409298 3300025933 Bacteria 1175
296 Ga0207706_10443095 3300025933 Bacteria 1124
297 Ga0207686_10093070 3300025934 Bacteria 1995
298 Ga0207709_10000182 3300025935 Bacteria 83442
299 Ga0207670_10007972 3300025936 Bacteria 5951
300 Ga0207669_10005013 3300025937 Bacteria 5889
301 Ga0207669_10135430 3300025937 Bacteria 1700
302 Ga0207704_10000022 3300025938 Bacteria 146109
303 Ga0207691_10083198 3300025940 Bacteria 2873
304 Ga0207711_10000038 3300025941 Bacteria 163520
305 Ga0207711_10006432 3300025941 Bacteria 9891
306 Ga0207711_10009854 3300025941 Bacteria 7946
307 Ga0207689_10000462 3300025942 Bacteria 38064
308 Ga0207689_10843337 3300025942 Bacteria 773
309 Ga0207667_10033105 3300025949 Bacteria 5561
310 Ga0207667_10063803 3300025949 Bacteria 3849
311 Ga0207667_10490963 3300025949 Bacteria 1246
312 Ga0207667_11391781 3300025949 Bacteria 675
313 Ga0207667_12076629 3300025949 Bacteria 527
314 Ga0207651_10000009 3300025960 Bacteria 199913
315 Ga0207712_10000001 3300025961 Bacteria 750309
316 Ga0207712_10009745 3300025961 Bacteria 6086
317 Ga0207712_10013288 3300025961 Bacteria 5278
318 Ga0207712_10304950 3300025961 Bacteria 1308
319 Ga0207640_10000021 3300025981 Bacteria 168138
320 Ga0207640_10167977 3300025981 Bacteria 1631
321 Ga0207640_10350270 3300025981 Bacteria 1186
322 Ga0207640_10661640 3300025981 Bacteria 891
323 Ga0207640_10751497 3300025981 Bacteria 841
324 Ga0207658_10000075 3300025986 Bacteria 109004
325 Ga0207658_10000350 3300025986 Bacteria 45928
326 Ga0207658_10000474 3300025986 Bacteria 37159
327 Ga0207658_10001041 3300025986 Bacteria 22533
328 Ga0207677_10000164 3300026023 Bacteria 52688
329 Ga0207703_10009056 3300026035 Bacteria 7838
330 Ga0207639_10050735 3300026041 Bacteria 3152
331 Ga0207639_10102332 3300026041 Bacteria 2318
332 Ga0207639_10131587 3300026041 Bacteria 2072
333 Ga0207639_10221999 3300026041 Bacteria 1633
334 Ga0207639_10229412 3300026041 Bacteria 1608
335 Ga0207678_10028170 3300026067 Bacteria 4905
336 Ga0207678_10037533 3300026067 Bacteria 4214
337 Ga0207678_10081423 3300026067 Bacteria 2771
338 Ga0207702_10060037 3300026078 Bacteria 3241
339 Ga0207641_10000002 3300026088 Bacteria 981004
340 Ga0207641_10000033 3300026088 Bacteria 219261
341 Ga0207641_10001366 3300026088 Bacteria 24146
342 Ga0207648_10000084 3300026089 Bacteria 88578
343 Ga0207676_10000004 3300026095 Bacteria 725417
344 Ga0207676_10000005 3300026095 Bacteria 698744
345 Ga0207676_10068058 3300026095 Bacteria 2846
346 Ga0207674_10046831 3300026116 Bacteria 4438
347 Ga0207674_10282895 3300026116 Bacteria 1607
348 Ga0207675_100001662 3300026118 Bacteria 22254
349 Ga0207675_100003358 3300026118 Bacteria 15642
350 Ga0207683_10002643 3300026121 Bacteria 15651
351 Ga0207698_10042180 3300026142 Bacteria 3406
352 Ga0207698_10329026 3300026142 Bacteria 1434
353 Ga0207698_10345459 3300026142 Unclassified 1403
354 Ga0207698_10771396 3300026142 Bacteria 962
355 Ga0207698_10890277 3300026142 Bacteria 897
356 Ga0268266_10000028 3300028379 Bacteria 425294
357 Ga0268265_10000002 3300028380 Bacteria 1035381
358 Ga0268265_10000003 3300028380 Bacteria 949201
359 Ga0268265_10000524 3300028380 Bacteria 39127
360 Ga0268264_10000006 3300028381 Bacteria 827324
361 Ga0268264_10000087 3300028381 Bacteria 236696
362 Ga0307517_10271038 3300028786 Bacteria 976
363 Ga0307408_100328685 3300031548 Bacteria 1290
364 Ga0307405_10031784 3300031731 Bacteria 3112
365 Ga0307406_11609227 3300031901 Bacteria 574
366 Ga0307406_11776098 3300031901 Bacteria 548
367 Ga0307412_10004683 3300031911 Bacteria 7632
368 Ga0307412_10254470 3300031911 Bacteria 1365
369 Ga0307412_10347690 3300031911 Bacteria 1189
370 Ga0307416_100368221 3300032002 Bacteria 1462
371 Ga0307414_11696763 3300032004 Bacteria 589
372 Ga0373944_0037555 3300035089 Bacteria 1484
373 Ga0395899_0005461 3300037312 Bacteria 9859
374 Ga0395899_0642436 3300037312 Bacteria 671
375 Ga0395900_0760926 3300037418 Bacteria 898
376 Ga0395900_0821917 3300037418 Bacteria 856
377 Ga0395905_0016931 3300037471 Bacteria 6924
378 Ga0395905_0107151 3300037471 Bacteria 2624
379 Ga0395905_0164136 3300037471 Bacteria 2087
380 Ga0436360_0243841 3300039438 Bacteria 898
381 Ga0436361_0144463 3300039447 Bacteria 26892
382 Ga0451795_0962454 3300041456 Bacteria 1053
383 Ga0451802_0219098 3300041460 Bacteria 727
384 Ga0451806_247531 3300041462 Bacteria 2986
385 Ga0451807_0392172 3300041486 Bacteria 1483
386 Ga0451807_0576451 3300041486 Bacteria 718
387 Ga0451845_0286583 3300041501 Bacteria 617
388 Ga0451849_0362350 3300041505 Bacteria 1178
389 Ga0451853_1098147 3300041512 Bacteria 1547
390 Ga0439448_0001214 3300042005 Bacteria 6581
391 Ga0439448_0003054 3300042005 Bacteria 4599
392 Ga0439455_0004709 3300042012 Bacteria 2721
393 Ga0439455_0033123 3300042012 Bacteria 1294
394 Ga0439458_0004082 3300042157 Bacteria 3368
395 Ga0466968_0464791 3300044735 Bacteria 627
396 Ga0495638_0029588 3300046460 Bacteria 3532
397 Ga0495638_0084921 3300046460 Bacteria 1915
398 Ga0495585_0361530 3300046492 Bacteria 704
399 Ga0495583_0000139 3300046506 Bacteria 123464
400 Ga0495606_0004048 3300046507 Bacteria 14949
401 Ga0495606_0190150 3300046507 Bacteria 1177
402 Ga0495637_0015420 3300046520 Bacteria 3583
403 Ga0495643_0038139 3300046522 Bacteria 2633
404 Ga0495643_0089040 3300046522 Bacteria 1595
405 Ga0495663_0011281 3300046525 Bacteria 2487
406 Ga0495654_0000736 3300046530 Bacteria 25435
407 Ga0495668_0001456 3300046616 Bacteria 22791
408 Ga0495668_0024118 3300046616 Bacteria 3461
409 Ga0495668_0049366 3300046616 Bacteria 2334
410 Ga0495661_0034003 3300046665 Bacteria 3211
411 Ga0495589_0079391 3300046794 Bacteria 1597
412 Ga0495672_0055722 3300047320 Bacteria 2305
413 Ga0495683_0236447 3300047323 Bacteria 808
414 Ga0495673_0009614 3300047469 Bacteria 5334
415 Ga0495686_0000182 3300047472 Bacteria 119682
416 Ga0495686_0001320 3300047472 Bacteria 27790
417 Ga0495686_0002610 3300047472 Bacteria 16704
418 Ga0495686_0019589 3300047472 Bacteria 4521
419 Ga0496101_0153963 3300048904 Bacteria 1760
420 Ga0496102_0011371 3300048905 Bacteria 7670
421 Ga0496102_0624754 3300048905 Bacteria 1000
422 Ga0496103_0008918 3300048906 Bacteria 5945
423 Ga0496103_0270109 3300048906 Bacteria 1094
424 Ga0496104_0468293 3300048907 Bacteria 1171
425 Ga0496105_0089541 3300048908 Bacteria 2542
426 Ga0496105_1404732 3300048908 Bacteria 505
427 Ga0496106_0076114 3300048909 Bacteria 2572
428 Ga0496107_0079931 3300048910 Bacteria 2384
429 Ga0496110_0073425 3300048913 Bacteria 3036
430 Ga0496111_0275718 3300048914 Bacteria 1248
431 Ga0496116_0032283 3300048919 Bacteria 3735
432 Ga0496117_0002989 3300048920 Bacteria 20363
433 Ga0496117_0004127 3300048920 Bacteria 16262
434 Ga0496117_0023979 3300048920 Bacteria 4843
435 Ga0496117_0073876 3300048920 Bacteria 2273
436 Ga0496117_0437214 3300048920 Bacteria 650
437 Ga0496118_0000463 3300048921 Bacteria 67382
438 Ga0496118_0020700 3300048921 Bacteria 5824
439 Ga0496118_0041401 3300048921 Bacteria 3648
440 Ga0496118_0084326 3300048921 Bacteria 2217
441 Ga0496118_0121995 3300048921 Bacteria 1696
442 Ga0496118_0257353 3300048921 Bacteria 988
443 Ga0496121_0010236 3300048924 Bacteria 10612
444 Ga0496121_0134874 3300048924 Bacteria 1841
445 Ga0496122_0013706 3300048925 Bacteria 7909
446 Ga0496122_0035124 3300048925 Bacteria 4086
447 Ga0496123_0009700 3300048926 Bacteria 8631
448 Ga0496123_0014602 3300048926 Bacteria 6495
449 Ga0496123_0106060 3300048926 Bacteria 1620
450 Ga0496124_0009261 3300048927 Bacteria 10157
451 Ga0496124_0918067 3300048927 Bacteria 529
452 Ga0496125_0323694 3300048928 Bacteria 933
453 Ga0495678_046482 3300049459 Bacteria 1706
454 Ga0501290_001796 3300049513 Bacteria 2851
455 Ga0501299_013381 3300049522 Bacteria 1414
456 Ga0501300_007119 3300049523 Bacteria 1640
457 Ga0501033_0440606 3300049570 Bacteria 906
458 Ga0501071_0729736 3300049587 Bacteria 763
459 Ga0501257_000012 3300049686 Bacteria 51962
460 Ga0501280_001885 3300049776 Bacteria 3666
461 Ga0501282_003357 3300049778 Bacteria 1726
462 nmdc:mga03683_216057_c1 3300050489 Bacteria 883
463 nmdc:mga0k408_83084_c1 3300050493 Bacteria 1877
464 Ga0500643_000215 3300053087 Bacteria 54391
465 Ga0500643_002098 3300053087 Bacteria 10611
466 Ga0500651_0027888 3300053093 Bacteria 3551
467 Ga0500566_0167500 3300053094 Bacteria 1139
468 Ga0500641_0326747 3300053096 Bacteria 622
469 Ga0500555_000188 3300053103 Bacteria 28317
470 Ga0500555_028998 3300053103 Bacteria 1574
471 Ga0500556_0244888 3300053104 Bacteria 706
472 Ga0500592_000065 3300053116 Bacteria 28864
473 Ga0500592_000255 3300053116 Bacteria 9553
474 Ga0500608_226880 3300053122 Bacteria 749
475 Ga0500618_036783 3300053125 Bacteria 1133
476 Ga0500642_0001739 3300053130 Bacteria 6280
477 Ga0500655_000070 3300053133 Bacteria 27417
478 Ga0500658_0046162 3300053134 Bacteria 1763
479 Ga0500559_0090092 3300053136 Bacteria 1403
480 Ga0500573_0217348 3300053140 Bacteria 1005
481 Ga0500577_0007077 3300053142 Bacteria 3130
482 Ga0500577_0203703 3300053142 Bacteria 854
483 Ga0500577_0366702 3300053142 Bacteria 630
484 Ga0500590_002815 3300053148 Bacteria 7857
485 Ga0500604_0042035 3300053151 Bacteria 1384
486 Ga0500604_0090261 3300053151 Bacteria 1000
487 Ga0500616_0010388 3300053153 Bacteria 5573
488 Ga0500616_0017809 3300053153 Bacteria 4025
489 Ga0500622_0004866 3300053156 Bacteria 8220
490 Ga0500627_0000086 3300053158 Bacteria 31214
491 Ga0500627_0000569 3300053158 Bacteria 9931
492 Ga0500636_0397237 3300053177 Bacteria 641
493 Ga0500636_0533759 3300053177 Bacteria 511
494 Ga0500570_000067 3300053724 Bacteria 27420
495 Ga0500611_024256 3300053727 Bacteria 1189
496 Ga0500645_035533 3300053730 Bacteria 1484
497 2585262075 2582581305 Bacteria 4895574
498 2643730583 2643221541 Bacteria 5498788
499 2644037575 2643221605 Bacteria 4772303
500 2644043752 2643221606 Bacteria 5588032
501 2644393911 2643221671 Bacteria 5496681
502 Ga0070671_101202855
503 JGI24736J21556_1000110
504 JGI24741J21665_1005243
505 JGI24752J21851_1000117
506 JGI24752J21851_1000299
507 JGI24740J21852_10013639
508 JGI24740J21852_10079329
509 JGI24739J22299_10003120
510 JGI24739J22299_10009998
511 JGI24739J22299_10059101
512 JGI24737J22298_10001852
513 JGI24737J22298_10005386
514 JGI24737J22298_10235397
515 JGI24743J22301_10014867
516 JGI24743J22301_10016268
517 JGI24735J21928_10016408
518 JGI24735J21928_10027963
519 JGI24735J21928_10041379
520 JGI24735J21928_10041460
521 JGI24735J21928_10048876
522 JGI24735J21928_10079160
523 JGI24735J21928_10222290
524 JGI24750J21931_1000358
525 JGI24750J21931_1000504
526 JGI24748J21848_1000029
527 JGI24738J21930_10001537
528 JGI24738J21930_10020090
529 JGI24749J21850_1000261
530 JGI24744J21845_10000726
531 JGI24034J26672_10000006
532 JGI24742J22300_10001153
533 JGI24751J29686_10000225
534 JGI24751J29686_10014058
535 JGI25165J46597_1000106
536 Ga0055542_1022713
537 JGI25405J52794_10026775
538 Ga0065704_10078300
539 Ga0065707_10082105
540 Ga0065707_10090132
541 Ga0065707_10210508
542 Ga0065707_10248241
543 Ga0070658_10000478
544 Ga0070658_10005193
545 Ga0070658_10026624
546 Ga0070658_10357618
547 Ga0070676_10001299
548 Ga0070676_10101437
549 Ga0070683_100341959
550 Ga0070690_100000002
551 Ga0070670_100000005
552 Ga0070670_100000021
553 Ga0070670_100399374
554 Ga0068869_100000134
555 Ga0070666_10000002
556 Ga0070666_10031628
557 Ga0070666_10894948
558 Ga0068868_100000596
559 Ga0070660_100000924
560 Ga0070660_100008479
561 Ga0070660_100097877
562 Ga0070660_100131796
563 Ga0070660_100227827
564 Ga0070660_100867231
565 Ga0070689_100015422
566 Ga0070689_101272897
567 Ga0070661_100459089
568 Ga0070661_100523807
569 Ga0070661_101360426
570 Ga0070661_101914963
571 Ga0070669_100000057
572 Ga0070669_100000078
573 Ga0070675_100013296
574 Ga0070675_100774683
575 Ga0070671_100072139
576 Ga0070671_100093011
577 Ga0070674_100008746
578 Ga0070674_100324777
579 Ga0070673_100000004
580 Ga0070673_100311721
581 Ga0070688_100056513
582 Ga0070659_100044363
583 Ga0070659_100044556
584 Ga0070659_100220115
585 Ga0070659_100486004
586 Ga0070659_100493993
587 Ga0070667_100000016
588 Ga0070667_100000750
589 Ga0070667_100001565
590 Ga0070667_101299029
591 Ga0070667_101725606
592 Ga0070708_100489495
593 Ga0070663_100018206
594 Ga0070663_100018496
595 Ga0070663_100027240
596 Ga0070678_100012107
597 Ga0070662_100010265
598 Ga0070662_100220529
599 Ga0068867_100000028
600 Ga0070685_10000056
601 Ga0070698_100433002
602 Ga0070684_100154408
603 Ga0070684_101982406
604 Ga0068853_100006114
605 Ga0068853_100148011
606 Ga0068853_100272162
607 Ga0068853_100323511
608 Ga0068853_100779933
609 Ga0070672_100128724
610 Ga0070686_100000002
611 Ga0070665_100000025
612 Ga0068855_100065569
613 Ga0068855_100078239
614 Ga0068855_100527389
615 Ga0068855_101369930
616 Ga0070664_100391637
617 Ga0068857_100041395
618 Ga0068857_100391879
619 Ga0068857_101378234
620 Ga0068854_100000881
621 Ga0068854_100015321
622 Ga0068854_100100041
623 Ga0068854_100122686
624 Ga0068854_100557892
625 Ga0068852_100106310
626 Ga0068852_100216308
627 Ga0068852_100503079
628 Ga0068852_100933082
629 Ga0068859_100002060
630 Ga0068859_100040411
631 Ga0068859_100044577
632 Ga0068859_100426232
633 Ga0068864_100000004
634 Ga0068864_100000011
635 Ga0068864_100987635
636 Ga0068866_10068610
637 Ga0068861_100003702
638 Ga0068861_100009174
639 Ga0068851_10060715
640 Ga0068851_10150821
641 Ga0068863_100000002
642 Ga0068863_100000070
643 Ga0068863_100090679
644 Ga0068858_100016855
645 Ga0068858_100072792
646 Ga0068860_100000001
647 Ga0068860_100000196
648 Ga0068862_100000002
649 Ga0068862_100000011
650 Ga0068862_100000020
651 Ga0081455_10001900
652 Ga0075362_10308588
653 Ga0097621_100004543
654 Ga0097621_100638379
655 Ga0075370_10005832
656 Ga0068871_101136377
657 Ga0068871_101975478
658 Ga0068865_100000006
659 Ga0097620_100002060
660 Ga0097620_100040412
661 Ga0097620_100044577
662 Ga0097620_100426211
663 Ga0105251_10001395
664 Ga0105240_10008281
665 Ga0105240_10052322
666 Ga0105240_10233073
667 Ga0105240_10257552
668 Ga0105240_10313950
669 Ga0105240_11244915
670 Ga0105240_12289617
671 Ga0105245_10001073
672 Ga0105247_10007084
673 Ga0105247_10025182
674 Ga0105243_10001033
675 Ga0105241_10147951
676 Ga0105241_10374869
677 Ga0105242_10000413
678 Ga0105248_10000010
679 Ga0105248_10000406
680 Ga0105248_10014736
681 Ga0105237_10050433
682 Ga0105237_10065333
683 Ga0105237_10165183
684 Ga0105237_11140661
685 Ga0105237_11348132
686 Ga0105238_10216404
687 Ga0105238_10232627
688 Ga0105238_10296612
689 Ga0105238_10808153
690 Ga0105238_11007106
691 Ga0105238_11262110
692 Ga0105249_10000041
693 Ga0105249_10019332
694 Ga0105249_10190267
695 Ga0105239_10000694
696 Ga0105239_10236976
697 Ga0105239_10597771
698 Ga0105239_11397139
699 Ga0105246_10002567
700 Ga0157373_10021371
701 Ga0157373_10194892
702 Ga0157373_10689590
703 Ga0157371_11188315
704 Ga0157370_10000318
705 Ga0157370_10378766
706 Ga0157370_10541196
707 Ga0157369_10018433
708 Ga0157369_10139389
709 Ga0157369_10213671
710 Ga0157369_11480111
711 Ga0157374_10004031
712 Ga0157378_10001466
713 Ga0157378_10014891
714 Ga0163162_10348255
715 Ga0163162_10556341
716 Ga0163162_11192092
717 Ga0163162_11232842
718 Ga0157372_10061610
719 Ga0157372_10077218
720 Ga0157372_10514172
721 Ga0157372_10525783
722 Ga0157372_11163519
723 Ga0157375_10000586
724 Ga0163163_10017089
725 Ga0157380_10000031
726 Ga0157380_10001415
727 Ga0157380_10118075
728 Ga0157379_10008271
729 Ga0157379_10068801
730 Ga0157379_10725409
731 Ga0157376_10000347
732 Ga0163161_10002791
733 Ga0163161_10123837
734 Ga0163161_10356050
735 Ga0209026_1005077
736 Ga0209148_1002373
737 Ga0209233_1000003
738 Ga0209455_1000441
739 Ga0207656_10093619
740 Ga0207656_10460397
741 Ga0207710_10040389
742 Ga0207680_10000004
743 Ga0207680_10005149
744 Ga0207647_10000069
745 Ga0207647_10053075
746 Ga0207647_10058505
747 Ga0207647_10266603
748 Ga0207645_10003000
749 Ga0207645_10059264
750 Ga0207705_10000049
751 Ga0207705_10000119
752 Ga0207705_10000903
753 Ga0207705_10137457
754 Ga0207705_10200499
755 Ga0207654_10278499
756 Ga0207654_10567160
757 Ga0207695_10080676
758 Ga0207695_10119320
759 Ga0207695_10395768
760 Ga0207695_11324229
761 Ga0207671_10001601
762 Ga0207671_10053198
763 Ga0207671_10132162
764 Ga0207657_10002263
765 Ga0207657_10002725
766 Ga0207657_10080857
767 Ga0207657_10089130
768 Ga0207657_10124996
769 Ga0207657_10231737
770 Ga0207657_10291944
771 Ga0207649_10010670
772 Ga0207649_10257316
773 Ga0207649_10270260
774 Ga0207649_11044008
775 Ga0207681_10000001
776 Ga0207681_10000130
777 Ga0207694_10002944
778 Ga0207694_10085601
779 Ga0207694_10549544
780 Ga0207694_11211053
781 Ga0207650_10000018
782 Ga0207650_10000298
783 Ga0207659_10007115
784 Ga0207659_10701431
785 Ga0207687_10021138
786 Ga0207644_10018489
787 Ga0207644_10049340
788 Ga0207644_10074769
789 Ga0207644_10662973
790 Ga0207690_10007558
791 Ga0207690_10258953
792 Ga0207690_10365942
793 Ga0207690_10674764
794 Ga0207690_10760939
795 Ga0207706_10020553
796 Ga0207706_10409298
797 Ga0207706_10443095
798 Ga0207686_10093070
799 Ga0207709_10000182
800 Ga0207670_10007972
801 Ga0207669_10005013
802 Ga0207669_10135430
803 Ga0207704_10000022
804 Ga0207691_10083198
805 Ga0207711_10000038
806 Ga0207711_10006432
807 Ga0207711_10009854
808 Ga0207689_10000462
809 Ga0207689_10843337
810 Ga0207667_10033105
811 Ga0207667_10063803
812 Ga0207667_10490963
813 Ga0207667_11391781
814 Ga0207667_12076629
815 Ga0207651_10000009
816 Ga0207712_10000001
817 Ga0207712_10009745
818 Ga0207712_10013288
819 Ga0207712_10304950
820 Ga0207640_10000021
821 Ga0207640_10167977
822 Ga0207640_10350270
823 Ga0207640_10661640
824 Ga0207640_10751497
825 Ga0207658_10000075
826 Ga0207658_10000350
827 Ga0207658_10000474
828 Ga0207658_10001041
829 Ga0207677_10000164
830 Ga0207703_10009056
831 Ga0207639_10050735
832 Ga0207639_10102332
833 Ga0207639_10131587
834 Ga0207639_10221999
835 Ga0207639_10229412
836 Ga0207678_10028170
837 Ga0207678_10037533
838 Ga0207678_10081423
839 Ga0207702_10060037
840 Ga0207641_10000002
841 Ga0207641_10000033
842 Ga0207641_10001366
843 Ga0207648_10000084
844 Ga0207676_10000004
845 Ga0207676_10000005
846 Ga0207676_10068058
847 Ga0207674_10046831
848 Ga0207674_10282895
849 Ga0207675_100001662
850 Ga0207675_100003358
851 Ga0207683_10002643
852 Ga0207698_10042180
853 Ga0207698_10329026
854 Ga0207698_10345459
855 Ga0207698_10771396
856 Ga0207698_10890277
857 Ga0268266_10000028
858 Ga0268265_10000002
859 Ga0268265_10000003
860 Ga0268265_10000524
861 Ga0268264_10000006
862 Ga0268264_10000087
863 Ga0307517_10271038
864 Ga0307408_100328685
865 Ga0307405_10031784
866 Ga0307406_11609227
867 Ga0307406_11776098
868 Ga0307412_10004683
869 Ga0307412_10254470
870 Ga0307412_10347690
871 Ga0307416_100368221
872 Ga0307414_11696763
873 Ga0373944_0037555
874 Ga0395899_0005461
875 Ga0395899_0642436
876 Ga0395900_0760926
877 Ga0395900_0821917
878 Ga0395905_0016931
879 Ga0395905_0107151
880 Ga0395905_0164136
881 Ga0436360_0243841
882 Ga0436361_0144463
883 Ga0451795_0962454
884 Ga0451802_0219098
885 Ga0451806_247531
886 Ga0451807_0392172
887 Ga0451807_0576451
888 Ga0451845_0286583
889 Ga0451849_0362350
890 Ga0451853_1098147
891 Ga0439448_0001214
892 Ga0439448_0003054
893 Ga0439455_0004709
894 Ga0439455_0033123
895 Ga0439458_0004082
896 Ga0466968_0464791
897 Ga0495638_0029588
898 Ga0495638_0084921
899 Ga0495585_0361530
900 Ga0495583_0000139
901 Ga0495606_0004048
902 Ga0495606_0190150
903 Ga0495637_0015420
904 Ga0495643_0038139
905 Ga0495643_0089040
906 Ga0495663_0011281
907 Ga0495654_0000736
908 Ga0495668_0001456
909 Ga0495668_0024118
910 Ga0495668_0049366
911 Ga0495661_0034003
912 Ga0495589_0079391
913 Ga0495672_0055722
914 Ga0495683_0236447
915 Ga0495673_0009614
916 Ga0495686_0000182
917 Ga0495686_0001320
918 Ga0495686_0002610
919 Ga0495686_0019589
920 Ga0496101_0153963
921 Ga0496102_0011371
922 Ga0496102_0624754
923 Ga0496103_0008918
924 Ga0496103_0270109
925 Ga0496104_0468293
926 Ga0496105_0089541
927 Ga0496105_1404732
928 Ga0496106_0076114
929 Ga0496107_0079931
930 Ga0496110_0073425
931 Ga0496111_0275718
932 Ga0496116_0032283
933 Ga0496117_0002989
934 Ga0496117_0004127
935 Ga0496117_0023979
936 Ga0496117_0073876
937 Ga0496117_0437214
938 Ga0496118_0000463
939 Ga0496118_0020700
940 Ga0496118_0041401
941 Ga0496118_0084326
942 Ga0496118_0121995
943 Ga0496118_0257353
944 Ga0496121_0010236
945 Ga0496121_0134874
946 Ga0496122_0013706
947 Ga0496122_0035124
948 Ga0496123_0009700
949 Ga0496123_0014602
950 Ga0496123_0106060
951 Ga0496124_0009261
952 Ga0496124_0918067
953 Ga0496125_0323694
954 Ga0495678_046482
955 Ga0501290_001796
956 Ga0501299_013381
957 Ga0501300_007119
958 Ga0501033_0440606
959 Ga0501071_0729736
960 Ga0501257_000012
961 Ga0501280_001885
962 Ga0501282_003357
963 nmdc:mga03683_216057_c1
964 nmdc:mga0k408_83084_c1
965 Ga0500643_000215
966 Ga0500643_002098
967 Ga0500651_0027888
968 Ga0500566_0167500
969 Ga0500641_0326747
970 Ga0500555_000188
971 Ga0500555_028998
972 Ga0500556_0244888
973 Ga0500592_000065
974 Ga0500592_000255
975 Ga0500608_226880
976 Ga0500618_036783
977 Ga0500642_0001739
978 Ga0500655_000070
979 Ga0500658_0046162
980 Ga0500559_0090092
981 Ga0500573_0217348
982 Ga0500577_0007077
983 Ga0500577_0203703
984 Ga0500577_0366702
985 Ga0500590_002815
986 Ga0500604_0042035
987 Ga0500604_0090261
988 Ga0500616_0010388
989 Ga0500616_0017809
990 Ga0500622_0004866
991 Ga0500627_0000086
992 Ga0500627_0000569
993 Ga0500636_0397237
994 Ga0500636_0533759
995 Ga0500570_000067
996 Ga0500611_024256
997 Ga0500645_035533
998 2585262075
999 2643730583
1000 2644037575
1001 2644043752
1002 2644393911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

31

118

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8301 5 107
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8189 1 101
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7879 5 107
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.6394 1 123
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.6304 1 123
ID Description Score Start End Superfamily
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8903 5 99 2.170.150.70
af_K7MPT9_9_124_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8849 6 119 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8849 5 100 2.170.150.70
af_K7MPT9_9_124_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8641 6 119 2.170.150.70
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8334 5 99 2.170.150.70
ID Description Score Start End GO Terms
AF-A0A382CKB3-F1-model_v4 CENP-V/GFA domain-containing protein 0.9749 39 100 GO:0016846
GO:0046872
AF-A0A2S6UP30-F1-model_v4 CENP-V/GFA domain-containing protein 0.9577 42 100 GO:0016846
GO:0046872
AF-A0A7W7ESE2-F1-model_v4 CENP-V/GFA domain-containing protein 0.9426 42 100 GO:0016846
GO:0046872
AF-A0A331GFE7-F1-model_v4 deleted 0.9387 42 100
AF-K0CAU2-F1-model_v4 Glutathione-dependent formaldehyde-activating GFA 0.9373 42 100 GO:0016846
GO:0046872

Map