F455583

General Info

Members Datasets Scaffolds Average Seq Length
500 253 1000 328

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0007203|Ga0466958_0007203_4967_6055
Length 362
Sequence MRAIASPMPDEPPVTSAARAIAPTVNGVEAAGLTSLSVGGGCAAKYSAARLDELLKGFVPAGAEDLLVGLDPADDAAVYRLDDERALVFTVDFFPPLVDDPTLFGRIAATNALNDVFAMGGTPLLALSVAAFPEELATDLVAAVFAGADEQVRAAGAILAGGHTIRDVEPKYGLAVVGTVHPDGVWVKSGAQPGDAVFLTKPLGTGLVLARKGDLEEAARWMTTLNDRAAQVLRPFSPHAVTDVTGFGLLGHAHETAERSGVRIRLEASTLPALDGALEAARDGIRTGGDPRNRDFAGAHVESDGVAEEVLALAYDAQTAGGLLVTLPAEKALSLEAEFERAGLFLARVGVVEEGAGVLLEP

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
93 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
94 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
98 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
130 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
191 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 9.2
Rhizosphere 90.2
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0007203 3300045836 Bacteria 6097
2 Ga0070658_10007291 3300005327 Bacteria 8927
3 Ga0070683_100095738 3300005329 Bacteria 2792
4 Ga0070683_100101655 3300005329 Bacteria 2707
5 Ga0070660_100026495 3300005339 Bacteria 4316
6 Ga0070691_10053598 3300005341 Bacteria 1930
7 Ga0070661_100034593 3300005344 Bacteria 3664
8 Ga0070675_100150264 3300005354 Bacteria 1997
9 Ga0070714_100011046 3300005435 Bacteria 7154
10 Ga0070714_100014958 3300005435 Bacteria 6237
11 Ga0070714_100024816 3300005435 Bacteria 4941
12 Ga0070714_100067907 3300005435 Unclassified 3076
13 Ga0070714_100084610 3300005435 Bacteria 2768
14 Ga0070714_100104605 3300005435 Bacteria 2498
15 Ga0070714_100141479 3300005435 Bacteria 2160
16 Ga0070713_100011866 3300005436 Bacteria 6368
17 Ga0070713_100067326 3300005436 Bacteria 3015
18 Ga0070710_10003409 3300005437 Bacteria 7531
19 Ga0070710_10013545 3300005437 Bacteria 4087
20 Ga0070701_10078785 3300005438 Bacteria 1779
21 Ga0070711_100011594 3300005439 Bacteria 5478
22 Ga0070711_100027387 3300005439 Bacteria 3742
23 Ga0070700_100048413 3300005441 Bacteria 2634
24 Ga0070708_100167334 3300005445 Bacteria 2051
25 Ga0070681_10058249 3300005458 Bacteria 3843
26 Ga0068867_100078597 3300005459 Bacteria 2481
27 Ga0070706_100451861 3300005467 Bacteria 1196
28 Ga0070707_100001067 3300005468 Bacteria 27041
29 Ga0070699_100101562 3300005518 Bacteria 2521
30 Ga0070699_100118175 3300005518 Bacteria 2330
31 Ga0070679_100058969 3300005530 Bacteria 3825
32 Ga0070679_100102617 3300005530 Bacteria 2846
33 Ga0070679_100176119 3300005530 Bacteria 2111
34 Ga0070684_100018317 3300005535 Bacteria 5767
35 Ga0070684_100063097 3300005535 Bacteria 3247
36 Ga0070695_100000028 3300005545 Bacteria 53880
37 Ga0070695_100087178 3300005545 Bacteria 2076
38 Ga0068855_100038872 3300005563 Bacteria 5651
39 Ga0068857_100009624 3300005577 Bacteria 8395
40 Ga0068857_100038748 3300005577 Bacteria 4219
41 Ga0068856_100046531 3300005614 Bacteria 4273
42 Ga0068856_100137304 3300005614 Bacteria 2451
43 Ga0070702_100028703 3300005615 Bacteria 3017
44 Ga0070702_100095650 3300005615 Bacteria 1811
45 Ga0068852_100074865 3300005616 Bacteria 2984
46 Ga0068861_100125028 3300005719 Bacteria 2080
47 Ga0068858_100047080 3300005842 Bacteria 3999
48 Ga0081539_10002688 3300005985 Bacteria 24146
49 Ga0081539_10020490 3300005985 Bacteria 4466
50 Ga0070717_10001757 3300006028 Bacteria 15091
51 Ga0070717_10019063 3300006028 Bacteria 5372
52 Ga0070715_10001705 3300006163 Bacteria 6533
53 Ga0070716_100000830 3300006173 Bacteria 13319
54 Ga0070712_100042445 3300006175 Bacteria 3127
55 Ga0075428_100003983 3300006844 Bacteria 16204
56 Ga0075428_100008650 3300006844 Bacteria 11291
57 Ga0075428_100105525 3300006844 Bacteria 3072
58 Ga0075430_100000493 3300006846 Bacteria 29659
59 Ga0075430_100070238 3300006846 Bacteria 2938
60 Ga0075431_100011419 3300006847 Bacteria 8950
61 Ga0075431_100021241 3300006847 Bacteria 6635
62 Ga0075431_100127107 3300006847 Bacteria 2630
63 Ga0075431_100182404 3300006847 Bacteria 2154
64 Ga0075433_10042316 3300006852 Bacteria 3952
65 Ga0075429_100035811 3300006880 Bacteria 4317
66 Ga0075429_100106305 3300006880 Bacteria 2452
67 Ga0075436_100016564 3300006914 Bacteria 5046
68 Ga0105240_10020937 3300009093 Bacteria 8707
69 Ga0105240_10036397 3300009093 Bacteria 6332
70 Ga0105240_10147258 3300009093 Bacteria 2808
71 Ga0111539_10007872 3300009094 Bacteria 13603
72 Ga0111539_10009677 3300009094 Bacteria 12165
73 Ga0111539_10024998 3300009094 Bacteria 7319
74 Ga0111539_10146696 3300009094 Bacteria 2763
75 Ga0111539_10274388 3300009094 Bacteria 1962
76 Ga0111539_10299000 3300009094 Bacteria 1873
77 Ga0111539_10365080 3300009094 Bacteria 1680
78 Ga0105245_10027862 3300009098 Bacteria 4979
79 Ga0105245_10147537 3300009098 Bacteria 2221
80 Ga0105245_10231526 3300009098 Bacteria 1787
81 Ga0105245_10242169 3300009098 Bacteria 1749
82 Ga0105245_10425052 3300009098 Bacteria 1332
83 Ga0114129_10019724 3300009147 Bacteria 9596
84 Ga0114129_10211879 3300009147 Bacteria 2619
85 Ga0105242_10161431 3300009176 Bacteria 1962
86 Ga0105242_10222355 3300009176 Bacteria 1688
87 Ga0105248_10027280 3300009177 Bacteria 6356
88 Ga0105237_10009843 3300009545 Bacteria 10221
89 Ga0105238_10150839 3300009551 Bacteria 2300
90 Ga0105249_10026346 3300009553 Bacteria 5238
91 Ga0105239_10006265 3300010375 Bacteria 13837
92 Ga0157373_10127439 3300013100 Bacteria 1790
93 Ga0157370_10048677 3300013104 Bacteria 4060
94 Ga0157369_10086492 3300013105 Bacteria 3348
95 Ga0157369_10273777 3300013105 Bacteria 1759
96 Ga0157374_10060145 3300013296 Bacteria 3555
97 Ga0163162_10493694 3300013306 Bacteria 1355
98 Ga0157372_10012761 3300013307 Bacteria 8951
99 Ga0157372_10066175 3300013307 Bacteria 4060
100 Ga0157375_10089305 3300013308 Bacteria 3138
101 Ga0157380_10202872 3300014326 Bacteria 1761
102 Ga0182008_10003241 3300014497 Bacteria 9946
103 Ga0182008_10069405 3300014497 Bacteria 1734
104 Ga0157377_10081352 3300014745 Bacteria 1894
105 Ga0182006_1026149 3300015261 Bacteria 2391
106 Ga0197907_10123835 3300020069 Bacteria 2121
107 Ga0207692_10107945 3300025898 Bacteria 1539
108 Ga0207707_10317213 3300025912 Bacteria 1346
109 Ga0207695_10018306 3300025913 Bacteria 8104
110 Ga0207695_10168958 3300025913 Bacteria 2114
111 Ga0207693_10000586 3300025915 Bacteria 32620
112 Ga0207693_10001266 3300025915 Bacteria 22523
113 Ga0207663_10007473 3300025916 Bacteria 5669
114 Ga0207663_10129404 3300025916 Bacteria 1742
115 Ga0207657_10006346 3300025919 Bacteria 12282
116 Ga0207657_10056472 3300025919 Bacteria 3387
117 Ga0207649_10018524 3300025920 Bacteria 3962
118 Ga0207649_10082273 3300025920 Bacteria 2087
119 Ga0207652_10238978 3300025921 Bacteria 1637
120 Ga0207646_10007593 3300025922 Bacteria 10986
121 Ga0207659_10230959 3300025926 Bacteria 1492
122 Ga0207687_10154919 3300025927 Bacteria 1752
123 Ga0207664_10003758 3300025929 Bacteria 10197
124 Ga0207664_10007986 3300025929 Bacteria 7357
125 Ga0207664_10010008 3300025929 Bacteria 6682
126 Ga0207664_10018610 3300025929 Bacteria 5118
127 Ga0207664_10021464 3300025929 Bacteria 4803
128 Ga0207664_10024595 3300025929 Bacteria 4527
129 Ga0207664_10074361 3300025929 Unclassified 2745
130 Ga0207706_10023095 3300025933 Bacteria 5586
131 Ga0207665_10000793 3300025939 Bacteria 21330
132 Ga0207691_10067927 3300025940 Bacteria 3221
133 Ga0207711_10027974 3300025941 Bacteria 4740
134 Ga0207689_10015719 3300025942 Bacteria 6408
135 Ga0207661_10019465 3300025944 Bacteria 5062
136 Ga0207661_10183749 3300025944 Bacteria 1828
137 Ga0207667_10247907 3300025949 Bacteria 1822
138 Ga0207703_10038089 3300026035 Bacteria 3834
139 Ga0207678_10194972 3300026067 Bacteria 1731
140 Ga0207702_10100462 3300026078 Bacteria 2552
141 Ga0207702_10163931 3300026078 Bacteria 2032
142 Ga0207648_10050002 3300026089 Bacteria 3656
143 Ga0207674_10003210 3300026116 Bacteria 20144
144 Ga0207674_10075214 3300026116 Bacteria 3388
145 Ga0207675_100324248 3300026118 Unclassified 1504
146 Ga0207698_10095248 3300026142 Bacteria 2450
147 Ga0207428_10009317 3300027907 Bacteria 8808
148 Ga0207428_10013183 3300027907 Bacteria 7236
149 Ga0207428_10015433 3300027907 Bacteria 6609
150 Ga0207428_10082385 3300027907 Bacteria 2510
151 Ga0265319_1011057 3300028563 Bacteria 3726
152 Ga0265334_10008339 3300028573 Bacteria 4406
153 Ga0265318_10001532 3300028577 Bacteria 13453
154 Ga0265323_10045386 3300028653 Bacteria 1579
155 Ga0265322_10004783 3300028654 Bacteria 4014
156 Ga0265338_10015430 3300028800 Bacteria 8392
157 Ga0265338_10027780 3300028800 Bacteria 5665
158 Ga0265338_10056438 3300028800 Bacteria 3482
159 Ga0265338_10057492 3300028800 Bacteria 3440
160 Ga0265324_10039429 3300029957 Bacteria 1637
161 Ga0265330_10012247 3300031235 Bacteria 4014
162 Ga0265328_10001734 3300031239 Bacteria 9988
163 Ga0265320_10011628 3300031240 Bacteria 5169
164 Ga0265325_10004366 3300031241 Bacteria 8945
165 Ga0265339_10022270 3300031249 Bacteria 3672
166 Ga0265339_10023353 3300031249 Bacteria 3575
167 Ga0265331_10001277 3300031250 Bacteria 18778
168 Ga0265327_10016485 3300031251 Bacteria 4688
169 Ga0265316_10008588 3300031344 Bacteria 9466
170 Ga0265313_10003763 3300031595 Bacteria 12046
171 Ga0307413_10024189 3300031824 Bacteria 3307
172 Ga0307410_10125807 3300031852 Bacteria 1876
173 Ga0307407_10108863 3300031903 Bacteria 1736
174 Ga0307409_100066331 3300031995 Bacteria 2846
175 Ga0307416_100007345 3300032002 Bacteria 6998
176 Ga0307415_100015810 3300032126 Bacteria 4480
177 Ga0373926_0004191 3300035083 Bacteria 4705
178 Ga0373939_0016666 3300035114 Bacteria 1941
179 Ga0373956_0089799 3300035119 Bacteria 1417
180 Ga0373943_0000485 3300035170 Bacteria 16976
181 Ga0373931_0161847 3300035691 Bacteria 1313
182 Ga0373935_0266705 3300035692 Bacteria 1202
183 Ga0373927_0034446 3300035695 Bacteria 3294
184 Ga0373947_0002997 3300035725 Bacteria 10071
185 Ga0373937_0003925 3300036401 Bacteria 12581
186 Ga0373937_0058413 3300036401 Bacteria 3544
187 Ga0395899_0001253 3300037312 Bacteria 22068
188 Ga0395899_0129608 3300037312 Bacteria 1802
189 Ga0395900_0002828 3300037418 Bacteria 18940
190 Ga0395900_0004261 3300037418 Bacteria 15184
191 Ga0395900_0031693 3300037418 Bacteria 5433
192 Ga0395900_0051303 3300037418 Bacteria 4250
193 Ga0395900_0092441 3300037418 Bacteria 3108
194 Ga0395900_0107135 3300037418 Bacteria 2871
195 Ga0395898_0002545 3300037466 Bacteria 21392
196 Ga0395898_0077033 3300037466 Bacteria 3219
197 Ga0395898_0147559 3300037466 Bacteria 2251
198 Ga0395898_0207164 3300037466 Bacteria 1871
199 Ga0395905_0019186 3300037471 Bacteria 6485
200 Ga0395905_0027980 3300037471 Bacteria 5314
201 Ga0395905_0099762 3300037471 Bacteria 2727
202 Ga0395905_0108121 3300037471 Bacteria 2611
203 Ga0395905_0128425 3300037471 Bacteria 2384
204 Ga0395905_0600630 3300037471 Bacteria 1002
205 Ga0395901_0002958 3300038443 Bacteria 17133
206 Ga0395901_0014034 3300038443 Bacteria 8153
207 Ga0395901_0058265 3300038443 Bacteria 4018
208 Ga0395901_0136509 3300038443 Bacteria 2577
209 Ga0395901_0212320 3300038443 Bacteria 2025
210 Ga0436360_0730041 3300039438 Bacteria 11070
211 Ga0436363_0255584 3300039450 Bacteria 3141
212 Ga0451853_0345001 3300041512 Bacteria 1348
213 Ga0439449_0091281 3300042007 Bacteria 1124
214 Ga0466969_0000749 3300044656 Bacteria 17589
215 Ga0466966_0016983 3300044684 Bacteria 4810
216 Ga0466966_0031486 3300044684 Bacteria 3439
217 Ga0466966_0063977 3300044684 Bacteria 2317
218 Ga0466961_0028244 3300044693 Bacteria 3607
219 Ga0466961_0070332 3300044693 Bacteria 2221
220 Ga0466961_0092252 3300044693 Bacteria 1912
221 Ga0466963_0000248 3300044694 Bacteria 23565
222 Ga0466963_0000355 3300044694 Bacteria 20745
223 Ga0466963_0001329 3300044694 Bacteria 13167
224 Ga0466963_0001715 3300044694 Bacteria 11927
225 Ga0466963_0005352 3300044694 Bacteria 7508
226 Ga0466963_0007445 3300044694 Bacteria 6527
227 Ga0466963_0012911 3300044694 Bacteria 5119
228 Ga0466963_0013492 3300044694 Bacteria 5017
229 Ga0466963_0016798 3300044694 Bacteria 4555
230 Ga0466963_0023085 3300044694 Bacteria 3944
231 Ga0466963_0028810 3300044694 Bacteria 3569
232 Ga0466963_0045019 3300044694 Bacteria 2905
233 Ga0466963_0057267 3300044694 Bacteria 2595
234 Ga0466963_0064788 3300044694 Bacteria 2449
235 Ga0466963_0068967 3300044694 Bacteria 2376
236 Ga0466964_0004715 3300044706 Bacteria 5038
237 Ga0466964_0007686 3300044706 Bacteria 4035
238 Ga0466964_0014459 3300044706 Bacteria 3003
239 Ga0466964_0015770 3300044706 Bacteria 2876
240 Ga0453684_0389305 3300044712 Bacteria 1564
241 Ga0466971_0101915 3300044719 Bacteria 1320
242 Ga0466968_0000662 3300044735 Bacteria 11788
243 Ga0466968_0031212 3300044735 Bacteria 2210
244 Ga0466968_0041125 3300044735 Bacteria 1950
245 Ga0466968_0051958 3300044735 Bacteria 1752
246 Ga0466970_0006693 3300044765 Bacteria 5766
247 Ga0466957_0003061 3300044842 Bacteria 9094
248 Ga0466957_0020759 3300044842 Bacteria 3865
249 Ga0466957_0022490 3300044842 Bacteria 3721
250 Ga0466957_0022983 3300044842 Bacteria 3681
251 Ga0466957_0032093 3300044842 Bacteria 3143
252 Ga0466957_0032979 3300044842 Bacteria 3104
253 Ga0466957_0036847 3300044842 Bacteria 2942
254 Ga0466957_0052412 3300044842 Bacteria 2484
255 Ga0466957_0180382 3300044842 Bacteria 1379
256 Ga0466957_0211875 3300044842 Unclassified 1276
257 Ga0466960_0014751 3300044901 Bacteria 3354
258 Ga0466959_0001794 3300045049 Bacteria 13421
259 Ga0466959_0005411 3300045049 Bacteria 8739
260 Ga0466959_0007947 3300045049 Bacteria 7470
261 Ga0466959_0033367 3300045049 Bacteria 3806
262 Ga0451576_0029434 3300045051 Bacteria 5877
263 Ga0466958_0000655 3300045836 Bacteria 14950
264 Ga0466958_0014393 3300045836 Bacteria 4518
265 Ga0466958_0021267 3300045836 Bacteria 3789
266 Ga0466958_0032176 3300045836 Bacteria 3119
267 Ga0466958_0041627 3300045836 Bacteria 2764
268 Ga0466958_0060761 3300045836 Bacteria 2300
269 Ga0466967_0000219 3300045976 Bacteria 24460
270 Ga0466967_0002872 3300045976 Bacteria 10954
271 Ga0466967_0009549 3300045976 Bacteria 7207
272 Ga0466967_0022408 3300045976 Bacteria 5153
273 Ga0466967_0026636 3300045976 Bacteria 4792
274 Ga0466967_0027483 3300045976 Bacteria 4734
275 Ga0466967_0104026 3300045976 Bacteria 2598
276 Ga0466967_0111940 3300045976 Bacteria 2509
277 Ga0466967_0123731 3300045976 Bacteria 2393
278 Ga0466967_0167021 3300045976 Bacteria 2068
279 Ga0466967_0256903 3300045976 Bacteria 1670
280 Ga0495592_0001003 3300046454 Bacteria 19611
281 Ga0495592_0002313 3300046454 Bacteria 13442
282 Ga0495592_0227397 3300046454 Bacteria 1244
283 Ga0495603_0042695 3300046455 Bacteria 2710
284 Ga0495629_0017474 3300046459 Bacteria 5139
285 Ga0495629_0038381 3300046459 Bacteria 3373
286 Ga0495641_0008094 3300046461 Bacteria 6458
287 Ga0495651_0000038 3300046462 Bacteria 97248
288 Ga0495653_0014400 3300046463 Bacteria 6453
289 Ga0495653_0036955 3300046463 Bacteria 3842
290 Ga0495582_0000560 3300046473 Bacteria 20576
291 Ga0495582_0108661 3300046473 Bacteria 1557
292 Ga0495605_0084596 3300046474 Bacteria 1479
293 Ga0495639_0000517 3300046475 Bacteria 18127
294 Ga0495662_0072875 3300046476 Bacteria 1665
295 Ga0495664_0078042 3300046477 Bacteria 1983
296 Ga0495584_0013313 3300046491 Bacteria 4200
297 Ga0495584_0033134 3300046491 Bacteria 2613
298 Ga0495584_0158818 3300046491 Bacteria 1149
299 Ga0495594_0116128 3300046499 Bacteria 1511
300 Ga0495607_0041873 3300046501 Bacteria 2718
301 Ga0495608_0020885 3300046511 Bacteria 4498
302 Ga0495608_0034107 3300046511 Bacteria 3437
303 Ga0495608_0161912 3300046511 Bacteria 1422
304 Ga0495618_0016647 3300046514 Bacteria 4502
305 Ga0495618_0039218 3300046514 Bacteria 2978
306 Ga0495618_0044399 3300046514 Bacteria 2804
307 Ga0495620_0053818 3300046515 Bacteria 1703
308 Ga0495620_0057726 3300046515 Bacteria 1628
309 Ga0495628_0000025 3300046516 Bacteria 127935
310 Ga0495628_0017025 3300046516 Bacteria 6056
311 Ga0495628_0041591 3300046516 Bacteria 3669
312 Ga0495630_0001418 3300046517 Bacteria 16580
313 Ga0495666_0000186 3300046526 Bacteria 26616
314 Ga0495642_0080864 3300046528 Bacteria 1368
315 Ga0495642_0086405 3300046528 Bacteria 1325
316 Ga0495652_0000088 3300046529 Bacteria 98865
317 Ga0495652_0043635 3300046529 Bacteria 3861
318 Ga0495665_0001413 3300046531 Bacteria 12861
319 Ga0495640_0028051 3300046533 Bacteria 4055
320 Ga0495640_0050165 3300046533 Bacteria 2876
321 Ga0495587_0002637 3300046536 Bacteria 11988
322 Ga0495587_0054355 3300046536 Bacteria 2360
323 Ga0495645_0000024 3300046543 Bacteria 125065
324 Ga0495645_0079543 3300046543 Bacteria 2354
325 Ga0495667_0002973 3300046559 Bacteria 11364
326 Ga0495656_0024860 3300046615 Bacteria 2370
327 Ga0495634_0033819 3300046642 Bacteria 3510
328 Ga0495634_0064651 3300046642 Bacteria 2425
329 Ga0495635_0015180 3300046663 Bacteria 5388
330 Ga0495635_0030485 3300046663 Bacteria 3748
331 Ga0495635_0227417 3300046663 Bacteria 1260
332 Ga0495657_0011991 3300046675 Bacteria 6453
333 Ga0495657_0114693 3300046675 Bacteria 1703
334 Ga0495599_0000019 3300046678 Bacteria 141108
335 Ga0495623_0000032 3300046679 Bacteria 84435
336 Ga0495623_0028486 3300046679 Bacteria 3593
337 Ga0495646_0048748 3300046680 Bacteria 2572
338 Ga0495647_0000811 3300046681 Bacteria 9345
339 Ga0495658_0001241 3300046683 Bacteria 13401
340 Ga0495613_0147867 3300046689 Bacteria 1676
341 Ga0495613_0262392 3300046689 Bacteria 1203
342 Ga0495624_0008189 3300046690 Bacteria 7311
343 Ga0495624_0044150 3300046690 Bacteria 2842
344 Ga0495600_0054694 3300046809 Bacteria 2607
345 Ga0495581_0003648 3300047315 Bacteria 8866
346 Ga0495604_0000128 3300047317 Bacteria 63743
347 Ga0495604_0252020 3300047317 Bacteria 1203
348 Ga0495674_0181340 3300047319 Bacteria 1753
349 Ga0495674_0243433 3300047319 Bacteria 1481
350 Ga0495674_0247735 3300047319 Bacteria 1467
351 Ga0495676_0062073 3300047321 Bacteria 2920
352 Ga0495676_0154338 3300047321 Bacteria 1630
353 Ga0495680_0018043 3300047322 Bacteria 6005
354 Ga0495680_0041956 3300047322 Bacteria 3634
355 Ga0495680_0044914 3300047322 Bacteria 3491
356 Ga0495680_0078813 3300047322 Bacteria 2492
357 Ga0495683_0154383 3300047323 Bacteria 1066
358 Ga0495675_0000007 3300047444 Bacteria 162640
359 Ga0495677_0011102 3300047445 Bacteria 3298
360 Ga0495685_029917 3300047447 Bacteria 1873
361 Ga0495684_0029481 3300047471 Bacteria 4211
362 Ga0495684_0169734 3300047471 Bacteria 1623
363 Ga0495593_0000358 3300047673 Bacteria 25227
364 Ga0495602_0000246 3300048088 Bacteria 50728
365 Ga0495614_0012164 3300048089 Bacteria 3778
366 Ga0496100_0012541 3300048903 Bacteria 4861
367 Ga0496100_0206932 3300048903 Bacteria 1433
368 Ga0496101_0027743 3300048904 Bacteria 3948
369 Ga0496101_0100276 3300048904 Bacteria 2166
370 Ga0496102_0006750 3300048905 Bacteria 9799
371 Ga0496102_0064128 3300048905 Bacteria 3365
372 Ga0496103_0005447 3300048906 Bacteria 7613
373 Ga0496103_0118455 3300048906 Bacteria 1686
374 Ga0496104_0002359 3300048907 Bacteria 16318
375 Ga0496104_0240794 3300048907 Bacteria 1721
376 Ga0496105_0003530 3300048908 Bacteria 11596
377 Ga0496105_0145987 3300048908 Bacteria 1945
378 Ga0496105_0171442 3300048908 Bacteria 1778
379 Ga0496106_0014103 3300048909 Bacteria 5905
380 Ga0496106_0016966 3300048909 Bacteria 5389
381 Ga0496106_0172946 3300048909 Bacteria 1713
382 Ga0496106_0184738 3300048909 Bacteria 1656
383 Ga0496106_0331497 3300048909 Bacteria 1222
384 Ga0496107_0003668 3300048910 Bacteria 10322
385 Ga0496107_0022333 3300048910 Bacteria 4471
386 Ga0496108_0016705 3300048911 Bacteria 5995
387 Ga0496108_0019939 3300048911 Bacteria 5508
388 Ga0496108_0127901 3300048911 Bacteria 2182
389 Ga0496108_0410653 3300048911 Bacteria 1182
390 Ga0496109_0001544 3300048912 Bacteria 19145
391 Ga0496109_0043517 3300048912 Bacteria 4070
392 Ga0496109_0061319 3300048912 Bacteria 3438
393 Ga0496109_0196404 3300048912 Bacteria 1896
394 Ga0496110_0022481 3300048913 Bacteria 5355
395 Ga0496111_0000101 3300048914 Bacteria 37061
396 Ga0496111_0013124 3300048914 Bacteria 5629
397 Ga0496111_0097708 3300048914 Bacteria 2156
398 Ga0496111_0111273 3300048914 Bacteria 2017
399 Ga0496111_0173127 3300048914 Bacteria 1604
400 Ga0496112_0023402 3300048915 Bacteria 5903
401 Ga0496112_0026580 3300048915 Bacteria 5573
402 Ga0496112_0340720 3300048915 Bacteria 1443
403 Ga0496113_0016405 3300048916 Bacteria 5118
404 Ga0496113_0092467 3300048916 Bacteria 2333
405 Ga0496114_0011285 3300048917 Bacteria 7135
406 Ga0496114_0039741 3300048917 Bacteria 3893
407 Ga0496114_0153163 3300048917 Bacteria 2000
408 Ga0496114_0254325 3300048917 Bacteria 1546
409 Ga0496115_0008680 3300048918 Bacteria 7530
410 Ga0496115_0030082 3300048918 Bacteria 4269
411 Ga0496115_0090333 3300048918 Bacteria 2502
412 Ga0501031_0014744 3300049568 Bacteria 5080
413 Ga0501033_0069135 3300049570 Bacteria 2596
414 Ga0501033_0187494 3300049570 Bacteria 1481
415 Ga0501034_0128379 3300049571 Bacteria 2520
416 Ga0501036_0004556 3300049572 Bacteria 11194
417 Ga0501036_0022905 3300049572 Bacteria 5259
418 Ga0501038_0014787 3300049574 Bacteria 7109
419 Ga0501039_0008373 3300049575 Bacteria 7880
420 Ga0501039_0009102 3300049575 Bacteria 7568
421 Ga0501040_0009857 3300049576 Bacteria 6238
422 Ga0501040_0172431 3300049576 Bacteria 1532
423 Ga0501042_0002742 3300049578 Bacteria 10863
424 Ga0501042_0011381 3300049578 Bacteria 6004
425 Ga0501046_0004548 3300049580 Bacteria 12567
426 Ga0501047_0053297 3300049581 Bacteria 3911
427 Ga0501048_0002148 3300049582 Bacteria 15046
428 Ga0501048_0031994 3300049582 Bacteria 3803
429 Ga0501048_0104818 3300049582 Bacteria 1996
430 Ga0501067_0007160 3300049583 Bacteria 6196
431 Ga0501068_0001499 3300049584 Bacteria 12432
432 Ga0501070_0008123 3300049586 Bacteria 8881
433 Ga0501070_0020926 3300049586 Bacteria 5488
434 Ga0501070_0119885 3300049586 Bacteria 2174
435 Ga0501070_0189061 3300049586 Bacteria 1693
436 Ga0501071_0008640 3300049587 Bacteria 6733
437 Ga0501071_0150807 3300049587 Bacteria 1734
438 Ga0501072_0002912 3300049588 Bacteria 12879
439 Ga0501072_0008230 3300049588 Bacteria 7921
440 Ga0501072_0319932 3300049588 Bacteria 1233
441 Ga0501073_0031791 3300049589 Bacteria 3765
442 Ga0501074_0004601 3300049590 Bacteria 9880
443 Ga0501074_0014957 3300049590 Bacteria 5646
444 Ga0501074_0027589 3300049590 Bacteria 4117
445 Ga0501074_0049191 3300049590 Bacteria 3044
446 Ga0501075_0004383 3300049591 Bacteria 9549
447 Ga0501075_0008894 3300049591 Bacteria 7005
448 Ga0501075_0144553 3300049591 Bacteria 1813
449 Ga0501076_0006613 3300049592 Bacteria 8407
450 Ga0501076_0028794 3300049592 Bacteria 4316
451 Ga0501076_0053282 3300049592 Bacteria 3206
452 Ga0501077_0016808 3300049593 Bacteria 4615
453 Ga0501077_0019584 3300049593 Bacteria 4279
454 Ga0501079_0002853 3300049741 Bacteria 12609
455 Ga0501079_0002994 3300049741 Bacteria 12357
456 Ga0501079_0064562 3300049741 Bacteria 2824
457 Ga0501079_0084603 3300049741 Bacteria 2454
458 Ga0501079_0257515 3300049741 Bacteria 1364
459 Ga0501080_0001096 3300049742 Bacteria 22313
460 Ga0501080_0017366 3300049742 Bacteria 6653
461 Ga0501080_0030143 3300049742 Bacteria 5054
462 Ga0501080_0146471 3300049742 Bacteria 2183
463 Ga0501081_0000280 3300049743 Bacteria 26904
464 Ga0501081_0115307 3300049743 Bacteria 1909
465 Ga0501083_0001728 3300049744 Bacteria 14875
466 Ga0501035_0027322 3300049822 Bacteria 5216
467 Ga0501035_0058416 3300049822 Bacteria 3437
468 Ga0501045_0001032 3300049824 Bacteria 18298
469 nmdc:mga05p37_201237_c1 3300050507 Bacteria 2412
470 nmdc:mga05p37_340093_c1 3300050507 Bacteria 1770
471 nmdc:mga05p37_534314_c1 3300050507 Bacteria 1338
472 nmdc:mga09592_212872_c1 3300050508 Bacteria 1675
473 nmdc:mga09592_37801_c1 3300050508 Bacteria 4050
474 nmdc:mga0qj67_10137_c1 3300050509 Bacteria 7033
475 nmdc:mga08y16_12328_c1 3300050511 Bacteria 8989
476 nmdc:mga08y16_22805_c1 3300050511 Bacteria 6607
477 nmdc:mga08y16_240078_c1 3300050511 Bacteria 1873
478 nmdc:mga08y16_25386_c1 3300050511 Bacteria 6249
479 nmdc:mga0n895_16905_c1 3300050512 Bacteria 6709
480 nmdc:mga0a205_67350_c1 3300050515 Bacteria 3459
481 Ga0495601_0000313 3300053077 Bacteria 25734
482 Ga0495601_0047793 3300053077 Bacteria 2694
483 Ga0495601_0070683 3300053077 Bacteria 2228
484 Ga0495612_0004427 3300053078 Bacteria 5825
485 Ga0495612_0022579 3300053078 Bacteria 2521
486 Ga0495595_0011603 3300053084 Bacteria 3687
487 Ga0495595_0012235 3300053084 Bacteria 3602
488 Ga0495595_0017429 3300053084 Bacteria 3090
489 Ga0495595_0131387 3300053084 Bacteria 1224
490 Ga0495619_0005391 3300053085 Bacteria 8102
491 Ga0495619_0006346 3300053085 Bacteria 7495
492 Ga0495619_0043250 3300053085 Bacteria 2952
493 Ga0495619_0049475 3300053085 Bacteria 2772
494 Ga0500566_0033184 3300053094 Bacteria 3009
495 Ga0501084_0001558 3300054114 Bacteria 18206
496 Ga0501082_0214167 3300060353 Bacteria 1676
497 Ga0466962_0004666 3300061719 Bacteria 6580
498 Ga0466962_0004857 3300061719 Bacteria 6471
499 Ga0466962_0033705 3300061719 Bacteria 2451
500 Ga0530510_0017802 3300061734 Bacteria 5037
501 Ga0466958_0007203
502 Ga0070658_10007291
503 Ga0070683_100095738
504 Ga0070683_100101655
505 Ga0070660_100026495
506 Ga0070691_10053598
507 Ga0070661_100034593
508 Ga0070675_100150264
509 Ga0070714_100011046
510 Ga0070714_100014958
511 Ga0070714_100024816
512 Ga0070714_100067907
513 Ga0070714_100084610
514 Ga0070714_100104605
515 Ga0070714_100141479
516 Ga0070713_100011866
517 Ga0070713_100067326
518 Ga0070710_10003409
519 Ga0070710_10013545
520 Ga0070701_10078785
521 Ga0070711_100011594
522 Ga0070711_100027387
523 Ga0070700_100048413
524 Ga0070708_100167334
525 Ga0070681_10058249
526 Ga0068867_100078597
527 Ga0070706_100451861
528 Ga0070707_100001067
529 Ga0070699_100101562
530 Ga0070699_100118175
531 Ga0070679_100058969
532 Ga0070679_100102617
533 Ga0070679_100176119
534 Ga0070684_100018317
535 Ga0070684_100063097
536 Ga0070695_100000028
537 Ga0070695_100087178
538 Ga0068855_100038872
539 Ga0068857_100009624
540 Ga0068857_100038748
541 Ga0068856_100046531
542 Ga0068856_100137304
543 Ga0070702_100028703
544 Ga0070702_100095650
545 Ga0068852_100074865
546 Ga0068861_100125028
547 Ga0068858_100047080
548 Ga0081539_10002688
549 Ga0081539_10020490
550 Ga0070717_10001757
551 Ga0070717_10019063
552 Ga0070715_10001705
553 Ga0070716_100000830
554 Ga0070712_100042445
555 Ga0075428_100003983
556 Ga0075428_100008650
557 Ga0075428_100105525
558 Ga0075430_100000493
559 Ga0075430_100070238
560 Ga0075431_100011419
561 Ga0075431_100021241
562 Ga0075431_100127107
563 Ga0075431_100182404
564 Ga0075433_10042316
565 Ga0075429_100035811
566 Ga0075429_100106305
567 Ga0075436_100016564
568 Ga0105240_10020937
569 Ga0105240_10036397
570 Ga0105240_10147258
571 Ga0111539_10007872
572 Ga0111539_10009677
573 Ga0111539_10024998
574 Ga0111539_10146696
575 Ga0111539_10274388
576 Ga0111539_10299000
577 Ga0111539_10365080
578 Ga0105245_10027862
579 Ga0105245_10147537
580 Ga0105245_10231526
581 Ga0105245_10242169
582 Ga0105245_10425052
583 Ga0114129_10019724
584 Ga0114129_10211879
585 Ga0105242_10161431
586 Ga0105242_10222355
587 Ga0105248_10027280
588 Ga0105237_10009843
589 Ga0105238_10150839
590 Ga0105249_10026346
591 Ga0105239_10006265
592 Ga0157373_10127439
593 Ga0157370_10048677
594 Ga0157369_10086492
595 Ga0157369_10273777
596 Ga0157374_10060145
597 Ga0163162_10493694
598 Ga0157372_10012761
599 Ga0157372_10066175
600 Ga0157375_10089305
601 Ga0157380_10202872
602 Ga0182008_10003241
603 Ga0182008_10069405
604 Ga0157377_10081352
605 Ga0182006_1026149
606 Ga0197907_10123835
607 Ga0207692_10107945
608 Ga0207707_10317213
609 Ga0207695_10018306
610 Ga0207695_10168958
611 Ga0207693_10000586
612 Ga0207693_10001266
613 Ga0207663_10007473
614 Ga0207663_10129404
615 Ga0207657_10006346
616 Ga0207657_10056472
617 Ga0207649_10018524
618 Ga0207649_10082273
619 Ga0207652_10238978
620 Ga0207646_10007593
621 Ga0207659_10230959
622 Ga0207687_10154919
623 Ga0207664_10003758
624 Ga0207664_10007986
625 Ga0207664_10010008
626 Ga0207664_10018610
627 Ga0207664_10021464
628 Ga0207664_10024595
629 Ga0207664_10074361
630 Ga0207706_10023095
631 Ga0207665_10000793
632 Ga0207691_10067927
633 Ga0207711_10027974
634 Ga0207689_10015719
635 Ga0207661_10019465
636 Ga0207661_10183749
637 Ga0207667_10247907
638 Ga0207703_10038089
639 Ga0207678_10194972
640 Ga0207702_10100462
641 Ga0207702_10163931
642 Ga0207648_10050002
643 Ga0207674_10003210
644 Ga0207674_10075214
645 Ga0207675_100324248
646 Ga0207698_10095248
647 Ga0207428_10009317
648 Ga0207428_10013183
649 Ga0207428_10015433
650 Ga0207428_10082385
651 Ga0265319_1011057
652 Ga0265334_10008339
653 Ga0265318_10001532
654 Ga0265323_10045386
655 Ga0265322_10004783
656 Ga0265338_10015430
657 Ga0265338_10027780
658 Ga0265338_10056438
659 Ga0265338_10057492
660 Ga0265324_10039429
661 Ga0265330_10012247
662 Ga0265328_10001734
663 Ga0265320_10011628
664 Ga0265325_10004366
665 Ga0265339_10022270
666 Ga0265339_10023353
667 Ga0265331_10001277
668 Ga0265327_10016485
669 Ga0265316_10008588
670 Ga0265313_10003763
671 Ga0307413_10024189
672 Ga0307410_10125807
673 Ga0307407_10108863
674 Ga0307409_100066331
675 Ga0307416_100007345
676 Ga0307415_100015810
677 Ga0373926_0004191
678 Ga0373939_0016666
679 Ga0373956_0089799
680 Ga0373943_0000485
681 Ga0373931_0161847
682 Ga0373935_0266705
683 Ga0373927_0034446
684 Ga0373947_0002997
685 Ga0373937_0003925
686 Ga0373937_0058413
687 Ga0395899_0001253
688 Ga0395899_0129608
689 Ga0395900_0002828
690 Ga0395900_0004261
691 Ga0395900_0031693
692 Ga0395900_0051303
693 Ga0395900_0092441
694 Ga0395900_0107135
695 Ga0395898_0002545
696 Ga0395898_0077033
697 Ga0395898_0147559
698 Ga0395898_0207164
699 Ga0395905_0019186
700 Ga0395905_0027980
701 Ga0395905_0099762
702 Ga0395905_0108121
703 Ga0395905_0128425
704 Ga0395905_0600630
705 Ga0395901_0002958
706 Ga0395901_0014034
707 Ga0395901_0058265
708 Ga0395901_0136509
709 Ga0395901_0212320
710 Ga0436360_0730041
711 Ga0436363_0255584
712 Ga0451853_0345001
713 Ga0439449_0091281
714 Ga0466969_0000749
715 Ga0466966_0016983
716 Ga0466966_0031486
717 Ga0466966_0063977
718 Ga0466961_0028244
719 Ga0466961_0070332
720 Ga0466961_0092252
721 Ga0466963_0000248
722 Ga0466963_0000355
723 Ga0466963_0001329
724 Ga0466963_0001715
725 Ga0466963_0005352
726 Ga0466963_0007445
727 Ga0466963_0012911
728 Ga0466963_0013492
729 Ga0466963_0016798
730 Ga0466963_0023085
731 Ga0466963_0028810
732 Ga0466963_0045019
733 Ga0466963_0057267
734 Ga0466963_0064788
735 Ga0466963_0068967
736 Ga0466964_0004715
737 Ga0466964_0007686
738 Ga0466964_0014459
739 Ga0466964_0015770
740 Ga0453684_0389305
741 Ga0466971_0101915
742 Ga0466968_0000662
743 Ga0466968_0031212
744 Ga0466968_0041125
745 Ga0466968_0051958
746 Ga0466970_0006693
747 Ga0466957_0003061
748 Ga0466957_0020759
749 Ga0466957_0022490
750 Ga0466957_0022983
751 Ga0466957_0032093
752 Ga0466957_0032979
753 Ga0466957_0036847
754 Ga0466957_0052412
755 Ga0466957_0180382
756 Ga0466957_0211875
757 Ga0466960_0014751
758 Ga0466959_0001794
759 Ga0466959_0005411
760 Ga0466959_0007947
761 Ga0466959_0033367
762 Ga0451576_0029434
763 Ga0466958_0000655
764 Ga0466958_0014393
765 Ga0466958_0021267
766 Ga0466958_0032176
767 Ga0466958_0041627
768 Ga0466958_0060761
769 Ga0466967_0000219
770 Ga0466967_0002872
771 Ga0466967_0009549
772 Ga0466967_0022408
773 Ga0466967_0026636
774 Ga0466967_0027483
775 Ga0466967_0104026
776 Ga0466967_0111940
777 Ga0466967_0123731
778 Ga0466967_0167021
779 Ga0466967_0256903
780 Ga0495592_0001003
781 Ga0495592_0002313
782 Ga0495592_0227397
783 Ga0495603_0042695
784 Ga0495629_0017474
785 Ga0495629_0038381
786 Ga0495641_0008094
787 Ga0495651_0000038
788 Ga0495653_0014400
789 Ga0495653_0036955
790 Ga0495582_0000560
791 Ga0495582_0108661
792 Ga0495605_0084596
793 Ga0495639_0000517
794 Ga0495662_0072875
795 Ga0495664_0078042
796 Ga0495584_0013313
797 Ga0495584_0033134
798 Ga0495584_0158818
799 Ga0495594_0116128
800 Ga0495607_0041873
801 Ga0495608_0020885
802 Ga0495608_0034107
803 Ga0495608_0161912
804 Ga0495618_0016647
805 Ga0495618_0039218
806 Ga0495618_0044399
807 Ga0495620_0053818
808 Ga0495620_0057726
809 Ga0495628_0000025
810 Ga0495628_0017025
811 Ga0495628_0041591
812 Ga0495630_0001418
813 Ga0495666_0000186
814 Ga0495642_0080864
815 Ga0495642_0086405
816 Ga0495652_0000088
817 Ga0495652_0043635
818 Ga0495665_0001413
819 Ga0495640_0028051
820 Ga0495640_0050165
821 Ga0495587_0002637
822 Ga0495587_0054355
823 Ga0495645_0000024
824 Ga0495645_0079543
825 Ga0495667_0002973
826 Ga0495656_0024860
827 Ga0495634_0033819
828 Ga0495634_0064651
829 Ga0495635_0015180
830 Ga0495635_0030485
831 Ga0495635_0227417
832 Ga0495657_0011991
833 Ga0495657_0114693
834 Ga0495599_0000019
835 Ga0495623_0000032
836 Ga0495623_0028486
837 Ga0495646_0048748
838 Ga0495647_0000811
839 Ga0495658_0001241
840 Ga0495613_0147867
841 Ga0495613_0262392
842 Ga0495624_0008189
843 Ga0495624_0044150
844 Ga0495600_0054694
845 Ga0495581_0003648
846 Ga0495604_0000128
847 Ga0495604_0252020
848 Ga0495674_0181340
849 Ga0495674_0243433
850 Ga0495674_0247735
851 Ga0495676_0062073
852 Ga0495676_0154338
853 Ga0495680_0018043
854 Ga0495680_0041956
855 Ga0495680_0044914
856 Ga0495680_0078813
857 Ga0495683_0154383
858 Ga0495675_0000007
859 Ga0495677_0011102
860 Ga0495685_029917
861 Ga0495684_0029481
862 Ga0495684_0169734
863 Ga0495593_0000358
864 Ga0495602_0000246
865 Ga0495614_0012164
866 Ga0496100_0012541
867 Ga0496100_0206932
868 Ga0496101_0027743
869 Ga0496101_0100276
870 Ga0496102_0006750
871 Ga0496102_0064128
872 Ga0496103_0005447
873 Ga0496103_0118455
874 Ga0496104_0002359
875 Ga0496104_0240794
876 Ga0496105_0003530
877 Ga0496105_0145987
878 Ga0496105_0171442
879 Ga0496106_0014103
880 Ga0496106_0016966
881 Ga0496106_0172946
882 Ga0496106_0184738
883 Ga0496106_0331497
884 Ga0496107_0003668
885 Ga0496107_0022333
886 Ga0496108_0016705
887 Ga0496108_0019939
888 Ga0496108_0127901
889 Ga0496108_0410653
890 Ga0496109_0001544
891 Ga0496109_0043517
892 Ga0496109_0061319
893 Ga0496109_0196404
894 Ga0496110_0022481
895 Ga0496111_0000101
896 Ga0496111_0013124
897 Ga0496111_0097708
898 Ga0496111_0111273
899 Ga0496111_0173127
900 Ga0496112_0023402
901 Ga0496112_0026580
902 Ga0496112_0340720
903 Ga0496113_0016405
904 Ga0496113_0092467
905 Ga0496114_0011285
906 Ga0496114_0039741
907 Ga0496114_0153163
908 Ga0496114_0254325
909 Ga0496115_0008680
910 Ga0496115_0030082
911 Ga0496115_0090333
912 Ga0501031_0014744
913 Ga0501033_0069135
914 Ga0501033_0187494
915 Ga0501034_0128379
916 Ga0501036_0004556
917 Ga0501036_0022905
918 Ga0501038_0014787
919 Ga0501039_0008373
920 Ga0501039_0009102
921 Ga0501040_0009857
922 Ga0501040_0172431
923 Ga0501042_0002742
924 Ga0501042_0011381
925 Ga0501046_0004548
926 Ga0501047_0053297
927 Ga0501048_0002148
928 Ga0501048_0031994
929 Ga0501048_0104818
930 Ga0501067_0007160
931 Ga0501068_0001499
932 Ga0501070_0008123
933 Ga0501070_0020926
934 Ga0501070_0119885
935 Ga0501070_0189061
936 Ga0501071_0008640
937 Ga0501071_0150807
938 Ga0501072_0002912
939 Ga0501072_0008230
940 Ga0501072_0319932
941 Ga0501073_0031791
942 Ga0501074_0004601
943 Ga0501074_0014957
944 Ga0501074_0027589
945 Ga0501074_0049191
946 Ga0501075_0004383
947 Ga0501075_0008894
948 Ga0501075_0144553
949 Ga0501076_0006613
950 Ga0501076_0028794
951 Ga0501076_0053282
952 Ga0501077_0016808
953 Ga0501077_0019584
954 Ga0501079_0002853
955 Ga0501079_0002994
956 Ga0501079_0064562
957 Ga0501079_0084603
958 Ga0501079_0257515
959 Ga0501080_0001096
960 Ga0501080_0017366
961 Ga0501080_0030143
962 Ga0501080_0146471
963 Ga0501081_0000280
964 Ga0501081_0115307
965 Ga0501083_0001728
966 Ga0501035_0027322
967 Ga0501035_0058416
968 Ga0501045_0001032
969 nmdc:mga05p37_201237_c1
970 nmdc:mga05p37_340093_c1
971 nmdc:mga05p37_534314_c1
972 nmdc:mga09592_212872_c1
973 nmdc:mga09592_37801_c1
974 nmdc:mga0qj67_10137_c1
975 nmdc:mga08y16_12328_c1
976 nmdc:mga08y16_22805_c1
977 nmdc:mga08y16_240078_c1
978 nmdc:mga08y16_25386_c1
979 nmdc:mga0n895_16905_c1
980 nmdc:mga0a205_67350_c1
981 Ga0495601_0000313
982 Ga0495601_0047793
983 Ga0495601_0070683
984 Ga0495612_0004427
985 Ga0495612_0022579
986 Ga0495595_0011603
987 Ga0495595_0012235
988 Ga0495595_0017429
989 Ga0495595_0131387
990 Ga0495619_0005391
991 Ga0495619_0006346
992 Ga0495619_0043250
993 Ga0495619_0049475
994 Ga0500566_0033184
995 Ga0501084_0001558
996 Ga0501082_0214167
997 Ga0466962_0004666
998 Ga0466962_0004857
999 Ga0466962_0033705
1000 Ga0530510_0017802

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

73

180

0.95

PF02769

AIRS_C

AIR synthase related protein, C-terminal domain

192

360

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zod-assembly1.cif.gz_A crystal structure of selenophosphate synthetase from aquifex aeolicus 0.9467 45 328
2zau-assembly1.cif.gz_A-2 crystal structure of an n-terminally truncated selenophosphate synthetase from aquifex aeolicus 0.9294 44 328
3u0o-assembly1.cif.gz_A the crystal structure of selenophosphate synthetase from e. coli 0.9275 36 330
2zau-assembly1.cif.gz_B-2 crystal structure of an n-terminally truncated selenophosphate synthetase from aquifex aeolicus 0.9272 46 328
3u0o-assembly1.cif.gz_B the crystal structure of selenophosphate synthetase from e. coli 0.9271 32 328
ID Description Score Start End Superfamily
3u0oA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9557 36 156 3.30.1330.10
3u0oB01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9484 32 154 3.30.1330.10
2yydA02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9399 158 328 3.90.650.10
2zodA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9207 45 156 3.30.1330.10
2yydA02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.8853 158 328 3.90.650.10
ID Description Score Start End GO Terms
AF-A0A1Q7UHY3-F1-model_v4 Selenide, water dikinase SelD 0.9937 124 327 GO:0004756
GO:0005524
GO:0005737
GO:0016260
AF-X1G5E3-F1-model_v4 PurM-like N-terminal domain-containing protein 0.9861 44 179 GO:0004756
GO:0005524
GO:0005737
GO:0016260
AF-A0A383A3I7-F1-model_v4 PurM-like N-terminal domain-containing protein 0.9815 33 218 GO:0004756
GO:0005524
GO:0005737
GO:0016260
AF-A6BIM7-F1-model_v4 Selenide, water dikinase (EC 2.7.9.3) 0.9769 60 328 GO:0004756
GO:0005524
GO:0005737
GO:0016260
AF-A0A4P5V6X6-F1-model_v4 Selenide, water dikinase 0.9754 51 328 GO:0004756
GO:0005524
GO:0005737
GO:0016260

Map